08Xg<  Xg {t tXg@@<@T 08Xg<  Xg {t tXg@@<@TU Xgt`AXgXgXg$h XgXgXgAXgXgXgvA.XgXgXgX`hAXgXgXgwAXgXgXgoAXgXgXgwAXgXgXgAXgXgXgAXgXgXgmDXgXgXg (08@HPX`hpx$XgXgXg(08@HPX`hpN$)XgXgXgxK$(XgXgXgM$CXgXgXg (08@HPFAXgXgXgCXgXgXgAXgXgXgAXgXgXg!XgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXgaXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg!XgXgXg4!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg B!XgXgXg B!XgXgXg!XgXgXg"!XgXgXg"!XgXgXg"aXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXgaXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg!XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg?\!XgXgXg>\!XgXgXg=\!XgXgXg<\!XgXgXg;\!XgXgXg:\!XgXgXg9\!XgXgXg8\!XgXgXg?\!XgXgXg>\!XgXgXg=\!XgXgXg<\!XgXgXg;\!XgXgXg:\!XgXgXg9\!XgXgXg8\!XgXgXg:\!XgXgXg7\!XgXgXg6\!XgXgXg5\!XgXgXg4\!XgXgXg3\!XgXgXg2\!XgXgXg1\!XgXgXg0\!XgXgXg7\!XgXgXg6\!XgXgXg5\!XgXgXg4\!XgXgXg3\!XgXgXg2\!XgXgXg1\!XgXgXg0\!XgXgXg2\!XgXgXg/\!XgXgXg.\!XgXgXg-\!XgXgXg,\!XgXgXg+\!XgXgXg*\!XgXgXg)\!XgXgXg(\!XgXgXg/\!XgXgXg.\!XgXgXg-\!XgXgXg,\!XgXgXg+\!XgXgXg*\!XgXgXg)\!XgXgXg(\!XgXgXg*\!XgXgXg'\!XgXgXg&\!XgXgXg%\!XgXgXg$\!XgXgXg#\!XgXgXg"\!XgXgXg!\!XgXgXg \!XgXgXg'\!XgXgXg&\!XgXgXg%\!XgXgXg$\!XgXgXg#\!XgXgXg"\!XgXgXg!\!XgXgXg \!XgXgXg"\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg \!XgXgXg \!XgXgXg \!XgXgXg \!XgXgXg \!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg \!XgXgXg \!XgXgXg \!XgXgXg \!XgXgXg \!XgXgXg\!XgXgXg \!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg\!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg !XgXgXg!XgXgXg !XgXgXg!XgXgXg!XgXgXg$!XgXgXg4!XgXgXg!XgXgXg!XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg !XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXg!XgXgXgaXgXgXgaXgXgXg!XgXgXg!XgXgXg!XgXgXgaXgXgXg aXgXgXgaXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXg?\aXgXgXg>\aXgXgXg=\aXgXgXg<\aXgXgXg;\aXgXgXg:\aXgXgXg9\aXgXgXg8\aXgXgXg?\aXgXgXg>\aXgXgXg=\aXgXgXg<\aXgXgXg;\aXgXgXg:\aXgXgXg9\aXgXgXg8\aXgXgXg:\aXgXgXg7\aXgXgXg6\aXgXgXg5\aXgXgXg4\aXgXgXg3\aXgXgXg2\aXgXgXg1\aXgXgXg0\aXgXgXg7\aXgXgXg6\aXgXgXg5\aXgXgXg4\aXgXgXg3\aXgXgXg2\aXgXgXg1\aXgXgXg0\aXgXgXg2\aXgXgXg/\aXgXgXg.\aXgXgXg-\aXgXgXg,\aXgXgXg+\aXgXgXg*\aXgXgXg)\aXgXgXg(\aXgXgXg/\aXgXgXg.\aXgXgXg-\aXgXgXg,\aXgXgXg+\aXgXgXg*\aXgXgXg)\aXgXgXg(\aXgXgXg*\aXgXgXg'\aXgXgXg&\aXgXgXg%\aXgXgXg$\aXgXgXg#\aXgXgXg"\aXgXgXg!\aXgXgXg \aXgXgXg'\aXgXgXg&\aXgXgXg%\aXgXgXg$\aXgXgXg#\aXgXgXg"\aXgXgXg!\aXgXgXg \aXgXgXg"\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg \aXgXgXg \aXgXgXg \aXgXgXg \aXgXgXg \aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg \aXgXgXg \aXgXgXg \aXgXgXg \aXgXgXg \aXgXgXg\aXgXgXg \aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\aXgXgXg\ !XgXgXgi!XgXgXg!XgXgXg!XgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXg aXgXgXgaXgXgXg aXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg!XgXgXg!XgXgXgaXgXgXgaXgXgXg!XgXgXg!XgXgXg!XgXgXg B!XgXgXg B!XgXgXg!XgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXgaXgXgXg!XgXgXg!XgXgXgaXgXgXg aXgXgXgaXgXgXg aXgXgXgaXgXgXgaXgXgXgXgXgXgbpf!XgXgXg $XgXgXgp$XgXgXgV$>XgXgXgs$XgXgXgx$sXgXgXgz$XgXgXgAXgXgXgm XgXgXg$XgXgXg $XgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgAXgXgXgn]'}Z+Ov a.}][wJO-X^i+/f 5~LлG䄎2o Xh4@W%r!/`5EA]L/{Fa+D,&;tzA=B#`'c`)nVK'Nag^~)8 ~ _;U~-17F 7&[RRSumk1r $-ge2[P+ {a |*PA1x%rS>WZ `\gi_+3j_m_Ys%B$;j8wp8j ^ʍCX'`cJD<XV2P3T"C@okf#mۻ8VXuNiqnxY4XYV+u*9` Ev&] 4ItiXD#TTZ,/2g’Tt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4D4 (AALLAANetBSDpmAPaX NetBSDearmv7hf3D0D 0p@-7(IѸ@`VФ3h>F+`fpywh+iK8F[ "oȿ+aoXF&`P;HYFF3h+)FXF[Z, I I#hZF8FD[( Dљ|c XT}T, ZTvT rT Kn:f*oB² *I[񏻚mQeppG 8 ?IFFH# "|T Jh3`pGH -pCF-FK"F)F0F`$ A @FIF( e KA1 I H! {z"h#NpY@H jW 0p FFmF@)F0F H1F p Xh-ApG#sFF `.=0F[8FX?h+J$h#@c`.2Щh0F[,(C+I+H O$)KEp?n9F.20F[0*?bh-+.IHh$,HZF(ѩhHZ(ѷ OH)F($ I$HJ O FH[00+.j"X\ ,XXK-OhFH[I ZF(~ЎIH$x!Fj"FZAF KXph+KJhhCЅK+@Kh+0yH [0nvI|H0FZ+nvKh+FuMmJ tI(F#80;0+ PF.Fđ(F (0OUK ]Y/!oCFO2H#"#&K ]YH0!?#F "HK]Y0!?#F "HKK]Y/!H0! KFh[ ?#H" K]/!Y/! KFh[ ?#H" K]/!YH0!oCFO2 H##"KC8 "]Y0!?#"F HKF`  F" ZnDIOr-C#BL#FAI88#V#hX;JB#CS#`#hY_5H#h4J@*D)71I 8F)F .I:F =!;*F*IF#;Cx'I*F#"IF","hhBIhC#`Ch8FGJKFJ`! KC#C#`#`LKKIK/!/!H0!#=ZZZAZTZnZ)C0!Zq 8KLhMchk`#B#A khc`##81bh;a??xE][0!H0!/!KQKpGH0!/!J I쪏rTJ I rTkF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G???h+#jCrTm8@F8"iFh Z>` Fp/!K-O(MVzLFF+N#mK 1FCEr =2DK2#Rc V#BsCai i8i#iDca.#RQ@F=C@YI" OZ V3B\(#RСl'k jG??bkHI BFGHQFe(sFFCbkAI >6h+bk=I'FP&2A&2 #=`$2 B$22B2&2DINEB&2 #BB23B2U23B2M23BEE2?B#k 03ak#H0V#k[bk Ik FF/![D[/!h[rTz[[*R*xBxKp p: F F*2 1L3 L L L L  L L  L L L L L L LL LB ў-CmL2C "kI Y2CgI" Y!ZOzw aH! sT\LAqSeUls Euad!V#&%#######EJ"B ; F Y #RQ#C\Mb/!@\l\6\|\\\ F F ZB-G*L!jc RkCk3&%3D jjG?? bj IxO dOE;h+;;`k2F!hj[jG(#j6Ѧi= I 0[պO ajHFH0!rTn\/!𵅰4L%j #KC3k!j DjG??bj 'ID#0kji!IG(ki!h[jjG( 5F #Bv#0kI'jiG0 O #BvҢi8F!h5FBBв.F/!rTmF J h!!B "JF`!FH"d0!T]-OFTMF0+FА8+BJ!@ A"0+>Уh!Hch"6#H####"(oH## #"o"hH"#H##" Ma!@ B9 0 / '+ 0@0M0aܳгo$0+[ЃK0#0#+`O~KI~K0 #0 {K{H*F:+h!F۰O6;+`B=)E(0+I+h9FlJlH2lJ2 2:FiK",0;gKgJhH #F"fH|)eK0 #cIb;+`B*`)]I *`B*`)аoаTH"`6X h ! #f C 0+$03DK@A!DJDH=zAK@B!>Jh/Or_Esy9FXF<AFFF(Fhp5IF5H!v5H .i B8@B/O5F5D;h)F3;`=>hM$IF$H!R%H;h;;`+"Kh w ;h P;;`+Khԛԣj2F k!! (ۆB >h IF H! H2 kB2#U0!~a a2!ah2!aF K FBhBP00BHo0!a2N2I3L5hk3`KkB20Jhg"h'B Kc"`5`-H)Kh? h3'OhFO Jc'`B ۼЃB#DKc'`h;O cO 'hB*h;"FFJc F!`B/ p"`Hch3'  h2!0!nx2!h2!8FM(hJh#`\`h`3`+h``3+`8|2!x2!-CF JFCFF3:x *ѧoCB/H(FB =h2*IF*H!8*H (Lij˱"!( =hIFH!Hj#aj2F!@F:(ۆB =h IF H!H(F.a} Hxca~a a0!aa#J#p? `"J`YfF H K(FF(F:J*F +\|2!db~a ah2!{b~b82!4! 2!p%NL3h`h3U3``%`H3he`;3`[Kh p p2!82!h2!-GF'L#hx . .$HoF(#h||xBN3#`0h%6hF0B FhF(0#!i #"#QFF(F[ B$h6 F(ں2!bp2!t2!2! Kn:f*oB (КmQeppGIY 8 -OFܑ&nLء0F+V8FFh]ѻ`+Z"h E򔀶F`hOz  D0QF30i(o=hxUIFUH!~UH"0;0S@ 0;0+JKhGԛchUFK"`6{h;{`+8F,&;hZ:`x - B@E0FD30AF(=h#+IF+H!(*H0;0+8&Kh K0;0+KhԚ -chUFch" Kh˱h8້[=zh IF H! Ho@F.ch "U#`T2!~a ah2!2!b`5!2!-OFZMFYNh|3hVK#`3`0 \$PO#F'EK,g+]+REIFH3h+XЪhh:hhh2:`#;h;;`3 i#U>`T2!2!~a ah2!db2!4!-OFFFF(H% N&DB { x405BI%H x ^+\(\  HYF9( 5O500 x00 x00c8 ccnc8I"@ h#jF ` IX( ۽0+;J`0+;JS`]h2!ht@n KZh B)iBHo h2!a-GF&MFliPO +iBkic!Ho Fki+Ж+i+$4tki+.,<ki+,i FFMF(Ыi+ #"#AFF8F(kiBѾh2!c-CFF0HfoL0B̿H F FFB (F()i;F"F@ (-hLFah2!KJh30 H-oa9 Ki" 2 #Da , ch2!B Kh30a8Ki@[Ho, h2!c-CqMԁli p;xY2I +"(7p )(((iiiiiiiiii^.30-.^. LD"0x?.. .@ 300xA2@ (I<~#EI "`DCF;33fa0(Abi Fo(:#10;0+\ h68ѽ(FF(K+ih;DB:ݳ y IF2 <hIFHH0;0#h  q0h;0##hԘQF*i8D;^+i-hDVo h2!>\~a aF-Ljp/1QXibB?+D",(Fw09F30|F<"hIFHH50;0+#h  0jp;0+#hԛ2x\*rx6/*6h2!~a a-G#Ll2CЬH!YF on B;@B0 F5D30)F <hIFH H0;0+#h C 0nP;0##hԙ1%@!"p x +8"B@B0.F6D301F(0b;0##hԚ*Fo;P1Q"ZU8x!XBXAt!+@%+n nB"۵F0Oz  D30QF{(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F~B.n BEE.F0FF6D301F?(?30n`;03#h?>?@0nZ x1ZU1 [x 'H1n`+DBݳv 1F2 (?0n`;03#h??13Np DBvp{0++1Hh2!c~a a~bc04!HF'F8faCB!ݳv 1F2 (?0n`;03#h??1>F+D++Q*>DJ1h8#@ C`'h2! KF1x!+ I:& /! F8 H+  h2!Vc7KL0x +9IKh0xP1E *DH 30 *!i 0x!+0(0/HP-6u0)F30 ;h%IF%H$H0;0+#h B 0P;0##hԛ# x )"TV(QYxTh2!, dd~a aK-AhL0F E2Pi (x /9!ȲY(AY)><<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Z<hHqX<Owb<}%E0 F+n*p*l*0 x + JHEE1 3h(o(FaiF(% F+n*p*l*0 x +1  %(`iE0EEaiF(% F+n*#p*l*0 x +1 (#B3caE0EE!)iah)Hv[x320[ Hn, h2!2dJd]d*F(?r% F+n*=p*3l*60 x +L!i (Y(R(3x 1KN!0Fw(@lJ#1O3`J`5E0EE!+СH"1F63x+Hah)[x320_F(? x!+іH%E0F+n*p*l*0x +ݮ xH"6HVEEQ H!i (Ӯg/ G/(F(ɮV/ (  ( F+n*p*l*0 x + 1)F31zE0EEch+?% F+n*p*l*0 x +hQJx+?yPIPHsE0EEch+?׮% F+n*p*l*0 x +=22+?JE0EEh 3H$%E0 F+n*p*l* 0 x + 1 Jh8EE`iA( % F+n*3p*l*0 x +1 #B?E0E04!nncwddl5!~a aEh _x(%`3F+n*p* l*03x +9FKE0EEaiF("Fn)p)l)0x +vB(%B0BBaiFf(mu7(fch HNh.$#iB? BuۮB% F+n*p*l*0 x +.1 k0F6H#E0EEaiF(%"Fn)p) l) 0x +BB0BBaiF("Fn)p) l) 0x +جB`B0BBch+?N% F+n*p*l*0 x +2^Kh ]Kh2E0EE#ch+?   F;l; ۲+  x +1+2q/iO5[x320]ch #i`3F(?{% F+n*:p*0l*30 x +U1 !3x2!+ ,H"1F63x+1+?4&Nh0F(J?J#iB?F#1AE0EEO%.F0xg*M- *=0: *,; "9F`@80C;h"+>Hb dd)'n04!2!cp*"r*#-0x *-[x +*ѥHٻE0x +2H̻E30EE2E#2D#20b30 i`F0;0+#h  ZB (,#b20;0##hԞ-ArIm(~!2C2 xn+Rp+Al+IaiF^(e% F+n*Lp*Bl*E0 x +?1 |!D#!2rCH2Ճ# #2C22 2C2CE0EEaiF(u(ch+?h.#iB?u% F+n*p*l*0 x +˪1 0FӺE0EEch+?:% F+n*p* l*0 x +E0EEbdH5!Q)300 O5%x320Z:F(?!ich C73 F+n*=p*3l*60 x +W!3x2!+ ВH"1F63x+1+?;NHI#W/F0Fb(K#iB# 9(?E0EE1+?12+,q(o$ch+?  F;l; ۲+  x +gHai `D(0x1;+"Fn)6p),l)/0x +ҩVKhh#iDBFV:&QI "OM`V(`@80:h"+IH.`B0BB%E0 F+n*p*l* 0 x +ch[h4H\EE!ich+?](% F+n*$p*l*0 x +` 0"0d2+fHyE0EEai `DF(Mh"F» H2oC04!2c0ddn2!cFd@'HS+]pGl5!x^+0x]+0x]+ +[+Dx.۲+ JBF/F])ѢB F ) F o-GFP,F#xB +.eJ BS@B4O.F6D;h1F3;`(7:|h,IF,H+H;h;;`)Kh [+\+ 4F( Ht&0Fcx +HF H;hJ`;;`+Khԛ,a*F0F:4K"rU@h+)F0F #G2!~a ah2!fe2!2!l5!,Jphx (*H# ( (L01'H0 Y`[x +ЃBMF pL0Kh۹K&0)F`Kh(J@'00A0a /0(:h( IF H. H2!bl5!}eT5!X5!~a a-O_N`L3hZ2`Yx%)"h5\O%|3hxKEX EF۵F;hOxD3;`AFP:vhKIFKHKH;h;;`HKh xIE33`CHt h  N;h;;`+0ԙ3hZ2`x"h +SU*3hx*P;3`B@B'O.F6D;h1F3;`v(;h;;`+!Khԛ#h"`ZU\+'3h5Z2`x"h + 0oKh+jXX(Н0D< +?Y 0#` 0]FO2!6!2!~a ah2!d3!4! # MF `F`*hx /J`##` (+hx *кB3+`+hx1):$I "`(hn0`@80:h"+H4`og*3+`#2!6!c-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`(;h`;;`+yKhKԛN+i"U=:x&*^  Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`x: h]IF]H]H23h;3`+o FSKh  3h;3`+JKhԙD\3PT\*Yzx 1)S0:BOX E ܤ KFE*i5ܫ Eȿ#D/O q:h2:` :h&IF&H &H;h;;`;h;;`+KhԟՒD\3PTFB@B2h'F7D22`9F(?Z3hp;3`; Kh?j?l +iU446!2!h2!~a a-O} FF#/(Kh#!i #"#i"# F(@2FMF`h7Bf  E?`IDq(i 2 f : huIFHzH : Kh ( : *xKhԙ0+ # " F>(i!F0D: JF F[hK>o HF }  E!IDq(i 2  ( : *TKhԛ0+# " F(i!F0DNF: 2D!x)7DAK? h  EO QFOq1 Di2 3KH:`h0IF0H/Hs0;0+?RC#" !F(? 0;0;Kh?4?6/ 2CH:Q Kh+# "9F Fx(i:F!F0D: J+i# \2!-OO$BLFBMF0&h;#`>K hKE &`S`9Ho h0 `T:FFb >!hFH(+Ji +hO 3+`0FF+h;+`+"Kh A "hFB+h;+`+Khԛ&h  XFF$F(:F1F0F( |2!2!t2!c6!h2!p2!-O[O[N;h3h3sh3VH^oSL#hRK"`T R $0(F30(<+ # # | FOl E ^AKh .3h0sh;`s`0;0+a7KhV  R2 ܾ' `FSXSP ;Dhh0 KhXhhh`X`KhhXh`X` hY` ; =?a [x2!ne6!4!3!h2!|2!2!-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FDF#F6!|2!nx2!-CF LFFh"hB#hO bh8F P#50Fh`0Z"`d1  "`$L(Н IF H H2`h 6!~a a9IFFHp be -O]NF FF3h˹IrhK* FG()FH ;pCO9#`o `Ob)F5oB9?# FUp(pCOгhS FUL(pCO3hkh[+x/+2(FU:H)F FUH(@B3h+@ހ!F(F8(8H"F)F `<(#FyJtOaotOb!F `5D `F(OakJ ` `U(fH)F/!(F騳/! F 逳G9F@F8LFX3i+@׀si+XOX8F6hVIX"F0;0+@F(fF88F (0F'F o3i+@si+shoc)FF[ #FUhP oEE(.#=( ]`UF(ѼB&.#=N ]`Uv((NqBBRBB= ]`ZF)F9 ]c ]`JF!F9 ]c 3i+Ksi+u!F(FU(Mi+T ]WX2-dL"#kG#cchC3B+ ;hS"##\0.+ѻi3k B8F +ˀmsEsBs 8i B8FBs h0B_Ѫj BF7H0ҲCBF#  A h+ii)Vi&J !F X i(j)P+j J !: d XF5 BFPF 5BFF8jpIF5BF3DFF r6!U gggXTzF(ѢF(Ѩ 0YF(`QF 0(Dh`:jJ!F0(D` FajQOsEq7J!5Xj(+?KBsD( !J5>j-+? KBsD-;B//3gVUUU-OFNNFNJF!Fk+"`FF !F 7h/(FOUk'(FFx9h(F9`9h+[1IP0;+R#lal lml l lml%H\ N!j`j-FXF B#sal[\0.+ѳi+"!F(F3l+sk!jPF9F(FDF Fk+)њ!jHF#sc6!gUVggU-GFhFI L 6v(IjF TF 0 J`#3TF#ah'%O JFAF0FCfюKbml C"mCЊHhfK`m3 id#eBaoCC  Co C@M#hE+c)@c(@G#*j+[+Z oKc`l+@rcm+@ph+@n"miKiI* F*F#c.e0F`i#d1G+HO|WdotO #ã`#d#3`ce3m3Oe`#3ced&#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE #"cdff#cdf###`#T6!ht@n gezx\g#`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@9+IF+HJ > E$I8Fj+[b#hA*ѢEEK#n Km KK+++KK#n Km KKKKKI g 7!KgYffeegffeiuEyuo8FKh<jFHD\ D8X7!|^8FKh<jFH D\ D8X7!|^l\m!J@A DOb!FTC9hIFH mBh@AiJ^##TH KJhhC F Kh F!FHrTg vfgP7!T7!,7!K\hjHTHFTX7!vfrThplKJhhCKAh˱K "!!JCS!b0I dHpKNhK*FKhU(OsAq7F F0Fp@T6!6! 7!Tgg7!gg7! Kn:f*oB (КmQeppGIT 8 pC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4H.F3Kh۱3Kh+5 #"2/K!#0,I +H9FD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKh<OsAq7"F F@F9FK0Fhv6!g6! 7!TggP7!T7!L7!\7!7!g7!,7!hF"K(FF  BKh[5B I2`IYBBAI[bBA5B 5Bgh7!p7!8Fh82;CЪi Fij h-GF R~K}Kh F`&h@@@ 2;C0m+#ajoH0mKh+| "''KiJCS!B0dI ibHhTijPFi\Kh#:h!k[Hzh!jXHXKh#hiVHh0C_WѪj#RIв1Ck "NHakLKh+g  IKJJhhCf0F=GKhh;FKh3pCO=hpC O0FV he;K*Oh:K*F9Kh<OsAq7F F8FivI# h ! I!^0?gjH^"I"OHj8FRKhK0FhZp7!(7!g 7!Tgg@7!h7! hhH7!P7!T7!L7!\7!7!g7!D7!,7!6!6!gHK-OFhEiCj3DDKh+DKhñj3DBK FBJBOhhC55;hE FOi9N!i3hB ݉"i2`#h&˹)F@F*FF@F*9F0F#F5OEE1!: C@&06hi "2B  E KajR*h*jJDVEF FO 6!6! 7!L7!\7!n op7!.K-GFhEiCj3D*Kh+*Khj3D(K F(JhhC5y%K5hE FG꽣i)F0F*d'FF0F*%hFG 2;CGE '0ajKj(FFE7hi 66!6! 7!L7!\7!n-CF#Kh Dj4!Kh+!Khj3DKh4.h'lp.C ci2;C/, 7W2k;D B 'L0ijSj0FDh >i6!6! 7!L7!n FFFhFCF L K!hF4 FX(AkD H8h-+5!FH8FS!F(FSFH)Fdsh+?w"F)F Hxp!F(FFjm‘bhsFhFFFS( I 1K(F`I!FUSSXSTp罱S F!LSSDSB#"F1F0F( I!S F)FLS]holhVh{hYh-AMCL'ch+nFAIhjF#%3u`S(7;Jh(FDhOBS(74Jh SO60F M,IjFh#u`3S(7)JhOBS7$JhOBS(mFIhjF#O+S(7J/1F8F"h!I@Fh`jF I#h+Sd(7|kh Jh@Fomhhhh%iUihF;`+ SühZ` "ppG-OFMhASlLO3J``#33#a`0+?bzFK`cahBСi"h+szKh(kyIhS(l7ciuJh hS0O3`#`XOr!0FS(`7jJ3Fh y^#`fKcahCСi)"Or@a0FS(`7\J3Fh Y#`&#`TKcaOr!0FS(`7OJ3Fh >MKca #k`S0O0jpCObi BI_'@IhS~p##a0`+@:K:Jh`:J` #!#a*`*@1Kh1K.`O8#"#h5??7fh+$##aY pD//EKh.A2FHFQF6C9K# !#a*`+c##o7!p:!o!7!ii$oii-oim8@Lc!Pc!h+(-K'gbw`hYi(F"A I j I3 I8Fo7!jkMk!pkjk4K𵅰 * 2MjhB1Jh:*0I  O0ZhZi**9"Z`kh+ 'Ii!`* *"i`Z` !I *@!Y`B(݊BOt'"#h5@)"F3F5hf52)   I#hS(#k`Ot7!o\skl7lm(O-G FuFFO#;!Oxh(.9)0!h5 F)"I9$BqF F!h5) 7Z Jh O0x`a  0+okl7!F8N Fph(%6Ki+<+-t]2I 6-qT#'"h5  7)Jh8FO0p`Bc+ڳj+!I"F!h5x),7Jh K-`t(F!F58CII#h0R(7 Jh M# s`o7!lllmPc!%im=m-O]zOzK F:hX*FtHV20[bS#"F20+:;h+ʀ!0F##eJV|dK:FV<5`J;FLOq]JL3FOQ,@XJXI(Fh ]t0ӱQK!0F##GJMJOQ 30F REKh;h+BK!VhAKBF8FV<5r6JCFLOqnL9J;F0 4O yh&J1Kj!0F:PJ!@FHI  1  L54 FJOqHF0JOQ"f猨3팩F Rng,k\s 7!bmmmmm!Uc!mp:!mXc!om!hc!x>!-CXMYNYLh+#3`30 C#i+NKOOh8h MKMI8hh8h4hIIhR>FhjpCO$2C`iR`@Kh+?Kh+(h(!RFhR`(h("0 C #i+ ,O2H9h)K8h"`4bO3`2C#3`)O#3;hj3b0 CML+h# h#+`;h۱KHh5 塀KOR%hPOI5@F F(FI\ . h4op:!7!!!!n7!\s!6n!>nhc!Xc!Cn!!-AMI Rr(7Jh (" Rb(7zJh xMyLkj`+\0CXH0#rKsHhagiqI8F5(oI8F5(#i3+j9F=hHFgHCgKh;+7eH;]O9h@F4aH1aH.`H+@A:(\I5Rй9h#ZH0O3k`WK"`O60F MSHRHRH0 OH s+ S+ Y+`i(aiHHy+FH2O@9h@FBH@A(4I5(Н0:H0#7I j5H4I53H3@CB/Ht(8!d8#'I0O3k``a#H!Pnjno7!!n$oonn\sNoooo[ p!o$o>\p9pWpppyppV q+qJqdqT!sopKFhC F0O0 `s-OL =OOu-Kh+,I -<,()I"FH0`$Kq"hBFB8 I O0*(>0+I HOq$&H!FiGL#(  W) !FH J`Y PsDrp8!\sqq8!q!-OO 8M$8H+hFFh9FYFE$кXO;XF -I (L)Kh+(I(I FO $@F+hAF#H[jGF0+hiRIJF$HF0 k!F@FG(HFKh+II j*hi!k HG("2"!p8!q\sqrx>!q8!?rer/!MFHF'p1FH*툹h/##p-K)FJ O0 MK0Fu")F!>/#X;9FK JE|#p |>!rp8!rhF;`+ ROhZ` "ppG-OMO3F+h( (+hjG(+h kKhFF+7рL4 F# FF( F((O3uKh F# F(.@΀nI" QHkKh  (ڨ Fp(оbK4+`O"FQ\(6`8ZJh P ;+! FyKHIH#y/+ 8KH34JIFH0/ F FEKh+ F(0K@J+hZFKF F!!!!x^!xN! s|>!}>!!!p8!!8c!!Oa LpBH6 Jh O0p3z p8!&sRCFн@ֿ6jJh  FCsFR06XJ#Fh @WspFRCF6Bh+ ++68iFh(FR0 pCO$ F&p+N+6"`-G( AO;hlG(;hjG( (O +;hIB FlG(UC F(2? F(: FF('! F(!#y/+ 8H2IFH0 KBFHKFlKd0[6Jh ,;hjGI" Qd aU#AW(!x>!|>!}>!8  ls!-O/( /[M+hlG(+hjG(( SKhF[QKhQ6ZOJh MKhùMNT+hjGII" Q (ڷ ++hIB FlG(8KSA F(0KS# F(+Kh+*HQ((O;h C#HQﰹ:h0B`CXRhBAKBA FG(! F(+H+KB!!`ss!x^!!8c! !|>!!b!x>!b!!#y/+ W8tH2tIFH0qO0:hClHQ>0+g;hKB`CXRhBAeKBA[aO;hKaJ+hTZF_H43h [Kh ZKh+ (;4+B +@;+9OHF+5<1YAکP;h+?ٮCO;h+?Ԯ!}>!!b!!!x>!!ds!8c!`s!-GNM,hD( *h\B #h hII$ FlG(+hjG(BO;h+T+h (!8c!! Kh+( (KhlG(۽@ !!-OMM+@BO38F)h1@oF ї;/+*hI >(hK"`>J(F232;Kh+:z(90+?R̐0+?K.Kh#0B&HQZ(00;"KBAKBA%KH4+> +<;+ P( H.P!st6t!x>!!|>!Xtb!b!!!p8!!x^!!!!!!x"FQ,( 528Jh P!xN!8LK#`chKh[hc`bhO IOC O5(F8IOsK``Kh( #D 2(Hc!e!!zttJCFh y 8F  (+5S2J8h _O92BA BCX0)sAF8FD(O9HFYBCX0BB RICF(  Q( 5SJ8h BBBR ICF(!0FQb耻Oy$# -w'.BCX0)s0F-w6Kh /CY 5P2J#h @I#* .32C O0 /Bw0F*F(WJ0h 1cE D-gw*BCX0)sۘT4B I!uvHc!-AFDL- #*s&%' h0B@!DAq#h!Fi*F5F+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF5zF3DaKhYi)0FF)(0"hBDa܈Hc!v!( K$h1T4 JQF 4`D!^xx!xx!-AF FFFFP(@.Kh (BBBB#I2F O0pCOI F3h FP(4J#Fh 6 FPJ(/ !F0FP"(4 F(/J3FAF  !x[yyS0F(4pCO)BCXSh(s RRBA## E `iF(FP0pCO  I*FdO0'0#"#iF(FN/ySF( P Q# 18pG-AFXUd>PF(4">J3Fh nyls!pspG-OFFFF FѤ _0+#`00CEFEF[0hCf#FBF#` ' <*F!F8FBL4&Jx3*/A$*F8F2L)84Jh EKthhDF FI O0IH hj!F0D/z `*D f4F|,zz`!zh!\!d!sF F p$O2O32) 4r J+Fh FO0I"F0FO(4`J+FDz!,z0Fh F(OnO3+` KhSQT"4  3EE#0!-G"]YFi4%/FF _(O SF(RF0FO( (Hx#3B DBCXKhCEBT#I( O0 "]0FO( T4J8h [B`CXRhBBTI(#"0F#2>)T4J8% T\ziqzz-C(M(h #3%Oh$N@Ish;s`+ 0F#CѬO03hZ2`x0B#F4FhcKEUFh"Ui"8F(`( kiSlaki+ (hka+`!! rKJhLh+ ##aCaKhiC@ahc@@`0 In{pFhF# M ]AB FvO@JJ pp{{?K-Ah FS;IBF F FAOV(S 3 #!<!F@"*K*I/F(F F#s#844;+c#ؚj FKѲ3 C "Il CFI Ff4*I B FZ F0# FIN+ I B!F !~aT{{ |||WS 3#F9S(H#~|7F FC1p!x 0?"hF)FhF&)F F0@ODFB*OЙB+0,08FK ,F+0 ,08BA,78a,W88F%)O0BB,;D%)3ѓB;$ (DtOF01W1YpTPBD6 F"D0!3|%CO0 8DEt01TГBpDBҐ0x+FB)F; +-*OF8ЬB;0;ڲ*APqAq@ECO2?oEBpBu7k AaF F;0ֲ . AqAqBAֲ. Aq 3Aa;ڲ* Aq 2AAqO0F8 F;DF)3ѓB;$ (DtOF401W1YpTPBD F"D0!3%CO0 8DEt01TГBKh(  IO2`H !"|-A F̀!,LF!hi(Khh!y `x-(1!q$I `!y9!hH `x!`!!q'!yq;)F0FAOz)F0FAOX9FF08`AFF( J#h&F`FJ7F`!FKJO(FAѽKhKhZQJ)+@K`(P @= hz(;S 5i55555555555555555555555555555555555555}555555555555i5555S5555Y55i5c5g5w5555555555 5!G5`2K(` 0I $0@` 9+K*Khx-*)JYx#``#%K"$K%J`$K$K$KKh+"H(̀K"`"K` 0K"`J#`J`J`!!T!Do \s! Lc!ˀ@o)'7!!7! !!ls!!!psK Kh(C xKK KKJ030Kh0)Kw E  0FOF Ip 9JhF; F Z` ~KJ[KKRKPuKh(?^uK|JI|K}JF{K|JCyK|J@xK{J=vK{J:uKzJ7zK1eKhhK1xK+xKxK`KhvK #0'sI`*+?oJ`oO#< h(RjK"ZakYL#h xCfH `x cK#`bKL"t7^K`(@@ h(@'WK"`VI  ;6%hPI(F1(@ch+{a4;i3;aII1(}i4DIHF1(BIHF8(@JF>Iv| EFO vF(Ѻ%(F.IHF1"h+?bJF*IL(F!)'!!ls7!%T!|!!!7!sssss|sps!dsT!!8 !!Dr!@o*qXTTtI1@;i@FO 3;ax}}I"@F0;i3;a%(FhO F@F^#a")F@F(#VjK#FPyi"(F4(#!(7F ;W[]%hXI(F1(c`h(?4!(ǭ>FRI1(Oeh-?Ю47FQF(F1KI(F6FP*Fph(!{(ڣ>IHF1p=I"HF ! !HF7N 0Fe(?![(0FYF(QF(F1l0F!0+*F7F4!(FF%Kgz;`"J!FO KF(FFAFL3I@J `K`K3@C‚:hIHLMO.@I0;0+򢂰1  qT0S\s8 !n͂ [T!rz*πGEAKN{Z`{)/5;~  &)W"FFK(`? I _7K"F`K"F`KFhK`K"F `KJ`K"F@`K"F`K"Fv`KFvh(ԮNKHh<#/Ffa*Тe_  ) {J!`zJ`0`vJ`wJ`" sJ`sIFfdKhB(FVmK"FV`kK"FF`iK"FF`zF6wT"0aKL#`K`F6d  \I\I\H@#[IXHL#XIUHTIVH0uAKUJUUK"F&`@PK(q LIKIOrF&%HK"F`)KFH0h1j0O30FF~(;I V.Kh ((F5K"F`3K"Fv`1I ;ɻ/K"+KFfKh>(FfLc!ˀ!!)'7!!7! !!!!ps!hsā!!!u!ځ R %T!xc!'!NT!!wh8!ls@oUKh2(FVwQK"FV`qOK"FF`kMK"FF`eKK"H`_IK[HKsAKhGKdFKGJaGKjb# `DK3@bDJ2@?# `AKV#2c# `M.hv#y/+ cy.##q.9I #+`.h  5C!F*F(S4+;+ CA@F(Э CA '8F.BaF8F+#h;#` I:F =I# +x##a ;x{!F8F(%2I:F =/&a*c* C*M* &iFm*&iF$I;F { F#iC#a#И0@F(IBF#iC"aBA I;FBF P Fg#ca Kh` ``hTa,ъvU !-CFK FFh@=00W! Fѹ pI  h(BBѽ@F#eG$0! Lch !@``( IO00!'CK-OF_h/ZX4+K84+FB0CP@ShPF0W!F\F LF#BEBB) i, F(( `U##ca9G&@ ) FI zO0!h @@B,>4+ ## 4i;a+i h0 F 0!R"K-AF\hS8$*-4+);+&B0CX@0F0@ T!@U 5#EBiBB F+ѽ h0u FAp0!K-A\h&T4OV_]/Fi8hY8FV-ѦBѽ0!Lhs!LGP`0I O0JKh S BB L h%K`01#h Jh ) hM> 0!p!!ts Lh !@ o`( IO00!͋ L#h !@=U `( IxO00!P" 09@ @B-O[NF3h+B C PO0B0C XPF0CEBCO#CFGFF(Eh+:0AP"F(@BBX"(SZN a(IhxaB C`E`B0CP>BEB<i  BE""C("FBE/ "X##h a` I *I  ##0!1l Li !@=ma( IO00!-CNiñ%O F@Gi\Yd### hj5B0!-OF-F'K0@=HF0ZX! FSFYEHEBBЛj+0 F `v(H%@ F}I O0!،-AFKFFFiԱ@=F0 T!@jBEBBB(FO0` h: F7 0! pGF!KMFFh{x/+ iF8I*F  MF( FI*F(F: `XI*F  F M@3`## ##07Kiab`! #0!-AMNOilcha3h cjh h\;h C #3### h Kh!j h h Fi0!!pshsls@)s¿@9@@!F$%FB["B8F0D1F F/,FpP%5 D-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, JF(q#"#/P)_2FAFBLU&`##0S' aC'@;#/,#BB 1 Jh #O0 M2FkB1J2FAF(B`CXShBA  1x Jh  F1nJI wTlÍ0!ts-CF*KFh7)I8F] @"W F5 F(70FF `p(F``0G(@h,!h0F/4(fh(F1F/,(0F(F``( I O0LF0F{ FxI0!-F KFFh h@"T @T!h(F/0ah:F(F,0`h0!pF%)O0BB4.3O-..O -HTHTB DEt039TSBD6# F"D0!0 %CO0 p T\TlFF0OpB DB0[(DDK@,-A]\FO. * F7J#hBD",x/+61JkF@   (EO0 ]+]** .& CDl+F]3D,?*D+FV7`\&JkF@  t (JkF@  f u(ڹ JkF@  V f, T\gupFh FF*F3e-p@(e"LF,F hL#(F#`3`pF  FI O`!KhOp!pGO`P!0#L#`\3щhY`ah3!`!`h(̿  0O0 P!8FxO08I"Kȹh2"` I"FOqF(F O0"`xs-ANOtdFȱ%h1F(F/^dh 9F F/XxI#F*F P K J I JO00;+I#F*FK"`GP!\s-AFFOq0F(O0BB! FU0nS #840K;+dK@A@A ` @]K "dFBH]"F (lQ"F<tI" !@|??Dy`" !2B`BPBPBK`PBpBK`PR hK`B 8 &2)1)(4*1y/)CCC"(4#$84K+!ٖ(4/5)#4(4C C(43y/+3#3q `/"CC$"8$K) # #4T0}hYBBU`!BCC(4BCxhX!YBP`B!B \!d!-CXŰF4;+: 9("((Kh;%(FETI( TI(TI(TI(I(`mB#IFD5F6й/ѥ++JѢIBF;+OFF|ẖB yJf(FJ(@#"#(F-6C@ POR80!/B yJD(FJF(@"#(F-C@ POR809F/B y|J (FJF(@܀"#(F-C@ӀNOR9FB /{wJ(FJd(@"#(F-C@xB /xJ(FJb0 EGFy Q8(FOWF:FO JB@i FFREGFy Q8(FOWF:FO JBnѸi FFYEGFy Q8(FOWF:FO JBRѸi FFaEGF{ Q8(FOWF:FO JB6 PN80:F!Hpk FF^ TO 84$  _D WE+ Jkxl<+=+/ Bkxl|+#F Kkxl&+#F Dkxl=+!#F = jx+*k' 5jx-*k( /) -% +# )$ '#F $#F !,FF  , d! ZX!\`!L!FKHhwH!ғKs[hM.h+`K.`0FH"xK*F/8"` F-F F/.hx/(h3IxJ\ HL3(F!FpH!t!Pt ZpFFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,-,FFp-&CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CC)5F-OFFt %*F F,U G9F, &*FFH## ;FG1FF,CMFDFF F(F!FSH!"K𵍰#FF#s,F F;F2FF F(F!F (Р +\9FF F/. TF F F FJ!TF" H!g8 FMh)+8)!FH!-OFFFFO O ,v,~,7,:]H,##LFF$,|",9FHF0#+F F PH:'+عtLH  QD E'G+E)0h+F F'6JOO3#FG70h" z## kK #%#;F1FFHFbC $$##y;F1FFHFQCCn/', JO4$'F$G!E\"bpgH!-OFFFF8##F1+FF F @+ FF m;FBF0FF F  <E - ph!pF Nrhr Kha H`<F (F=p`p Fp@h!s-OFrMkhchaoL #h3#`kh`#k`#h;#`#hKh lh\h"eH ihdH"  aH!F A F8F^N*x09F(`HYK@h3`;x/+oh;F7x*KO0FO5F;h3;`"hFsh@F+gF4K\b;h;;`#2Kh h1`h#hhF( -(FH-hF"Hrh@Fah:";h;;`#0 -!!(F +H! `h!- PH$h`h!(FH+!!! -C FOF^0Pc!N!h)3_{lCP rJSb$qKh -+πlKXj(ʀ,ǀ /`hAF^0hh, `h!^0sjhC$&`h!^0+h+sj+SKh )F Fj)F F@EKh r)F Fp0 h`h!Z^0+h+sj+h,Xtb4Kh PAF F/Kh FAF FN*Kh K`x?L& F+h#` S5Kh +` cz X6J`6J`h1K`)LB hi3az.H & !Ji ;ah L3` K F`K`K`K`+h #`K`Jh;`S Kh*""GKXj  !!|!!!d!\!x!!x!t!FKh+ # BJBBJBAK!h`#8 2+#!J F-hS`I*FF F!U -AF F*tL$>Kh3"1FhFFyah5H 8F A2H 2H )0H1F z.Lk hCh;C`+C g"hhY`*"p hCh;C`+9 Y"hhY` "p4)MH 1FH +h`h3+` cFhFC+h;+`;H  HKh+H1FhZ`hZ`!BZcrT`u!lv|!8FL h0*xxB%+`h8)F*n(4_8FL h@x+xB)F*\`h84_ K "0%h I:0Q;+г(,۝rhs!-CFL%dd#h3#`|-#h;#`Kh˱C0[ChB h;`y8h(5+0F!!!s"K-AFhO6Bt%3xF+BQ:*(l<:+5:)lM+h+r.` F.`F*%*q H9F(.F,F,Fs$!s-A&MX+h3+`|.+h;+`˹KhA~0+ #h`h;` X F2H(tCE?p?-+h*?e+h*?_+Y!F8FQL#h3#`!0F6F *O   "h:"`*Jh*?~  O )  !s\uDbHt!!!-O$&F'FFFFO HF(1   !H ;C3CvK &O h7FFFFh+@oK|BUnL h #h[kH% )(Fb=-R%=H5HGGHHGGGGGGGGGGGGGGGGGGGG%H+H1HGG5H9H#O O O '&$OSк)Vл,!FPF5J/0KRFXFh3+4н 03C,? &Kh+/I h `?d!XF(а0+R#HIHH,н 03!XF!P %F,˜|!!`u̘P!!sp FN!3h33`0F+ +@h +#kh`krhc`3h;3`3Khp@p!!0LFF#h3#`#0 K>00 (F#h;#`;Kh#0@0!Pt!!@0+@h -OOM FFFGF(F"X!hM xc+7CWIЍHp(v(V('O&&/<ЅH+hh+97F+h*`h,l F Hc&H`H]!Fa.+h'*`haH' ~'|! 2TUj~a`u!dřڙV-OaLFaMF#hF(h#h` .؀.:.) .c/.*TI h: `*OkF *Q"MMMMMMMM/M?MBJ z>N(3h33` hxs8H F"O &/*ј0/+ F"pFPF@Fsj,/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZF?B*`8B*`HtT!`!Ptc\-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33` 3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+UT!!!X!7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; ++0# "` FF+&h+x =+T Kh-+x+KhBۛhD: *@;.0+FrBF+F B2 5D;+K 0 ;+ ۲ +0;0#;0&;0\  ` #FT!!!!\HtLt`!EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0D`lh `h`aTF E#x+$Ё+@F  F'0H'령 F@F' p H'LEF(TFF &FT!!ʫX!u M L Nhhha#hh3#`#ho`;#`+3h+!T!!!8F'0b)FF [KjD``b8T!) FOF{;2F6h#9F`F0FFahhh)( 5`.F*h,`#FFF4`&F#h+%`F! ʿh1-OO FFF[غ*Tк?#xGк #x+4#xSE4T& غ\#x+4!xCx$ x۲+?b+ cx;@" 4#x+ #x+4Ax#xQЙB4+4;Cx+*+Ё+*xҲ*?+[+ѠFF8F?*И 4*4"xB)Ё*FbxBИ 4B{x+ѮAx!)^)5у[x.-?l]-!)^)&ц##x+ +cO x;xɲ)@+?J[+5FZ:)5F[;F>F#HI(FX(ШBqx)ѱx)ШB)x?JQ\ BB # psF K .F;]+[E?,7F4`5BЕ  85qE8+\+ F)x-)&ix])#Ё)\)5 k"# |( #6 p(ؿO 5BO 5F0+?ٮOFDF Z-OFF F"#x*+6?+4[+=cx!+^+ѣxx./](@[($Xx:($Xx^](/(3x:+ѳc(ўx+/+3F:(ћx]+竱/+"(3x/( P3狱x(ف+4#x/+:4"TL+FfjxxҲ*ف(1 x+ 1B`j`j)F(EL $BICBx/+E#<F($0B/#<#x+5&kCFF xɲ)ف(F08F./#<x F1xҲ*ف( F+F+AEӯHH& 3(F/+*/#!F<8F@F(Z{.*Ѻ. "@F(.(F$3T![|^!FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$N`hF;C+j`h`#F$h+b*+?+[+3h/j33`kjK&oO`hbahhjhjf#kb3h;3`# Kh +jB"`8h8`Fh(T!!!8FM8+j`h`x,b$hT!-CFxF0۲ +عB1"FO FxV*F !F*FU*ѽ>L .++*- F!xB`   =) ЁB MB*FF !*F+D%++2F5!F Z-Gvtv F FO#00F !( 6F0и/ N F-#<=O3h;3`+K`! *-OF#xF-+ F +@򉀣! *|L[?+v@+0; +m*# "`0FF*h+^x =+Y.@!Khj-gNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h& `^K^K^KC;`#yp@-VKhOJ!bh,KMW;+x+1+hGN;+`+3hZ2`"p+h;+`+3hZ2`"p;h++h;N;+`+d3hZ2`"pC3`#pC3`#p.N=x+0 ;+ +h;+`+3hZ2`"p+h;+`+S3hY1`xpzC3`#psZB2`xp+h;+`+ S3hY1`xpx+ћXZB2`xpNC3`#pm!\`!T!HVLVX!!d!S&0!C#`#pZB"`xpd3۲ +3h;3`++hZ*`p3h;3`+S+hY)`xpx+C+`#pZB*`xpN'M!ud!`!T!\-OF; (CxJ\ O O =!@F&M 3G ОKJ.h[hh<Ѻ _$O &@F.hKFh@ @@ "" h@*"b@F ~K.hh}K@,'0@+!*+Ъ+rH9BFx+к#HHF R&$FO h49`)-)hH(` p ;ܹ 3O̿F"DO  D @ЀMK)hhD)`LI hD `xDJHKA`pEKF?JDFRF@FLDkO ;Lt$[FА'[FF$O @*-Jh*@B@"(--{++++ K  9) 9))ho~H(` p9) )hH(`zA)`!psA)` ZT!`!HtPt`!d!\ * "h:"`**hQ)`"h:"`* *hQ)`jAB*`:B*`\$#"~)hFU(`*["FiL8F!;x+@78F4*@",8FCB[x+@*B$7,tX0;0+70Z "pF ( uC_/0+  F) њ)ښ@)њ =*O(`hI h: `B Q!p'B "p [I h: `* Q!pTI h2 `~B "pNI h: `* Q !phB "p( QB): &/7I h: `* Q!p:B "p,L+1ɲ ) !h9!`)H p h8 `(D@ )p * A!pD@Hh1`f  F)@"F *F@h h F!t!`!uT!HtKh8`(C0kpᮚ ~*ܮ=)+?֮#)F FC0B pTF`!-CF;KFf0 "8L)FhO6Oa05J(#`4Kh;`ih`3;hfCr;h3;` `p#hp;;`++#hZ"` h0* F$AF#j"`+ i)F#j"`i*qh `s`6C#`ik #jG`` bPtT!`!t!@tHtp!"FsKhK@0ٽHt-OOq5L&h02O;h;;`+FP#hZ"`"pP0F5D(F0 h"K(Fh7F F2 #h2D"`:hD;`+ `!J h!h F+F+*ѹ"3D0FY6#h@F=+D#`;h[;` C#`#pT!`!t!gHt-OFذ,NF,OF0 !!O2iF -9h!l:h2:`0`pa0KhUDи+HF")F3h 5`;h;`2h!p#x+H*FI  Ja H KFJF5T!`!Htdu~aDVLt-OFO2vOF4F0 *i5 9!   2 8`p,a0`Kh5DNDN ,},",FO B :h!pRF)F0F}(fфй44tO BӔRF)F0Fb(K#FНB ,* *Fx)22B8FtBRF!F0F@(AbЕB <+ +Fx)33B8FRF!F0F#(#x+44Bӈ,Fuc:h=C3D;`>00B s;?;h<`0;0+ c;`##p;h;;`030)C;`#pT!HtLt`!-CFLFx9h!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FFM FC#`pT!@tHt`!-AF-LFA,H hCh;C`+&"hhY`&O"pB"HAFm hCh;C`+"hhY`&O"pB hZ`W&6%DhZ`W& hCh;C`+ "hhY`6hZ``ugHHKhpGhB`s Kh) Khj3c1 i@ pGh(h pG pG!sKh2`Zh:Z`pG!-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$!!!sK-AhN,j3h'i33`@F%l`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x(h+3h(h#+JF!HFDS"!HFD(@F3h"`Za2hchQiWa Dc`F)F+: * Тh:`* H`"`h!`:`*;#`+#+p#.x+p K03`h Kh.pos!HuduPt\uʚ L#h;#`+chZb`xB#h;#`+ڽ@7!8 L J#hh`hRhaabhZ`#h`O3 ``#3as!FLFI#h3#` "!(FDNN3hh( 7hi`#O`Qa K"``#s`#h;#`3Kh@!ps!!F-N!F3h33`D)H)FDxpCO)"# F&lC!" FD(F I\( FDH)F#" F#&PC FDH)F FTBD H9Fp3h;3`# Kh +!3M!FLF#h3#` . O(F}`% K^`#h;#`8``3Kh@|!!s!pNM4h+hh3+`(Hi#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@Fps!!!KhpGspFNM3hB ЫBѬBHPps!e8ML+hB8s!8FPM+hh(+h`8sKhB`pGs%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` !5rOsFSMhB%RKhRL(i hCsOH!C `0 hKI `U ht(`GHFK"N '8F&7/8FD* `0DhB! ! N! 5OI! EC9hB D0(Nh"F*H 9h h0;(>h"F$HVChB 0FDb0(*h"Fh h0(h"F h! O3#`! ! `!\!sĒu|PtX!ΛF0+gH3K3Hh3KaYC11N% !Ow3h33`B 0B(&K)Hh&KaYC103[h? ѻB5!0(h(ЌFH ;OpO5'Qh сBU`p;3h;3`3 Kh@v!5rO!7!8FM+hB+`Ћ@! F[+h;+`3Kh8@D8!!-OFFF 0hI FOQؐ3QHBݪ IFPhShBE_  ++ +E 90+ і0+k0FЀ Fm0#00CEooKpHhpKr@hZCB_G_'B "-"fJ!$Fh aJ !0XFXF$D  Q=XIXF:O $!FD{ch;c`+ F,#h7/"`!FeH( o# X+" "=J!O#7J!XF5J!XF(OsB "YFb0XF$@D(H@Sch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p:FYF F7&!s5rOZdiwqz0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8FL4F69FPFk(((F&lKC;Ԕ Z) "R,B4HH$s!Ü-G/N0HZ3ic.M/O+h!hP0F#+H+H!1h OA%H2O yC10CE!Ch;C`+#p hY` "p F+hh"[h*`+ HF 1hZ`!T|!5rOҜ`u';MF(F03;D+7Hj(p(g(&'$0Khh[h .H!F`+Kh+KAYC1*H$ FF.)9$H0#N#O0B# cC0F4Xy8hCh;C`+9h0 hB̿ # #P`p;! KCX0hB̿ # #Q`4F |!8!5rOV`uKi !T(@B!JiH#;pG2 pG pG!KF60 Kh Khy Kh KZC200hI FpGPt\!\u!5rO\-GFKM+i+G?_#+a@F;@DO;h3;`(YOhpFkh",`!O O0D"F93k`;h;;`#3Kh }0O! F;h3;`/K0;#0#63Os0h0n. pC;h;;`#Kh Q F0 F40Om QFF'D#F"EPF2B03 *4t!!!PtFJJFFhKF F'-)d` FCKCJ` FAK`/N-?K60+I!F !F !F `-5K60+2KN00˹CF1F C 뭹+K1Fh0'h5@|RF$H0h!F !F K603-K"a-!F |!F xvFpCH)FC8 IH0+/,Т\!|!T!!PtsΛf FF JN js0+ ""BO0CƼ"FPt-OFFF #`iL AFHFFh 'Fh+#h+(F-$0PF300"B.00OKh+OK60+@DE@"P"sGK!Fh0;0+BKh+0ñ !0##FB C )I*#00?#ЬE?O|dE,O4T`$@8`F? OsE!2 O~EtEѐ@D@T`#*#!0DEѲP"y0C0z!\!Pt\u!!!"-GF F F " F(0KN0O &@0B(ڽ'JN *3$N0h,FC0B4hC*F F0 '2h@j"FHIO0C0C0 F64Д0ոД0#0*F!F8FPtsΛ!$!M(F<` M,+hhё xH l(p(Z($$$ K6 "0 D@N0h+h!7hh "FF8Fs+h*`[h+!F?p|!rTPt`u-O%NOF0FF`x-N0۱$en,p,H=hO Khh+-@0+M#KO &h>GջF&_F[Qhh+,O #1"9} *@@\F#"(FF(lH)FX#!(FhH)F0++ F  8h8A2B̦!@FXTKF( [, Ж *!0F F% F(F9hHK60+0Fx ^B4 r O O y@$("0@#!8F0F5ѷB=З0+8F=\F;;j#("F3IAF(FR) 40a0+\FF&Ԁ0+Q8FԀŹ0+0F!t|!Pt!0 ;!KCX!J   0+8F-??"AF(F^CF+З0+8FgpFB5N3h33`F 01K)Fh0'hq@RF*H!F 0+ %K&JhSC JRhB! F! F%0+ Fh3h;3`#Kh (Fp-OsB 0 5OsB-(F'd%!sΛ!5rO!1Ki0H0F -H%+H&1+O0B#(M(hCh;C`+&*hhY` "p!Kh(0'nhOrFH8F51hZ`M F+h3+`a F,+h;+`F# Kh 8 F!ҜrT`usΛ!!HtKhh@}T|! FHe h@pT8L0C1"B ۓPUP-H(F#ca823 ! #-C!F Fo%0.@F+:F* ؀* =*{-آ"۲+N&#:*&S"Ռ%;IQ9DK)">+w++ \*э \"zx#*ѮzxF5K /CFF@Fx0? /CCBЁ""Ȁ)K /CF&KOaO#}"{x +Ѹ!K$"""I JICF%:") }*Ix/ј K$"K""+FP.?M"#>;GНs!ڝ-AOFF,ni+k%h-*7]sEO(( &&XUM"hBJ!(F#h;+h+}HC`h!{HzHh.F`h!vHh%`h!rHrHqHdhhoO=޹ch˱mH hh!+h8F-hfH`h!udH dh5F`H`h!dSHz[Hwh!YhSLHmVHjh!LGHbQHQH]`h!?@HUMHRh!4;HJHHHHHHCh@FH=`h!DHDH4chCNCOh.=H+,h ?H!h0Fh!#h + @F8Fmhh3H}h!vh!rYhr.M"-M"-M" ,M" ,M"+M" J!Yh!V%HR%HP!gXT"%)07K~KD<sJP|\bh szVpF N F=! FnchKdh0F)F Fc0Fydh,ppFN5KFa6 N0+ 2$$!aDi+ <."+*UZpp"pp$i"p!Pt-AF)KFFFh+A*C%KN0+:P!F FBV. Kd F0!F FBH.FKd0 Y!KCPO3C`#r܀/9F܀ FAFB&.Kd.Kd-O\!Pts-AFFF CFЀF:F1F(FA&h0FHF:F(F1F F~-OF-l@ #0NN>MKXO ZhKIKhh 3H30KE"QFhFFp[0+-#x+:"FF2x),/*3 FB(""B#rڿ z%L F%LO hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F&&#cU=FKh+FI FFhZ`! !4!\u@tHt`!!DV!-CF3L&0 6/O?U(FBA(K!hY %HC#HF^0B(1.ܔ^0+P60+Д.0+H6Qi(({ sB-ѽ(Д^p/ J>FhKBKA9F`Pt4u\udu!!px+P(L!#h3#`B`(#h;#`+B"Kh+>нp@PKhSK!#h;#`+M@Ĺ&F L O F0;#0#0p@`&#0@,#$0p!!Pt8!LF#h3#`B( !#h;#`S 8@H)FKh+!!8F F@-`hO 8CH%H8F#0)FFP F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh +hh3+``#h#`+h;+`#Kh z8F@t!!0I " A$2Jhh` D`@tKZh`hhB``Kh`ZhX`apG@t`!pFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@-hs`p!@t`!! Li#h3#`KZ`#h;#`3Kh@ !`!!-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱGļhh"DRi(FJFQFF&#h`+D#`@t!!`! J0 h3` KhD`h `h;`#Kh pG!@t!p M Nh,h( ۴o"Fhh<4`pn+hh; D3`@t`!pMN,h3hZ+hh3` Dp@t`!J hh`#D`J[`@t`!-A$&FU{+@>`oCBHT#,, D4C hp$d5UFF-8F ApG, 4S l)F@FDh(F"F-OK"O&M` #8F5F0Kh+hHp,r,d,+hx.h##8&0F#!H~KHN(F PJ#Fh2`O" # A(F5$N@ 2h22`F{N ;܁O 3hDE#pH"F1h"(hpNU(@ H F#\\+ӹ #FAF(ѝ# >+QKEйIF"xPHIF"xB/LHh:`*F[FF;/?zDHh:`*[FFnF h?g72h_:2`* [FF OQmF Ohh2h`:72`O[F 9!I(h%F:2`*XF0J#5h2`7r23h33`p"(h" " !.!|!4vʫ`!@tHtDV"8(?@F"2/? "1F-A%~L FF(@030AtFAp0;0#rKh QqKhh,|-u^r#,F0:4kDw" ,{4kDx" , O <^r#0+F3jDw!:3jDx!3|kDOHF,\r# 05kDw",5kDx",BH #<=L hj#h[:H&0F%d6H9F5J#xh320Z#!FF x0:ղ-.H!F/_(#*ћ'H!F0 F30Fx0;0&h!FFHCF(F 0;0# Kh CAKh+sz!|!|`u, џ!-O'؂f$=F@FF(1Ē0+:0B6ќKh2-8%/ODFW <+sђL h#h[ՏH&,0FS.a.H.EE'4F [hH+-I@F%$((@FF !;0Բ ,ٛvHAF?z sHAFC 3Cz O0oAZF$Bq ӫG w iFA0l&h/F_HiF AW<,FW YHH) oCE?0MH !PF 7^oBE? BH !PFH) 7, FAF$FF FXFF7,# FAF$FF FXFFO4oGDFGF ЩHG G iFAr(&FhF!HM 0+ K`cGoCB?HSHG # F9F$^F FHAH!F|!U`u  =*hLP! Uvpb :*# p;;+pG8?  pG+B pG7#Fx0; + "$zB xZCO5ABAH!FH!F0jUx0; +?+ pG pG8F"FFI(F~鸱I"F(Fx鈱, I(FP+x0; +(F8 8  KqUy]"FFgy24Bl*DqPt8LM6N+xñv@A4A^A4A,pA,KI"F(FH8@8PtH!-C FMMF(l)>KH,FJNJIHH#h3y@F#y\4IF74/BL hCh;C`+"hhY`=N$=O " p)h9y@F* 2F:F45,ѽhZ`1H+N0O؀yyB*h\@F45,$L hCh;C`+ U"hhY` "p*y8FhZ`)I$hF F4y4,Ѽ $&U6A8F$ !F0FC 6.K:F H]Pt`u¡ҡڡ KF $yBѽ@0(KHY\tPt8Fych=U h8@𶸉8-AF T 0F0+р'======e=====;=$9==========X=7V='F?'O MF0 +0  OEѫ (@H_'(#Р0/0+-H_'(@>^0300h Q_,K] ;+#h;#`#;#hEF;#`Z0X0+0_ OF#hEF;#`#??;+`(H\('2\(!'{Ht@t]`! [^!!c\4usH?('U'V'TA+7Ya+WP/-٥XCo}H#h +F"ho2"` ?b? Eɲ )#h!;#`!hF9!`+?0"`* b Bɲ )#h!;#`!h9!`p?Eɲ )]!h1!`!Yp#h;#`H"` b 2Bɲ )#h!;#`!h9!`pA?Ҳ *Z"h 2"`Xp#h;#`Epɲ )U!h1!`!Qp"h:"`;5oK"`*b BBɲ )#h!;#`!h9!`1pAҲ *Z"h 2"`Xp#h;#`pA۲ +S#h 3#`Pp"h:"`pR0H-j"`b bBɲ )#h!;#`!h9!`pBBɲ )Y!h 1!`Xp#h;#`3 pCҲ *J"h 2"`Hp!h9!`p ' '''\(B? (0300h ' ' ?'3D[#h;#`#;#hEF;#`{dfE #hEF;#`\#;V ( 0300k2cshZ:\(`(}(ۉ˱I²#h \; 9) #`#;#hEF;#`+%$("(ћ+#h";#`CF+"h:"`\" Fqh)EF#`#;#h;#` #M3DB*#h;#`#;0FChFF`"EFZ*ۉ+?t0FChFhqKB#hEF;#`#3D12#h;#`p[ #h0F;#`#0F0F]IChFF`"Z#h;#`# [0F#h;#`#F0@F((F@u((@fr#h;#`#F;sh[#h ";3DۉS0F'n#h;F#`(FpIFU#h;3D23Dc#hEF;#`{sh:<)(F.@F&rh;EFK0F5#h;#`#;pF #h;#`#AF0F3Dۉ+S?sh HhB0FHMF\^] [HB#0FH݉M0F0 Hc#h;#`+DۜK[hsh+C'<+=+:#x X#xF+D Fh0BF`ڊKhBȿ`>/D,$>(H#+`00F`]b0 a)F Ff(@0@FbbU00Fa0 0O2`+hKhB`>/O4<(>(3&(3#+`'|(#&(##+`#'+` ` 0 (j]`a0j-("`$t`##+` F#)F#h{(3=J\V{/#`OO ;3Kh#h3#`$i#(Fld}(F*K\ 'Hh00XM}(F/FO MK]hOh:`*E{5K*\Fh:`*O=eEF+@Ӏ%/Ā:/a#/mO^HtL! Z, `!P!HHIF0pFCpIO :sF0 (h:`* {sKFР0 *٧WF :`pgKFO B="cKF+F`H l]KO ]KZH9F `WK(h:`*@{h:`*4O {OshZ  I JJ)OhJI@ C ST0F ChFډځO;IZ`FFOVB  }/ h#':`* O {FO FC ST?'(rhhJB0F#`#pIChFF`"Z#`$#p7#h"";#`Bp0F J!ChF`"ف!`!UWTWHt^\ [-G0h $i4&F0h *h4D`h3 0 khhZBZA F Fkh`Fh+0"F!i5"QF0ij``54u](OK0h!UKKP0 GK h  C BK h #F|(P8K:M$!F`6K`+`"F3IY*hj; )3,I)Mi!   2#KF$Kh K`K K`K`+Fa0K`K  K` K` Kh+!# KK|!Ptt!4u]Ht!T-GM"+ha# (%*hSi3Sa(v"dd|+h[j;` O F F``` 0 Y`( +hi* M  +h F ;Fp` 3`" Zi2Za +hi+ # #F` `` ` : (+hji8XH^ #`F+hik`a+hi *j*NIi"J(+ y#`IK`#`C`+hkai``:*Zi2Za+hk0` (!1`c`+hiZ* ;nF+ +h"a(( ! & `0F[& 2*h #`Fkk` j+hk``/.h3i +Ii"IO0O +hi*" "ak #FJ;F+hi++hi * ! 4u˥8ukS+hFn( +hi*! vk 3a3+h"`aW(Р +! b ( #3`+hE &F` #```! +ha, (0*hSi3Sa#;`%#h+ #4F` K0F ( +*h8FSi3SaF F+h[j;`EPt-AF?MO$+h+h (k8`F+hi(Oi )\j4`&)G2B±Zi2ZaO #`F+h`k`a%O F+hh:h0FZcH0Fbh/!TFH*h##`;hk#a+h``^c FYi1Ya*)O04us-A"%0aW(< Si3Sa~FK( "#F# F`F` &FFd``4`0(>F##` Si3SaM VF0FL5(є0+H;Pt4u8!M*hQaa` +h$`(*h Si3Sa+hh+hiH$H8 F4u&"FUpGChBhKFhpGCh hhBpGh!F FFFch```v`FhF>(!H!K7ih8FBȿ`F F9F F >!"FF(>! "! "!F"! "!F "1i*F F>@uKXh8 pG!F FF)O> FBѰB0F>K FhB`)F0F>B, #Rh*F1FFHi F>fH#F*F1F@u4-AFDh FOt`{h;{`-- FDFh(F>-h!KpFh FB`hB`BF>#"!F(FAB "h(F>0F!FFH Fp@uP8$Mkh +ܿ3k`kh@ , !bF>(+hB(`>K2Kb , $`8d@ugfff!pFNh +JhBh !(F>r KhB`B(F>x Fp"Th+ h +"!(F,F>T"Bh+!P!@u8F FV(KEh``8! KFS 0hhB` F@>.FF!JFhpGhBh!-CFOhFF;h -;`ܿ#KUh;+݀K@i!0F>&tK$`"!Fh~1FFpH0F>mKhB`-iK0+𫀬B{"!>!  F>iOr@!0F>YKV0+5i!0F>CFOr@!iF>l0"h F>"`FK"`"~!h"1FFEHpCO F>"j#`&iOr@aiOr@ !h.=0FE0F`@ *F1FF/Hg - .0s# 0;h;;`#(Kh *'O)F0F "F(h""h*F!FF(F>8EFF/HBO#)F F("hl)FF H)! F>!!@uPtj!pF F FXO0p >!FFH! F=AF-"h! F=BF -"h!FFHH@H@̧p-OF"FFCFD#O"I2F8h J!K!N-FF3h8h[%I"F8hIOhB BFYFhC8hIF EFQFz,h+$ 6-$`u0 T\W>\8 !MFh=BC Ѫh* b ! F=8E KhB`8 !R F=*A " ! F="B" ! F=CH(!@u 8F KhhBVhFhBch)FGh= `8!-OF F C 0 #C`FxKh``ؑ 0tKtJ`0sKqJ`pKhhBnKhB`3h F;+hB FF8 !FFbH! F=("hF@ FEB(` F= Ffr+xh!FuF(x! F=t8(0300 +AK! Fh0BF2=TCF]"@h* * *0"8h!FF2H ! F=6 "$h*"! F=* BP"!(F= " h* 2P*F!F8F0;0#Kh $030BF0Fvh B(!`uxu\uP!L!HR!!@u-O&JMFOFL#f`+`:F F,A L}M+hB|L h#hX@òs+v+tH.`O oI0FFX,СW@FF@FF000+x+@FZ(0B@0B+ѫh+Ъh FIm+H!FH!F#h*ch;c`+ F#hZ"`-"p I FL F\Wg:48F""K,hh hJh*31+/K"`"`8*Qh)Rhx*,h*hx*!" D" K60+,KhK`!!!PtF" F@I F0 F@(O0FP@0J#FH !HHg!FYCh;C`++#hZ"` "pN%O(F1FF F -?- !FH@X!F8FT!%ch5;c`+ F#hZ"` "prT>\-C$MFO+h3+` #;`+h;+` KhC9X0;3hx#0h4!!! Jhp2FX h x3  !F`NF3h+_Kh% [h+x+%%,Eі,2 ,$,,32+l++E$+JKN0HK6 ʹGJh02BK60+32+K++%!2+>++7I%32+JjF! F"x0+,--%! F!0&DR-! F><#>,33)"#`"iF =@%%F%KN R,--ѵ*ٓ60+|+?zBvb #@R CB<!\!Ptx!(-OF F!ѤIh LehI(F F0I(F B(@Àkxp4p+F(@ŀHO #(GehI(F (`HK!hpO PFI(F F(lэNLkh #h3#`hhl!i`g#h;#` 'Kh+8F#h;#`#~Kh 7@/#3`(uO$&FZh[hxm,@qH$0FF@F6@.jHjN$kh{khxc0Fhh FF@F4@,ц&W(3$%FPYOX -V-%^hf,OSH$y(FF8F5@-,HHj4'9I h vF8/P% ''/6.?.԰<ԐO T(?:v?(Fp5K"h5IhYO .%/?a,F %(F4wF8FR ,HF4F0F4hF@FC ,]H,FW/Kh h^(%h+x-+kx+%.?ծ4!xv^`uXT!!!>\R\uBT_'/O D0+?z)HsD'H0C%H0FF#H (()-h030% OZhXh DP!0Fx0;0+9 Kh+?4s0030-(FF~aXTT_!-AFK"`d%N-,ѽA{Yhx3h33`cYBYA+3h;3`#Kh ,5!!!!pF LF#2 ,D2;+!(F!8#2p!KXmh+(x+ pG pG!-C' L N131#rQ3@+1;1qUh-hFX2(FAFF(F>+hF!!K@ 8 !*pG!8F M\2B ! ! ! \B8!Ͱ#IK`"b!*8X"*42d"AKAJd2`K !t *!#`" <=!F< +P "@S  CC !!|!!"K Y!8F I'!F F `]8 8BOrOA X8 M Lh#h3#` 4#`k`#h;#`3Kh8@8Hu!!-AFF F*F1F@F h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] d!x!!PtH!ApF MF+h3+`T+h;+`sKh[p@˾`h 1F7$hp!!sM,hLH0h `#;0p@;h 0Fx0Fh"`` Bkh#0Cc`h#a`5pXX`!Q%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&F|!"FF BhiC՘G(h3DhFKFh(F"F!FeFرCh2CiՐGph4D gh)F8F:0=!8FD F$hh!-C' h=F #xr+&&@FOp:Khh#*F1F FCn(p('% . F&'-*Khh,0 h(F! F c\=+   2FIF F(Ch7 3C߹F#C`Ch#C` H"F5%ChH"F,% Fv(H!F|!Vuzs" FFFChX)> I h2 `#c`Jh;`#Kh Y pHh2`)! DRx I"0F|^ch#c`chCb`ћԠh"h F` !!DV-ANO|@ #heh0m:h@Fh h Fh+Ѩh!"i:@hh0DGkhԨhjhk`h`#i+a`!0uPt-AOMGFFF(F(F`VK'h=U Fv, e, f,&x,O''OGFC/(hAF*C狫|!(ܽ@(H" -CFX FT030;x-+F!|xHM(h*hGI v0t`3`0`;0+w?Kh+sCR"8FF=!8FF8F%A"h##3a%8FBehBh`BB`"B0iC02aC`B*@*% #c`h\=+8FF% rKB 1\=+ 1#30!8Fpch+Cc`0uPt!`!!`!8F F8`h)FC$h8HN(x(I($(F ( M+h*`hH8DDM$!F|!« hxxpG hFxxPxKxpGsF # "` FFF h{ h"+ jfC2s3H!FBxr H!F Khx21 R3B(F1Fp;L, ̰ FiF; L& F;(6BB8BԿ  BA ̰ FiF; L& F;(6BB8B  BA ̰ FiF; L& F;(&BB*BB  F F; I#\Ch @iBѤ5j;B!F; ؿ%hFF(F;8W 3jB8F)FxCx-*xKK"I#`x K " I#+K" I# I(H YYY]X0Fx F!+Cx+x8 '0(F(𔀰0+@P- - - F^ x@ @ x8 -iF F;(E ;(=-` _#)/5_M_AEI___V[!hF<!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s ;B; +x(+ #x)+kxbxCO0 UO0RpFFFF(𙀰0+@𔀰0;+{ "+:IWep)F F@ @ )F F8 )F F)F F(Կ  FF(F FBB  FF(FFBB FF(F FBA FF(F FBA FF(F FBA FF(F FBA)F F)F F)F F,Tcx#x!+ )F0F(  p(++x)+kx 0xkO08 FF$I h X="IT% HD%-011 chx@ 8c`h(0\xx!+ (  (+x)+Sx+H `bdnFH<!Kh \uKhHI3Fh !\uԬ7 "FxJoECAoBAI"F 0S-OF F I,khf/x-*@Zxl*bI*-*(FF(@vJ(F0h320[^F(@>7.mI8h:.>7̑=ȡOU;x%+y8FF(@)h`HO>@FOs*њx*LНYI(FF((F|F(;hB(Fx.ќKJ#xh320Z FZ(Fȿu F+h(?sBK9Fh.(F$0(FTF ;I*F 9H 6HFPhx+I$w F0n# "`8FBxڹOBoBB?IH:FpFxh)I!FXF;p0 *h?IFQFHO,,O!XF;ZIT, !x`uv~aj |qP0"K#J"h!KhF!, F-CFFFL@- H9F%'##a9F H2F&D,D#Hu!j!-O#N(F F3aeKhS#S7`h%! عOO:F!F(FC ќKh-  L(X4#FS+`sa,FkfKhBh+щE4\. " FMKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+z7F^H)Fh8F\IO6DXI F'O4{xxOxp غW غ%9Aڲ*KKH)FX +R#5555+R#5]5552LF\HF<0F\(ɁFO\ ps#;ppuaF1F"F(F!`ux F(()Q ,(.&*Sb FXp'(\("(0 Y>o p Ff n r t v O\ OM ( ^#? F ;HpaF-#(@@^#a e a!F(F=F{pKihL h"h0@(#I SxL`dO `I"df PFd(x!s#;ps `~H#F2F)F@0tL"xI#n`:hvHsCF2F)FpH*aCF"FBF)FkHKl"Fc!(FrcCF"F1FOsBF1FnZJhh(!3`eBF!F^AFF1FUF(Fj"FF(FQFZse"F1FAJFCF1F;aJFCF!F20h(6 x"+'+!FFX0+6L"QF(F#s)e!"F1F # `0h0  hYOO BFKF1FaBFKF!Fr c"F1F(FBFKF1F(FfBFKF!F(FN.ɭB,ƭ$Ki pH!`uP!rT, hh:Dh"-CL0HHAF>F(x+=!F =I"F #;IF(Fc5I Ff(]`i0I FZ;`-I FR(I+I(F`{bl&I F@(8`o2QF F4{`I F,(I(F<b 61h) x[E F(sh;+ I(F$sh;Dt3h+w N.M[SZ``aI$[#K0#M0#P0Cl# CCCdk#cc#bpGj#ABrC##bpG"r#lBl`3CCdB3cK@CcCCd#c#bpG$@ hh:#dBj80]F@k##cfF@k##cdFjhK#I:L#b#`t"pFFH9P! Gv[x\cZcV dT`dPBJeH f 8,"9F(F9L.#bphF@kPF8 #bF@kBF8#bf dH:+v80T@FH:j >kBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I:(I ]t}I :(I nnt I :(I ^ot h"phF F+x-+5 ##bKI # ȱhԢj* H)F$3h2`[hccH)FCh FG pa̰FFFF)h9%x--41hF FTHh9h!9`kh C ;` 5 FD8:h--sh "C68 FhJh@(F b8J8(F$( JD(FT(J<(F<(bcde8FL#h# r##`e`8X!) F2Bh:*J!H2H JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHg`!X!pFM.h6FihH(`pDH. H H!F0H!F+hDX!UrTR-CFFFF<F(F!FBF+Hl.F hHbԐH'ԏHaԍH#ԌHՊHbՉH+sHՃHcՂHՀH{Hv,}Hqg|Hl!zHgyHbwH]"uH,hsHQrHLbpHG'oHBmH=clH8 jH3iH.+eH$cHbH``H"^Hlh\H [HYHO@VHTHh!@@s+JK_G0F.򋂢BHAH ?Hb>HLpHqHFLoHpH@LnHoH:d!mH5mH2lH/lHhkHo3F"4,? F)HNHaHaH`HXHWHWHh.VHVHVH@THTHSHSHߴش%$+*2198A@IHRQ[Zfenmvu~}õµʵɵӵҵ۵ڵ #L:H;H</39H7!L8H8H1cL7H7H+L6H6H%L5H5H5K?F.h0H/L0O&h>0F5,Hch F 4\3F:Fd!.zh\:zBBF !{h8FO 4\BF !FHD ,$pn 7&$#,32;:CBLKS`Z+IFH h K IK( FIH h!  sFF# "`#x#+4 FFh#I"F x+I3F"F (FprTx8Fx;#+MI F`8s(Ѓh`h! hh9ȼFFFF "!F(F<0`02hB" h"++x#hx(иB K0h30@ O O ,  H Kh! "CFh"+I L Fx! H KXh! "CFnh"+I * Fx!#pFLh h#i{B H@F IB F FBFH"#%a#px!B8FL!h!I*F (F:젹 K"y`YaR`"(Z`bya ""`н8@ 48 f^x!0Fh FxC H)F K #`0O3!H)F#`w!-O%}F/F& 0+2H)FV j#@FOr 0)H)F0F } F"JU#B 0+H)F, y *$((#( F  E,9/FB 0+ H*F)D@FG(݆BF FFܓx!`h+ + + H]9+HH]9HHUfpG7 FMjj*I I I0kjB B I"F "FI 0x!(p!Ny8Fx 8 I#\%+5#I#T(FF(\+ L J N O8FT; FT8F1+F1FHBF i J-CFhFx;H1F>K +`/O7/!Hx/)\0`0\CFT0P DD+`H1Fw!ŕx!"-GFcIdHꢈbH*aKbIbIH#j_IZHj]IXH"k\IUHkZISHbkYIPH#akJCBUJUIKHTJH0aoRIFHOJJ0+OIAHKJL0#LI=HGJN0#II9HCJ#m#FI6H?JcmDI2H~Ā'0B *I (HG9̹U<+BaAFHFU   E۲FFȖۖ Lx!6\`Ɨ -OO} JF#wIORuN3j(Fpb sH9FO HF O}+mH9FOFF FmEUd$EFFOJ*OI#JZJ K2EB2UJsj qDBOrhIF0艛hBNIB,QaBDCCh1hCKB$CKBDF]FK ;KB%;KBщ9JB6KB5H"F+FQFp*2[iB 3j+-H"F+F^*2h3(3j+%H"F+FQFL1+?QhH:FQFE1;:h,hOrHF#1JH%Hp!x!ژ}WEVVEW<kD!8 -F FFN%"h*o`0o0 !F(F#5+ { JsjqDB I"F I(F!F x!p!!8F IK(O2 F!8@FE"/K[i+ O2Or8 @x!{F HF  !-O$N4M%FOS-3 @1(I 5#pI \F+:!@Fv(H)FN4F#I ;PF чI@F(?FI@F(u888;x+B0wI@F(OFWFOsBFAFHF(+iHJF)FeI"8FHZ (IF(ѧ j8FNAF8F CIF8FCQF8FCLH:F)F4II@F>XHOO:L ?20+?-E?*"F@F8P)FXF4@F7e3I@F"(iB.H)Fxi0$0 &I@F("#Hz"I@F" H I@FF(GO3F8F 2H;FBF)F:3ex!rF1!Sb!ީ!wTi;I@FFhO3F8F(se}|I@FxFhO3F8F(3fisI@FdFhO3F8Fq(eUjI@FPFpO3F8F](ye@aI@F< _I@F6x"O3F8FC(_sf&VI@F"퀹"OsF8F.(Jp0LI@F FxOsF8F(4r0BI@FFxOsF8F(t08I@FFxOsF8F(v0.I@FFpO3F8F(g$I@FFpO3F8F(ݮg a+ؘ0+HBF)F iBHBF)F/"H#BF)F栚}Ϛݚ/Jj)FĂX CE ,?~)F~E?qIHFX0 Fp## ;6@FJ 0h320[@#@FF5 H)F4!+򅀄K :H)F~4HB  4M[;+FF )FAFP(oHkJ F0 O 0+C;ڲ*?Ĭ+?R#Q70Q70070Q70070000Q7EIHF *F"#EHBF)FDH#o)Fe  KE?(?v)FVKE?=e)FF0ODB?(?W)F7B?t)F(B>b)FODB?W(?.)FB?K)FD KB, x!w!i!Ks&S[}>"1F  F8H`(Fp6 I(F K"1F(FrS$4B3 iA$Kh@84#`O0u8F&L5+5 I2F(Fs($h+ h+H #5sI(FX(HKH]`h(F5 p J I(F@( H2Fx!WEVfdBmdSui:!gddFHBOr F@!KJIXhul!mdF1 BpG3+P@FQ JOa F: x (( ! F^( @pG#pO0  8 L M!hAl8@`H8񜹢h(F| 4u mLKhFJ!h)FI(ݝ0c+ C+S+ HJs+##` m#p"} 1A0MIFhFF( ݝ0Y+ F(H M0!F(FA(HjzKFHhLD!8 mI#F"hFM("iF F m8FMFJ(F>K!F(Fh8@8 D!D! hhmIFFjF0H mkB If (ݝ1Y+cFHrdAǣ*Fgj zF JOazzgzGz z ] 7 FFRFF+x$+kx+_(FBUxT)GB))HQ ;Kh+IФk#"FC##A8C++R#====>=====>=====A=%>cڲ*HHO0F0zg ` Q0 zg    @p"-mLKhFJah)FI (ݝ0n+y+#c` m#Hp"q)u Kn:f*oB (КmQeppGI7 8 -GFF"F )F#F-I H9F+H V HnBFE 4"K$")F8F!FH NFhDBFhO FQFS)`D0FME0F@FB6 &/F EGQ<8 -OF MH FFJH!FqOAF+(#W# ZB𢁰IF(I"HbO [ 6}I";F7C("8Fz2F)F FtMtN)F  Ah1F(kH  (eH4砀0aM^Nj)FB=h1F(YHbWMQNj)FC$h1F(NHbLMEN"k)FG h1F(DHl#cBM8N)FkAh1Ft(9HTc7M,Nbk)FBـh1FZ('H:cc,MNk)FxCh1FB(H"c MNJ )F^G(?1F&(5HD!8 k٤3VqΥ4\}ȤJ04M4N)FL AYp1F(,HL0*M'NN )FB?p1F(!HN0MN"m)FC&h1F(H#eMNbm)F0( 1F( Hpce MߦB`-OMFH@IAW(ЮM.h.Oѝ0+@G0`+@BP`0B:0|VaB  `03Fh3SsEbF”FO0 `I"+(# nGBxI `ȹI""HO0F1FF@kh+ FG 5}JO R `(=ѠDh  F  `QFC?hx4+\ѝ4`+Xو4`0BQSa;RX[hDkB]H a  " aWHy0x|X  FIF  `A?"(CХjkO F [F a??@H aT a"# F)kB7H aO2B{ kAB{-H a"1F 0(K:F(H!Fh>&K[h+?ʮ"O%FO3& B Z B02F;h!F@F%#D65H M٧uk*ݨD!8 p"kMh F0:*F`ڍiBhQ`p0pG07 FNIF쪈 F*KKLILIS" KI" FGI" F!FEH$mCH!FmAH!Fm[>H!F!F j;I Fj9I F*k8I Fk6I Fjk5I Fk3I FH 1I FJ /I FL -I FN +I F*m*I Fjm(I F!F'Hp#Q-;FX!O\5V/9F FB!FH F@7E|l,LVbovɪߪ );[T-OFOFX 0F+a)cбk)`,[FFYFFPFYFdJ@! ` jhkFjFFFPFFmUJ@!XFSI:F F*{ F!*NKOIOIn+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{11?I Fk)_hh(;IF FhhkBA!F+ }kjhKX DD1IB FX 0hhDkB2!F+ d*H!F)O7뉪hk{11$Ih Fk{11 IxhI FrJIk!F* !F k)!F* !F )O7)|l-ū#uثF FF & I( H!FP0B F@72F;F)F F6)9pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q pH8ah Hx"td@#-p:RpF-P"L F"I h jF60bhI .. ahjFHpih "  I h 60bh IkhjFahHx"}d(@@~d(Rd(0 FWIh"hF( I" T MjF I(h6|0#h jhIT50rx"{dЀ -C&@J@OF$ FF#`;`JF)F FC;hB7O%,FE8hIF6D0zh 0Ie(q(O&B#B)F~F(zh !IQyhH> 薹K" FMIKH* Fyh(B (#!F(F6#*##4)' x"1M-V|d(FLI h60bh(FII hOs60ahHg#0F9F2F;FHah x"d@6d@GY-O(-]GLhI F(DћMN2aOR (h1F6f0jhI=i 0 hw! DZ`h+ ]#PFih(4? #TzBFKFXFZ|I FZXvLzI h6(0bhwI FvIHF(mM (h60pI hpC_lJlImH 2D0OS4(hYF60VF&0SD0 0+Oq }Fر#FF7F2FSrcFih2FQHHI(h603jh( ( }AF!( F>Ǽǜ@tF6L hhha@BFih3Hؐؠ,?2#.H̰##ihg#BA$h{"CSr(h2F;F??ihH6GHFzOrAF(h6RHXF`PFx"wd˯xd Rѯ ;Tno8 ?(-A FIh"(4I" !i. "(/I""`hbxFFh'Ih"+ jfC2s3!I .I"`hxFFhIh"+ѷ??I*VMI,(h60#h jh I H6!;Sx"yd m-CFFM$OY!IBF H@Fh48Fh1FG hC6 LMDOch`hBF `0bh I0Hvx"UJFRh I x" (7 FMh I(F^눱 I(FX( K Ih6$0 h 0q)x"wd(7 FMI(h60 hihH&0x"d@IFFHx lr -OFF# HF F 3!E "  (I(FJF60%I O }4(IJF(F60SE K ,F$B$}&IH  EHIFOG#2F(FQD4O D7BG p FF ,KB7+KB@}SB F&IF $KBc#3B F. FJK( FFp@6ĺ Fp@F FH6b F8FFH> Fp@} FRF H$ FHp)Ftcidyaraxrbmnk4FhUqJ1HLhDD"!AF"F*LqO0,ѕq@p8D``?`. h `h%Ch-<` hh##DBO0 q@p8D``?`.2@ D8"K !*03(pG"-AFKFF銁FFAF@3BFI8Dg2FHPDT6KOYh \"DCDSOD$F F\2TDUXDXR$X2[DFX2dFX2dFFD B t EA *FH #FUFLF(F!F ]F"w " ڹ, ' 'sLQ vH\ch;c`+ FFN(F (0I #hZ"`xch;c`+0F|#hZ"`x +% YXBXAp@pG K-OF0NFhB.I uhO DDkB tRF#Fr??O0rhh9FO5\`5shBRFh#FL??`B=Or9F Drhh!F5hshBOpwQ"pFL2sN(Or#21F11U#&2oU'2MIP#3@+B p"'"f "-G FJ?K?H)ؿF1J1Fh}1"F+F8HD1*+2+ 0+b.J9F+H  F)F02XCF/F3FZFQF H1F6"F+F.2Cw#2r"`Y[tmi-xw!?S;C=@#;*"kJU#BR*T=K2+s #F;Nҝ>0)+6J1F6H0Z0)+_1J1F2H&XE#.I/K/H*ȿ F(J1F,HIF#K2+?"JU#B!KJ1F"H!HK2+'*KJ1FH)! |@FI KYF"#KJ1FHHF|4"-սS?;c Ƚ-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA51H1*F1F/Hx1*F1F+HG7l1*F1F'Hd1!1F$H@sD*FX1*F1FHP1*F1F?HH1!1FH@sD*F:1*F1FH41H*F?1FA5C""-EUduо-OF-4cE(~ F30B@0FO A+ x FI "jP жH #QFXF& " *q@ pd `CW@Xr*@ۀBuFJ%FT@lJ%FHFG4i+:H)F8F(F&hOE*E&F F0F!42+@F(F&hVDF F!0F5!H"FHiBHG4 (F$h}E$F F F!GܺFHH"#)F" " GT-iMC C}F!O"OF F0H9FL }\" F8I" F# \"! FK2+h+#9FeH#"i"#BBh#iBF"#0N0LB d2C-I4(+H+J !0(H#B d2CI4(H2 FiB1o"hAE"0H)FROu-h@"0 H#h5;Dw"mdY"6m'"XFi,/iI FHI F I FNh4h<Khñohhv,F h9Fp( Kh+Fh0h9FbF( F$d̷зG"4wF FFF8FT `0FP#`kh````4l`-AFhF FF0F F5)FJ3F)FF@Dh<`F&Fӷ-G]Ki L h)F(dhIK# Kiѹ Oph +`6JOa `0F*#h`+hc$h !F*h O@&4%h$` ;9FvF(D%C$ ]`pKi QnKrJ hrHBFpN0FS%BE 3PF`?,J  {{ Sh+ Sh` Bv(F"F0+-+ =!HFE$4#4;E$4FGHH  {{ 8Li 8 a088C 6H"i/k 4 'Ki[0L 0M*F@A 4@#hX 4@h+T?+h+!H 4AF 3H 4AFH 4AH 4A S FhF(%HG"Tܷ`طR8wvf5DL h O ?* ](?#OrB?{FHKUKpGH"KhpGH"KhpGH"LR F!F   -GFFFN5ILch!hHNhS!hHB 9F0FR-PF{FH4ch{ chS$h!FFH" ~H" R]pG R]pGHR]pG R} :-Gm(FiFAH$@3^B>H5F(F mr@20F9F3%C(!F/H(pCO'0BB'H"FOa030ZF!H!FL3()FNpC_H)F_U"FOa8FFȹH!F F F(-hOa8FFQFHF[,F%|^ֺH".H"rTL` J! HzH]#!H#JnLL"\K4 G 3H"0"Ih 3K! "$`tH"h ! ! `hF Nki(iG3h8+ 33`M"-O$FFK'FBO`FB Oa F;@ pI$H F 'G2h@OaF8H@O \F F#F9FH| +X-]F(/M NO@kiFh'FEF GE% `FH@-kh+hrIrJsK( FrIrHrNlhrOrM,0!h"i) )F1FiH9F$h/i+-#)FrhhGF(ՄBF+=\IJFWHO fh! b(FshOc4CFcQI 300F F3HFJKhCFKDEF x;62`qՠ  0Kh.? FHF2F#` 0B ?3`#%Kir``Zia2Za 0 F(F 2i 0FhRFIFF   0+6h)Fv H)FM"bnrT̻RzT- U>\zd@, 0F>  8F.0FHF0?􀮁EF6h7hJH{iB?h*hBH#!i%+COqB?+=h9I:Hh"iV#*.S`O `##`hK c```h#{a+h;+`*1ji:ja.?~CE{jiBwh6h.Fh+si+0F;a2{Z`bh` i{h{ F{:a.8FF(?HEF?LF5Z?xO vcֻ (IFH r pF7Mðkhsh3$ FCp@pG(0HHHGOqzhKh+5)N)M0FB(Hnkh;k`+)#HvF ,kh;k`+'(Fl (y,&$ Y\B\AhJK)FHhd J+hZ*`x竉դ+hZ*`x +Y,n,N,M" 8 ط𵣰#OFKNh;`3hFH9h" FI I20:h:F F2~H<#;`(FF#(F2 0 3h% (=`rH!F/&0F#3h+ 3h+ 3h3+eHfH~(F"rC(F2+':F(FC;FCz7B3hMHJC~3hHH>6C&(FC3h?H*(F'CD9I X@(F7C&(D! ppC *H,4" ԣ 'I %H$ uD&&wzX(F2?AH^<HZHV#(FC&F&M"M"M"BXzͽ&>p-G FI#F3zOsҝH zkFH)FHF2fBF ЕH(Fz'8F!U*Ѫ)ЌHl"!O3o{d 0g`#`'8F(ЁH9F)|`` }H01F* #aa0jcb"bk}icab*jabezFlH zFgH#iclCcdgl kj( +e*(0* dR\HsjHFjcbc+"h#cZC;Fj#k"hSCBBQHwp1FHFR2CKI"0F NIIp" FFع1ù11U+і1+ і3S3;3U+і3+<8H18I IF(;5K'"hHF3`SS 310K13#kZC;F #k"hSCBB (H0Fz@Fz1FHFR2$C'#k;1c1#d cckO "hHFZCSFck"hSCQEB$Hd@zʾ(DfRRaAU̿AFHF2BѕA0  O"A0 谱akO BH   0BIFPF  e0Fzx@Fzu(Fzrm3H1F%h ik)F@23D f*H)F'HAFcjCbceBF"HjAFclF e opBBdeH2F@sB KR#@r[OsBOr[ HT1"#!e#ef$Dg F F hzaF$H#k%"h8FZC+F"h#kSCBBH0Fz R1F8F2B#hCk8F!"l!"kZC+F"h#kSCBB HR1F8F2#hC0Fz(FzfsFFlFh" B$c+`,h,n3f p o3g,mB  KJ Fl H@2F I 0O3 +`K B4L-GFXFh FF (Fz>8`8H)Fb h#@F UV*F3F:BB HK8hz*m@F"h9hZC2m"hSCB -O$D FFp7m?8Fz FXsH9F(Fz$ F :F!Fsi*xlBkxhѨx@(dOpBx)?)j $;op@B7x)y ,y, ly,Ѭy,,Z( (y(hy(Ѩy()yOHyiy)yxxJIII $lOrB2opBB0O 3mKE+(Fz@FOzOpB op@BЩx3H0Ix0Hx+I{$/lOpO :B   op@BW+QF@0F`JFCF0F7H JFQFC QF`0FJF3m[EDٺx0F73QFH ZFCD  |CTA*FH KH FpGHpGHpGea\B-OFF FFO 'P0BHF )jE!2K P@F 3F8 2 6H9FZF5I ع#I 745  F9FZFF)H)I #j+b#%I2F(+j#bF F!H9FI2F (I 3F9FsBFFHI (I2F(#H FBF9Fv I (I2Fl@]qpF$+mBpkhBыYl`Q`-AFF IFFRF0*F1F8F  IF *F;mB4X*O30`;-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,$٣B b 2 F)FF-HCF*F1F8FI 5RhB)2F,$BH"F)F BF)FHH#F)FCF*F1F8FSIRFF  :mB!chSE =RF1F8FH"I e`tX,V;-OFm hF FF_C8Fy;F@eH9F_&0F:F!.#lfFci!ipp+pOsBopCB m!O|opNB7&FFhCEz(Fz+p!pj`OsBopCB &&l!FPF"r((Fz&2F(FIFxHFzOlX `bEO)rEn2f2 px3lf"Cl1n2fFkFn2f1  Bp3D`n2fI2 3,mPFh"#h+[FYEBH&g:F)FPF1BC-GF` FFF&'#mB #k+kY5!lJq0F$0B' 0# 3+!,0( 9FPFX;F*F!FHFCF+ 6Id0:F)F FF7nB"F-H5-I M!lFhK#mB1n+ X+$J)nHc!FHFC!lJ"mB(+ X+'"mB + X+'#mBn'JH I "m#B/w'iX #d3 X`hO? OBڼB`\&knx05N"-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#BF+FtB@E:FPF1B#E#BFPF+F\B@E H Hk ;:FPF1zBB$YM"-OFFFVF+q/+/H-I EpBlJB@FJAIF1bRF+F`( AB-#B  HH ; +OM"-A#NF/'e 3c~@FN+FB5FAFL|F$h,F ?",+FM"K OpyBh %pGM"-OhF F /Eл@҄ m[E@΄$O3%F'F C D07 *3 X0`3v 3F # ` BBСHn cO3=FsBD00+ @[#  BByH(1Osp 63rx*E*gHF FlHlI (G(1" AF#(11 $(?sE1 "BDDD(1%DD#DspC(1D KK@!JJKHn +II((1C(1 D 3{+@rxQN 2- =F FOr!PF^{ ;+K; # !  ( ! ( ! #KB"HQe ;F/FF[+?@HC-@;F /FF3{ BB%/ ' :F/FF'tN"*M"Or!2{ g3F^ϘBOp0# ()D {Qh)!h'-?ӮHF#"AFO32 +FC%<;Op3-=F qz ). D3sqzDs 3 \ D O D (9Op/@opBL[B_r}CC}Cc_i`/ uOrQFO00\-@O3 ^R`C@fFHNI f(M5wDDvDL opC@FBuuu_#_^5-@4P B8hB`+S`ӱ+FHI +("DDOD 0wwsw#`IF(@-_ 1BŁHFFHI F(\ 1_v_ 3wL opCB~1su1u 1F۲CR/DBڲ B?3- ;F/FF+')0\-?NZF2#AF  +FTC?0 E-1B?(HDD"O1 ;F 1B皹MI00h+?7zFFHb#*P0B[X3 3+ChB?[X\F8HV_F5H=^"3I QF(#spDDDf 3 :_FX)FF&H-F$H$I . PDDwopCwDuw5wvL BOuuu`D+خ-,D+ϮDSp'T[CVIP(AP-;/h_ӱHFFHI DD_D7wvopCL Buwu%D !BmHFF{HyI F 0 1D/F{FqHOrP( xS jH Ch55Sh03h0d BiF^HQ^I i(?Y_%d`DBY@FO3DQ_`5'#F 1JB $DO RP0[E?DZ =FHF#!O31AF +FC!D00ӹ  BBͫ ]$K*F1B$D$@m jhd0]C`Bd`+FFHI (?DD`+ uwwD+ -w P?VpT!EM"-C F#Fi?NOAEF@Fx^F08HAF HFxPF(8FyU1HIFH8FyJ@FyG+HbOr!4clСk)#mB"H3 X( +!ShB khC`5 !縹H"I :k" P F H H M"_|!O8!L5% %" 5F%ѹ 5%UUyy@U8YhZ`F F!`FF Fh)Yh Z`Z`"hM"-CFNFF5F$ FU-28FU%JFi`AFCM"-OFϰ F qIFF(EoN55hEjIjH4 QFdh EO 5jnDB$$5Y hnx7 (YHZ 5 !*$%+mB OIQH; O"x2*$ 41:(hCC@F2#J+Z#BBAHjn@F 0xknB EnOr!3f;F6J !#J7 jnhSCLFF Fl  !P @FC CKvK vlopCB.1#u/1cuL#wL cw21w31wLhC`#T#T#BBHajn@F 0knB jM"gR"L xy# 5M"KpGR"KhpGR"KhpGR"LR FN!F  F -GFFF5ILch!hHhS!hH 9F0F-PFyFHch{ *chSZ$h!FFH R" R]pG R]pGHR]pG R} -Gm(FiFAH$@1B>H5F(F mr@20F9F0%C F0(W(΀xO-T`X.`0f(h5FO`_ph!0&phOr@!0F.#KERE aF(Xp%t#3 F(ڧ-O ""`=J3F!"!0jPIF0R( jh+ F60P+I F08hh F0n&'I F0,(x$## F ]`h0xxO4x -Xhx-0,ۻ-0F F@FpG@pG8F FhHȀ ^((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`   `lwhd   lm(d  lcd `p`lSd mO(e`mKhemGemCeQ BC p`"254S+BE+8#FBT#!A#38 FF    ~8F F#T#E#34+g hfXX\\ H B <|q|pc .cW &Fg fW F cbaXXSBBczgfp j $d$(^(,X, cW F H>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg" !KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3C OsE0F)Fe %`O"j;h]kUC0Fh 2O [br 2PF MTKh*F"QKhFBiYQF[ӈ[Ӏ# 0 #Rcs #*sO 9DO F#cF #爈$oO`FFhF0 Cѽ0[0ch F@ИGF8%J0hC Cѽ0[0*F2FiFF k0NDr#9hOR 0ijKih 0iFi# 0\ FFnZ"W"Z"0Z"4Z"X"8X"pCKHOF^ F)F0+U0[2C ##; lM2HT3C1FC3CO2C@! !H0#X0K0F PhhFi##J2CqыHH(щK"`oPoH0cL0" !zO#?F FRH !ȱvJh3`0tHP"#nH(ѮS  !F@}8yPXFQFT0 + 0PO^p@OHSHtRH(`" !L0#P?f H ![C"#f#X0IF\W",Z"Dw "# "#02 - F)FAC;CO b# F)F#BF?? F#)FBF@^0ZPi )FC3C# F+F H"Fq??FH3FKh+ W"V-G FFF@FE&=L ;KhS:Kx;"9I0FG%#"#F=F-K,KBB7 'I(Kp@OF%HNv"HAF3hSKx- H3hH3hkx`GKlH(K"`-W"W"W"xW"Dw"DX"pG8F M+hkF C +hkn+h!kFi F8$W"Kh @pGK(FhS"!`(C"@S f #3FF 2p(O zEغ $'O'N(M;h1h(hB7d1v+hk#H: F87A?62O`^&0X5X6B?BV`+h;h(`d3;`3h*hY1`B#@W"TZ"`Z"PZ"LZ"\Z"a,Z"8F K Fh KhS" H*F#F#BBh8TZ"`Z"pN3hKMh,hC;+hB 0hv(hv#+`3`pT v`Z"LZ"\Z"K"h pGlZ"-OFH0$ FF+F ChGFXF $ K*jF(@.t0k{0k_oCFOzFB!pI1JFSF"#BAK(FhKh+>ѻB"iR# B#33JC " Di   6E# 0oK!Fh!jhmKBmKhRoBJܸEKۣiO #aO aHih Q;@hC!Oa(FYJXKTHihȱ ! Q+)  hIoYEIK!FhA+HI`FJF@Jih)BS8QhPAѕH0+bV _;K" @@A`##6H A4H(FGt(JhFa )H (J!`S((jo[(FGFТi"a2FKF(FTa Oi 6O #Z",Z"Z"W"DX"@X"-O\$] hF F`+# `v F(0CpL_ Op$(5BOpq ۸Hh<*qۣF2C *n+)F"n .)FOrd :kU(Aq%FFF3B2FZ0@΀+ȀKh8u8@@uD%BrlIm@r ' G BC'bHp+P@/2+/zK"G@A`##uHGtH(@0F+0khCOiHhK"`56 -_Khk#b0+ 4.k #O sCOzaw)t4PwєH0+-w{KK"G@A`##h&H&J1;A11H0+   #o!F(F!Kh˱IOr(FD#p@H(;h+ I" K` |W">W",Z"X"JY"DX"0F FH#r !F(Fx) )HK+0#p#P`K-OhPF F x+$%F F)F $%؂&#Bu8#BB F)F0#ZFFJFO hR Bs>V! .8 &^E(^F0Fu FH F)FxF+4EYh T!S FBĀXhus|K F)Fh C `gFvI ,\5Bii(YCL|hġLsȱPFM08F cK h*+_KzhB#B\HAFYK 2YHUK" zh F)FB5zm 0 #ACq#@ C 0;j;;b4$;4L3B2$ h:`OR 8Khf1Kh#Fa# 0pCOг O?гO#3pi3aO  #34+?|!K9Fhs#3pKh8OO8Fw F)F qKFXFwC"ц#3pdZ"HX"wT3sp8{b(н Oxd80[m   +H HAF8a8baXFO[+KPfW"0Z"-O\FKFPh# 0I#F\Bii&ACCshCsPF0 F (qKh+0+mKbhB#BjH1F$X"!vfK@F9F8UcKhF+@h`h\mX(F ##X0+UKh+SIOr(F@F9FJ#pX0+ #  PDJ1;A11,Rbh@F9K9FB05um O-ACq#k\#kT#j3#b4$34L3B)L$hi2`OR #Kihy0iFui%H P P0+?@ !F?7ohohnV I"hdZ"TZ"U E,Z"X"W"X"8X"Z"Y"W"#h~H7k#h|H0`#hyH)#hwH"i3#hsHhqHt k"1 DB 2 ###hDT@OzsRF  E [Cs+FAlH "#Dd!  #RF+F8KF:FLHch+# 2ChcRC#R@ 0, br4Z0 J H DJz80^Cf!8FD-JpF a` #RH#iSHN%i-@ #l+<HxN%l-@ 0W" !6[y$C^ :JHBch+r%%d%aedl(FhJORfhn fononFn#p00#0 %ShjBOto#0#z0+(H'K"`l+?i#h$H0"HP(?YHx #B"IH,*(?E#hH,\ ;#0F-h:#0F-hA@ht5A_"r|^ܷ-OFH0v+zF3*sɀ*j8F1FF bJv_J1\A +q@#YHMYKh+sXHXO@F+jNKh+TMH2FKFN kBBS;B2FKh;pO#DH( 0?OF+O+h^kOy0FIF"9hHH)F#o0 QOsIq)FF^'Kh32F)HKF#'H\#Hpj(@gpKh+\IOrh5+h^kOy0FIFX"PY"Y"Y"JX"Y"DX"["W"W"W"%DX"0FH0+?"#####ػ H (8fI"fW"Y"K!-OO LMN"hjB3Qk0HHDDLTOO EpBu_X"!@K% K K 0$jB_K`0>\Bii!xCNFWi NwIhNrKEr1 F F*FFB@Np 3BN  -#F*FE9hCBs 4EBT0!FkCFmJ\5B0{#3hlLCs F0i@F Hii%BC0@z+ AFi0@/H)F0B\0CDOF0"0"h*ՀHIF(@ˀF y*>J"7Hq(6J"h*@8F $HFOr;h(I;#0#0 d'J;hhCѽ0[0#Jpy7'3#7DB<#hHJHM(?BF F0 H4Z"W"0Z"[ DX"VJ#` H # 3\Bii+ACC FhNCs0FO i(FK h*+𙀊Kh[KjhB#BІHYF`0+~H# 0KhK 0CK`hC~KhCv}Kh wK\e . jKB `p+~CN2F0d`hNs  @"C@;CAF8d *<$ AC BsUKhVh/@耔 *;j;E +?g:h)Fi`8h6O  # 3\Bii+yCC Fh8OnCs8FO{i2HYF1Kh{iK.Il(aK!h0inKh#i0J\B J&\%KhP(KhBZ" TZ"W" 4[" R]pG R]pGHR]pG R} V-Gm(FiFAH$@)zB>H5F(F mr@20F9F(%CKh *2D8F0*GJ `GJ`e(@JDKh#hC0CY-Ix2F(F h0;H)F0;8H)FAOs5I P3I (2H)F.P-H)F`*H)F4&H)F#H)Fp/H!H)F$Z"Z"LX"j Z"}]lX"W"@["X"xW"Z"W"hZ"F(@]IiK h7B'ЌKh+MHH (AO3O29F F ?@Fpp# 0h (F"zH0+gxH(i#[ ܁rH0+ppH(r#[kkH0+xcH({#[B/":*/*@^H0+XH(@# F#qcqziFBRORH};h+@IH|(@iKH~0+#O #rcrr@F 00I =Hb0+#"ct"t@F000# 0y1HH0+?O2O3! F n#@F00 # 0gH$0+?x7'i#8F;q{q# 0o7TW"PX" XX"@Z"xZ" Z"LBAL+W"[FH;h+?Ri# F#qcq# 0>K"`=Kh=K) OrOb`08H-h7L 5s6 #"''pY+ɲ.kp03B"!p",H@S)H#x%!@(Fn|%K!`F(Fnu#K`,  "HJ#p`J`JZ!)?HHJ+FHZ BH"8#J( "XX"Z"FZ"DZ"W"HZ"T>\cKh IpCO س_гOг_ KhK PBOг@OH$  8 pF KFFh H2F+F!FVHg pW"H3KOp-A$-`0K`0Khk9Foy-H-KOaaOp @aof(%K9F%NaO @ @af!( F( n9FFOpoHF(,(Fn3h4Ean`+`5`]`O 0aѽ,+ѠFpZ"lZ"W"\Z"xZ"Z"-OFBKFFh ;"D;BKF7H"FK!@F :2H'=FB L"FKF@FF(8F AFFKs# B)K(FhIsB) 3D@OsF FF H70DD#Hz@Z"x}hkB$I1 Kax!SaEs#@ @܀ B@Ȁ FAF\5!FHBii)XCAqzKhPFvNAsI;h@F pKh+3h+mK B#BiHIF;h FO vs\H h CTZJ0B   `O@D]E  " MHO~2[Br28hL3 kB]0;02;B220n;0AO3AF39MOR9hi6Kih8FB3h9F8F?i&/H ` F `O  I0%D3BD 3h+?T:hAFL$0 $[$04[4 0b $[ 0 FW"W" Z"TdZ" F%(W(΀mS-T`X.`%j(h5FO`_ph!%&phOr@!%F.#KERE aJ(Xp%t#3 F(ڧ-O ""`=J3F!"!%nPIF%V( nh+ F6%P+I F%<hh F%r&'I F%0(m$## F ]`h%mmO4m -Xhm-%,ۻ-%F F@FKh @pGK "` H(dH((W"W"J>&j|FV^xi!@BK@}1JHp6cEvF5FdF=F|qE$ 5FF EF BuF5F^xpF%+K@,1JH8;ch BhZ`Bh`lX#kYk(bk5B#K@21Jp'xjFKh[Hjl2# Fb#`k3K@!JH k@la";xjF3K@AJH@ml F@lNx-OF-FF# -Nе?9+$+F $<<_<O1FR0FlP`hT@Dh3DP0 0O OshBihPFBB$H& FiA B43BFOL IAQTPFI,qBB K@ 1 Ja"LBAWVx`xqxNBAWxAFPF6I  #k,`40`@0  R#`H`B#803800O/FOs hBji&0FBB47BFOL Y AQPFI80+K@1J|;80h BhZ`Bh`k6I HjO$PFF^PFPFXFO x-GO CiFF j3K@FQJH|O0$kFF+kS(p_kkCE0Fk F#1F(F#JFQF(#IF0F#RFF(?hx-AFCi&F@jF3KOVaJH21F FY K@aQJ:FCF(F (, F$x'-CFCi& F@jFF3K@qQJH1F(FQK@sQJ4DI "FKF8F(#AF8F#kF2F(F(Fx'K-sCFh F N3hBF HKF|BF0hKF!F pa"Z">K-sCFh F N3hBF HKFXBF0hKF!FP pa" Z"oKMxQHN$O+hmB(hPHH( (hN2hR[m8FS4Rh4lX"a"a"L h@j ( hS##`a"7FHh(j,)F0 Fa"8F F'KhñmJh K@"h`B #BB  8@n ,Z"wI"n@ FFFFFIHVH:F1FH읱*FI@ H#"4[IFH>"F@ I# m#*sF FO0O "8h(Fq*xs* jx$$1D 1S*B*jx*8h(1)'DLO2BC;S@۲T#0"x-G'B$0@d%FB#3p70 OD  XOo3сD \O+ 5B d4p?datpp)5B1pdFo5BҌ ?d?a4pqpOq8%FF/F+FOr,.E\& dE"& F+%#F+%+%#F\&pE1%=?ѷ?EҼ @]pG3FS[hk)FF F'0@pGF04[ H ]pG-O!FFFWF@qI(FO0'nI"V逹&ih a F\B 4+gIJF;F(F Fj< 2$XF) F (F#Fh0+4+#(FRIYF$m4B +#(FKI@Fj+ 6AV "#DI(F#CJn#AJ(F>Ie#"B#"(F#JF;F"(?~VO##F(F# F (?f>C@ cVcmXFDp b6Bvb $*J![Fi(FI"(Fi#(?*{a7#mBؾ'F3rT8-O!FFFQF0oI FO0!JU#B4+hI2F;F F(Fj? #pFA\)#32*V6+)YI"# Fy#"S F###"#[((Fj ԫ4+II2F;F F{4+DI"# FpBI2F;F FD#"S F##2F;F'(xs0s+ P [ /I2F;F FEр$* ,! FQ$I,0*+rO FOG(?Aha3` JY FFHFQF F0$d-GFF OaFjF8yԉH1F$#Tet@E#!$4###F840FOcuF31FOb FqI FC" FlI~ Fja"z0gIH4$$pCO(ВbI$B"j0^I$4#]I FHU2C=YIb"T0VIU2C.TIdF4Os$4U2$tCc:F#@FIFC EI:F FB#`EFdU#$t@FIF:F(Fq FFF F F4Ir4CBF0IKF F2F+F F0?_"# F#'0?Q"# FBF?Gȱ! Fбj#R вBs F0?0 F2e#/;d@G^d@uF4BB* I"0 I Fz4 I"F F@"d@"A!F(I FG ! F  I! F ! F4I4j-AF jFjF&1YCh&ae FAF a(F0I(FO09F(F0I0F $ʿ$ Ŀ9!+OտOs Fp!Ap!AOaOq!pGjXm j0pG$4jjPm0pG $4jjPm0pG-O FyF(C#MF!IF0F2FI&(H FFEF;h#h+F,NEIO0 ZFW&06H#hSCFW%02FAFPF5#h ME %!~S, AT|a$$#Q8a#*N FsF7hI;O08FX(2h I(F,#*#s2hI )'Xt-OFF# h*Fs FOUڋj k#*s #@ BO0 0F(0FF (Fi+Wi/TУj BP(sBBD(sBB8?0F9F0F! XFH"QF@FG0F09F0F"QFG0F0ck0Fi I 80$!m#jFJiFXF(-i"AFXF(FFFFO0"1FG Fi0 4"1FjG Fd0 FzkIk -CF F uFCI5O0F$d#HFAF2FCIJFCF F2F#8F)FFFCFFI:F+F/upFaF-OKF Fx 'IhF8FO O !F["`   I"F0FO7D#C C#I `F)'/|FN$O3i4V+)F8F,|K-O FF F"IFF!K    C!x*FH' & )FF F2*F F,KEWJ!v x K*FI(F F*F F F TZ|-OF FF F)B G C -I F pTN)-GF FFF ) FIO0OI$ iFHI:F FOi#"# F#RFCF@ F I:F0Fi\ hV^-O!FHFFkXI FO6F0FAF ! FZF(#" F cPFFцI$3J7O#B3u 0E E sH[CsREz9B: F'i oIWEzMF9WFYhI=OOO FG770$HFigRd F$"8F-OP#HFC FDKF   >JIF0FvCF C:JhB$9J(Ff*l*Y(F@Xp{0I8F.I8FrFx,I:F(F+I i8O0'LO`i"`#I(Fi%DE FZ@2#F!RFI:F(FuDE FD$ ! @4(p(F0ѷ XTTx )'FF (!FFiEX#vT3#3FHCjji F@i-ODFF.,#h  J Bq %  J  FABsD€@F.1SF^I$isiEBEEx(- @ F.QI@Fa%F#bcbั(-IKS -HI@FFKGKS%0{(CJ asF 0 QF(Y bCb#EB aiAYaea&`a`k#M pBB!iMa%a2a iQF2[BB k2ciaCahaeaCi,aa a(FI@F04[ I@F%(F=x}$.-OF, u/"F+FYFxC"F+FKnF;hCD "F+FAF`C "F+FHVF8hC D t/Zлi+@:hzh*rzR LB{q[ k 2 ^ b S BzZۦBzV SO,u "F+F0FQFCECjQD O3OjC WF8F ,u"F+FFC "FC 0F+FIFi  i F F?irF-O iFFFFS sI$O4&F!R_ oIi nIF2F[ 8+i;a+i_a(FFF F1FSFAFZFz hEEТExVI"F3FHF2hF22b63C+i;a+i_a(FTFXFQF@C  ZFF SF F1F4f#Bv,F i8h!yhc F^ -IHFh8aW-ha2b22F2xBstIHFGi IfBq Ia# (hf hhAC+i;a_a(F%FA?Y}iBpGipG Fi(FpG-A|pEnEBEsځi! FiW ФEC Eu  c0n𵋰F$ !FF8(F IO0 J !vX(  FRIFK"F IH$Z I H M NU40F, >I~S^ }*"* IO0**    < *8F FF +6&( *+!#% 8 : *"+J@!HK FI*FC      JR#0 O0[a"`}-O2OCFF@JI0F"%F(FhFJB BCI0F Fh j'FP#F!ECE4+8I*F#0F#(F$$Fjذ O FF0KE Fh} * BCB8%134+ݗ0"+7!J@!!HH K IJF0F IF 0FGC 8H#)F0j$XC"jJ0B;B2 25  7[#0WEV[a"}-O FFF#O BF9F0FBFqKhB(F !(F F2C&hI(FE p, A,f,cI F F s,# (FN0O #j'(Fg#s??4Fjz 0p4+ݚ0"EIQ2BBDK0BIJF(F *J=*?=I#@ BP8   (F0(F0!@"v0Fh#0FAF(F0?(I(F~2*%J@!%H<#K**(+ I(FhKc:F#(FrFK 8H#1F#sD?C3 s6  $A 8x~}X8N[,b"2y-AF)OHhFO NON F)FHI2F F0O0 F0I2F FI;F2FB(F^V5Q-GF F07-4 d1HOF1j$$j(0j#h(F##&##.a#(a F0I:F FO03F FOhF FIKF:F0FVp^-G F-FFuJ(FX?FqI GnKhB FHFF F!^HhI F@F! FO! FI!  FC! F=$" 4;UI4۹XSI4+x("#!yj#BB8IIF FDjBB([ 4! FF(Mџ5"# F C 8I*F3F! F 0ёO "# FF.IIFOrpJU#*F13F#"# FzF F0I F]I FOV瘹#!f Fx0?J4+ 4+"#!TPx )\PKOF FF M    :F1F(FBCF KhB J#iF F| iF F0I  hxKSB@pG#-O F FF   BF9F0FCFJwKhBX+s F'`i+Ui+RaBBL # F# #??FF1 F I FiE 6i2EB [  лz  #4C %-I Fh/hx :F1F F CF\??FF2BB2 A:B; F 0 F{0?x F# I#JF{ x7-OgFW#F FO#JF1F(FC ѡKhBРI zq( s("F FY0O0O# F#"#??FFEA6U#I FW#$$rGaHEq s*F|I3F F! FF [ uI Fj! F oI! FkI4! Fjj Sj z!  Ft 4(_I F4hh BBѸUI F Zj2QI B fEzKI*F3FtF"  EI8 Ez FF3 aEz;I} B A0-vCڸ;=F*F3F! FD0?! F jOf(@#I F$-v BA ڸI F)I F$ )II F-vګ x2In +Fu> I"X>HJ!>_>Hvm#8$!HjHh #RHR |]rTg Kn:f*oB (КmQeppGI  8 𵽰 FFBg( :,468jKH=@ 0>CHH1kF  !AJ@H=>H:H=H8:H:H:H2C3H6H#jT!p RD EB10),H+J,I( F)H=@ Ѻ'Hh $!8m#jF9iF!HJ!#FJH1+є1+HoFH=@ &g7-=L\jxTk8-GFmJF HP~J |HJ|H:(FzJ{KyOFFF$ F m#@F *# @F" i.1FgH#!#"ji &j`J!"3F!B3F:FB" XI""WH"i+Nр!TKB:FRHBBHFOH$ O O@#3!(1$4! ?H qm#8$!<9H8H #R5H$idB-HB:F!v#HbOaPF#1F#"jiN 3i+;+#j83":F!N"HFd#jc d 1bbgrTlb" cRv8T-GāF FF%BF9F FC`KhB"!0F\H;)F0Fl( `(a8 (    %u(x( NI F FEE0F00FZEEE+s0F^!xi+ sBB )0Fi+J +H*J (H(H0F1&J'KFFF/#@F  #@Fz 5 2iPFp * '#)F#:ji6 ?iHFX xx-APF FnFFC 7F+K    h3ScE2FF!K!N2FAF(FCF<I"8FxKhBJ;F FT*l*H O09F F0$ I  F408E yxQ+B@+pG#𵉰3OF FF :F1F(F"C(+s F?!`i+Ei+BvBB<ԱKhB# F#"#)a8 (!$I  F10, F, FCHc i yh `Èˀz rF /0 //B/pG{ {S{{zzSzzӈhJn ]-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8F`p#*F FCjF)F FD'F"iF@FDh#*F FB7/67.0-C FFx[PD FIF[  7"I"F 6 5  3 2 1  . ( ѝ0 00**+4'EF1Fr0#S˄7/O00pFpL&"F@!hF6hF4G. p0FL%O#51F8F6-0IpFL#FD F5`ir)Fp@ p0-A FF(?4;;J044rABOA64N  #38NC0 C8dCS00hF)F#@c0 HOCFI FO0'F:FAF0FI F0FIBI;F FeD0F0 CC0瀜S؀hXr-C FFF(*ICPC #K #    BF1F(FCFKhBJkF FJkF F U*9F0I L F0,y )' FFIhK8SB@|b"FFRKh JS BB KSB@Ihb"-OKFN FOF2F)F FHF3 ѠKhB ПI ?O۾o+;hF($$*ڔK!JHI(XHFCF8FF(M8FI(ƁI(F(@HFIX(Fg2i;+.F4jOswI"F|츱OF1+~F8oIZFP(FlIHF8F!(FhI(Д!(FeI(Д!(FbI(Д!(F_I(Д!(F\I(Д!(FYI(Д!(FVI(Д!(FSI(д!(FPI(д!(FMI(д!(FJI(д!(FGI(иџF()F@F8(  4r 9IRF8FL(?|6i$5IBFPFB(q5j1IhFP0,?f Fa+J!8)I Fv(*m*%K!%J%I F(#I"FXT0)' Hy3Id2cip|pg%C|F(?fF(f5jO h$3j3B >IRF@F(QH A i(DА *=#@;@B7УhW iF/Hh`i# Bx3@C0$I @@BB#H AliOa J#qH^  pFH1FVh`i# Bx3@CP0 I @@BH A:6ѧO6b"@h"T!!!!" !sF J II "(FF$^pah(Fph[x+ F*h`h h$hކ "1Ch/hB(Fu-OFFC BFxJxI |(F9FsJtIFbh hQFhhoI(F8(9НflI(F0F(HiI(F(FVFfI(F FNFbI (F`F(1Ѣn# (F0%NJUISI (FB(0+ѡn)|"l0F60onJIF#  ***ѻ YF[ kױ:I9IRF (AF4I 鯱09F=C"l0Fn꘹"l0F!n0bnl)lckB(Fh1+#o˱!F(FG0mI, "l0F!n0k0Fm0m}|! "4"<"@"H" R"rT"a"""-AF<F$ F8FFȹ FRn1FF8FF0 F(FAF F((FF((FIl]-AFFIjFFNF+ CFO0&8FF(А"!F"9FoI0F&0н #FI@F*"iF0 F@ FFF0#`O0BF?#8F"FF(F2(!n FFFF0#`O0BF?#8F"FF(F2(!H FjFID@#`O0]ΆpF.IjFF.(,K!,J,H,I FJ8xFŔ1)9XBaA;@!F8FI0FF(F`I Fĕ! IFF0FF F-O0pC"""#i0,MP IFC  0 7" Oa2J pM#x7# OaM 2Jp#xc ,M0!F(F. F0D!F(F$ F0Di#Q#f#pIFF (KV!JHD FlFFh3SB"FF IjF(Fx0I p#v#"i#F"!hF2IjF FVC&iIFjF$0KOaJHI F;C!0)PBaA:@ I F0$0O0 &C#"#iisF FIjFCF0F$0K@QJH FFI x1bF JI  I(FJ I Fe p$"ˇ#$.$@"H$7 F F0J II(FF0 K@A J Hb0 F I KF^80ڇR"`$j$#@"<"7 F F0J I0 I I(FtF0 K@1J H"I F&80R"t$H"j$#pIFR@O5#`(F$pdE@-I n(FeFIF I+F0F0 I L IjF0FT$FI Fe$$$$i$𵉰IF 8r#`O0 F0FeFI $FI3F8FZ0 I I8F%V0I Fe(F<*$$i%FPCHHH6]T"% 𵅰  mIF0I 0epFI`I(F0I2%OBȿB p Fe[ N f1F8F5xi .%G%m%rTsFFMF` 1F FQ0I*F ~ FC(  %pFIFF:XjFĕ pIjF(FmF&ĕ !hFIFF0FF(F`R)vi p FIjFF0K@fAJH!F(F0O0 p2*^BbB;B2@ @e !RF(F I FF(F`C C%"#R)8FMICF(F$0 K@1 J Hb) FWI e| 84"j$#$jF IFd8#`O0" F0IH % rTH % IFjF80 K@A J H  I FM0H &%"#i% IFjF0 K@A J H I F#0H &%"&#i%I#jF3I 0%]i$ FIF0K@1JHI F8`$j$/#@"F08 (٣a*أWA*أ=2#`O0P IC C #0I ]i%رL ! !\ J H` "FIHT&&FF J Im!HvONL!(>FHlKI"F(;FH3F0Klƹm!HZJKIDD(F"F H(F sh(FG6h< &yT&&;& &A`pGA`pGA`pGA`pGJF `l `dpGyJF `Qm `SepGyJF `m `epGyJF `Ql `SdpGyJF aQn `3SfpGy8FFH0B#`O080 +$ A;+2#M(F&>(( #,T yCK \b"JFnpG BЀiy-OTOK @@ DPJOx0GI 2(DIHD@E FTFd0gYI n:!#pUJOaoxp#x۹:##pOadp#JJo #x+!FPF F|0D!FPF Fr0DchAF(FG$h7I0F J06I 6Hjd4LH0s(F(0K1I0HTAF(FH0I0{@ƀ`@,ǀh"AF(FGi"9FJnI0IJ0FD0@єIJK) FFiB|!(()i')~iC)K)8)i)i*Y),*D*b"R*i(t(y))9NV#9H`#Jd#R2I3HX#R/I.Hh#R+I)H}j#R'HZ#&Hob#Jf#RIH_\#RIHU^#RIHK P@,?;ch(FG$h0"AF(FG ]k*b*r*|****-OF FF` )F F0?I:F djFhF@9J 9I FF4I FȐ1KO0 F@F|| |'YF8FꐻYFPFP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F (-h. VIhhl%X*1b"8 𵋰FF8FI rI(F@O PIjF(FM    .0h+I I"0F& J IJ;`;h I"F 0 $".Dh"8i(..8. FFm4I#FF J.-CF!I FF0KOqJHN4h NF(FF8F~FȱFHFm,CFJ)FHF$p$(F$dD /H/-GFF|I L0FC BFvJvI \--7U^#`0FO;d-)UI@Fp(OrYB?Q)?) A^ [X\0 X eO " F Fxr(00FdXպ0F(OsX0| X Y*##0FdgO;!"#`O;$ 8FF !YPO;+?2kDҲ^ x X0:,;+?w*lDx ?FF#ΆP40,0a- W<+۲C# FA-7<0< ,`!?[x1F(Fc$JI :i"F( FJI F sh05P.$H$-AFFFF@FB(D#`O0@FJF8 #ji!F8F0h Vc`-OPF%FFFC  GpW;F:F!FXF5g`9hYFhFKFG F5\4 F00K+- FB#`O0(  +-#` -GF FFF#`O0:Dj#!ia00sIFPF8 0h(($h0-+ PF(( iIaiybh*=C$70h( 0h(H` #*<FF)F0F0ck xk`i+aTI Fh#FS0FF$ !FFc 8K`T7`\FF !FFc(KeDa7d-AFFF`i0FFB hcaacd cTF0`ixO05i`ahcaacD-AFF (!FFcF K"1F`FC/:Fa0 Fc%$ F%wl-CF F ,!FFcFFK")F5FC$/2Fb  ;F0 FcO HFt-OF!FFFFFE8hO  B \"`O0tO  :hO  EJTC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F hS1FFGFPFbk  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah+0O0`k$h08F Fc `ciE``a#`a#t F8@O08pư&IF%IF0FF`"I`""Hz#`O0Fp(F8F F4xxFBI Or!hF)F/*("V!F/&*("N IjF0F0 HNl0s0z00Ji0IH̿ 01K!-AmxFOrB8< h1`W>v4CK5( , :1m1Q1)F Fx0+Kh#FB"FH)F@JCxh320x+H&OBb\20 V@# H]8F6, ~1( 1pP( FC C (7#`%(Fp"#, ۴O,F!(F!A\"T`bF(2F Kr"#F FFCF I "8FFI"(Fm*F1F F@ӽ!$"pF FF!"hFjF)F F$p-O<]FF ?J?I  {CF9J;I05J8IOr!z")Fؠ4j <]ah(F F 0+ћ0YF +"OC 0IF8F 0IH$h 3CEњ0Mhx[c@C(ѝ41+ KM I HF "|!111f1i@h"pFHx FCF h++ &pI F"!hF"1FhFm6"x!F*("r IjF(FP0 hh1+bh/+Hj1 i1Kx;@FHnb"1F FF Fgh(F9FD$hhKxB8F( IH¼ 1P A F FFCF I I":( J+yh320[ I"F0F0O0 O02 2, :i"F0J IIjF FB8#`O0 I F0z0I ~ 042@29iH2"F0J IdI F8#`O0 "lxKI F($0 I F50I : 8|!T2@29iH2"C0н0]#H^Jd2\2pGh JB ~BB I H JBFpG JB I H HpG HpG HpGPP2,PP2222hJB~BBrB I H JBFpG JB I H HpG HpG HpG HpG2,22222-O EDFFFF(FBBF)F8FDF' 9^). I2F8F.#P=$/DYFOD vE  c  ءEK<h;Q8FOdF$1:IF0I FI  F^0KOqJH0 F ICF Ht F$i22"2i3PI FC   C #C J I I F0I v8$3i63IFjF0KOqJHVI F0 I  I F0 I F3" 2i2i3-ACI OsF0?J ?I?H # #$C c #c@0O3 1I(FA0Q.I j-H "8"@*JxhY2 R'Bx:*$0$'0;D#DAFP#`O0` 4 ,x+I "$2F!(#F"3a+Ѧ 8U3h3i83p3, y3#I F:0JI tFIhjF I F00I u8(33i3IH񦹐 3-AF-PI°2"F0:69Ԛ9o &&PI .(F$ !( * , . 0 u0𦀝l * pI f&&&lHl m."hI(F#`0,0нb0+aH_I(F#`00нb0+xZHVI(F #`0 0нb@)BkQHvMI(FI#`00нb@)B`IHbP$GI(FF( * , . 0 0(+L ;I(F0@ƀ8I(F06I(F0 3I" F(@OsB-HB*Kx+?{(Hv&Kx+&H#Kx+$HKx+!H H#6I,2(F:.2>02$+*q0/H8i(i44i4444i8iii345b"444455),.,C0C**+-H xh300[Kx:+* 'H"z &H!F&$'i)@F.?<74/?7, imHv;Hp ,HhJF H\OsB HR /, h355$5>5H50 I$jF%DED D D0I(F F0i83P  IjFM C0I ]i3 IF0 KOq J H4 I Fw0I |8"92iR5-AFFFHF FFEO<< rT-O=P I C # D0.OsH0(ڍI *H0'+ @.F##"F(2D !<~(BF'-|K.|H|KFzKzKzKzKzKL(!0!!"FV (kԣ2*O |3 SjJ$;2+Fo  O1 BnzqyOa F]IE#\KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pCK)F@H|!0D"0 +v >+ D '+?o =/ #QJL 33~@B4@B'JأgvA6B$رO &f13?,!!@C;2%2^A$1B٣zcTc2 2PS;I"JoB1FKi+6t6K6y6}6663F6̌h"6b"#x*+؀H+1ٛ *f;'+mLkmQSkkkkkkkkkUkkkkkkkkkkkkkkkWY[]_acegi+R#;s2+(+fx0+𣁛 +#HJ+F cxR!IFHcx 3D 0+ЙI0+ЗIgx&HĂI7B> 4]PFW6"8JFI0+СxH0+#y'FIOHxxcxN;``6vFEݸyyy(yDBPF|7FHFt0+СxpH.0nJB .r؛0+jH!F{hI^HT0+?scHJFF`H@짉_IF8'>ZI_F>F  CD ۲+e7(PH^PF  9FJHJKF0h?KBsBPDJEK`EF@H6 9>I@J@J@JBѣys>I'H0+?"zy:H+v5IH0+?!z 1H0OܐĠ<,6*HOJFRFWFE6566l5d5rT6666P|77 77t557 2,z55P&7+7D7DR72T666P5CIDHP0+?oa ?HF FF';IF 9'7I  FFF ODo#+d8)PF  8F(H(KF0h'KBsB#J$K`EFH6 :IJJHbx!F2HHHHHHHHHHHHHHHH7rT 77t55 2,z55555555555555665"660P%C   FICFHx F 0,Fi7  IF<(K!JH ! F7"T2  IF(K!JH ! F7"`20" F!" H  0@n"!(F( ObiF F( H F  0@0+ѝ0+ѽ0i+770IFjFvBF H F%00I (F$(F7i77  IF0 K@A J H I! F+0I l  8"l28  IF0 KOq J H ! F0I D 8"v2+8K"`pGpG O4S+2h @pGSBDSA"D Rbb]pGFbFH F(\Jh+`h" Rbb ]pG Rbb]pGK[h" ##!##3b0HO0]h"mF,! H! FC H!F jX0H!F pp(eK%[hӱBF! #*F#!+F0!FXH@$  % U UH FB0FHFLHJH$"F DD DK"DIEH4ZCHAIBH  H>HB=H"!O0(" " 4Hp3N5`"O0C"h+!3h+" " 0hB+OsB H! FH4h,+OrB+ + O333Hh""(z7%SKh#0@pG;>+#`Y T! "D! 0"H!" FI La MF(` IH!D([ k`08h"/" M IFF(F)FHI"F(F  889 h7(0TK ! CC !B K`!03 CBKK `(0TKH!0CC !B K`!03 CBKK `(0A#!@C%BF#CL`BK`!0K `(A#ȲC/F۲L`BK`!K `瀚(ACS_FL`BK`!K `(ACCOFL`BK`!K `(A!CCcoF#CL`BK`!K `(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `瀚::K"#I&@h]e-AF!'FBO@F`)FF()FD(77 FhF]I*Fk(Fa4 `0Fk-A F xn+Kxo+4'kL%FAF80Fa(F'x!Fn+ Cxo+0a(=F a(ч8IFFH  -O]F S 4E3Fh S 3 S)FF3FT HQFX#@.1FqI0F 8 ` h+@𥀜I(F:(@𞀚Io(@G>ՕIMՓIGyՑIAՏI;KB 8A(F0 Nd!@ k` h+𷀄I" F(@𯀁I v `ހhO@ $4xI 4F(@`rNB$hhU`"`3h+@iH4  '0HFS'7B $VI `_IF.L `U S3h+?d!`OEV EI"HF #Z"(FFQF FFй;Khc ]9HZF #6Ka5H #JF0I#F0.J OaG,JBOI 0FOkF8x -(OwP8F=!0 #;PTF/K sPPF$04B4J} ǬȚ[h"Pzb-sh+ 0 wHsh+ rCFX@Fa"ad h+@ 4"8F0@bHFbH@Faa 1sh   `h!,0QH~QLQNRO2F @A 4#h 4hZh+ 4*F8F`T?+Lh+ @H*FFP SF3h< , V! ( R"FAF(#0L " h(ܻs'I 4l 4@4$D48O 3h+? 8A(F0H)F(OrBa\)FFHbQ 8@A8  -Oh FAF\H #JFZN%h!z%-XвEkUH+BUJ+FUMFUH) )FFSH0+V <BV<MKhkJH GKV,)FHHFYFV <% 6繱?ICHv_h?Hn;Kh=I#*H##6#'H##,+h+#JOcAF#8FJF3F`#xS ! FpH"F9F H  Oxؚ-V9(2h"qGUu+UgB8FF T)Kh@ (F(Kh8i"xn+Cxo+0K"`NFC 0` FH F`  H%(F,/0F FFK,!.F0`{i"e2IFH 0; -OFF"! FFxJ%#5`F`FuJF`9FsJA;oKh+=ѻ-%W"4_5@F[3hZ\C3`4#`#g𦀹-@@F0@VIBF r(d(M(DU(aG(,e8 (S =*)G*))*))g*)*))*CCO CsgyO gq%iC)I2FjF&I nj.VCO Cs`gFo0X-?W0gQ@F&0?s cg%3+@F0?a cg g)' ;;|;)'] e$#H)FT,0I+F"F T<[T< `Oa2Jkz `( S;7" FFxB(I#F*F 0<<F^( FI@ݿhF_n( FI@Ϳh("FBx (I"F N<8F F I"F #x/+ !FHF)FH8@8d<z<<lIFH  < -OF#F` FJ F|;`#`0J)F FC0,o(I#:Fj I 4iU#AFTxhQFOL)'0Ԟ|; )'m c#!FH0<h++6h` H? KF#F IH ꆹ<<$=<8F F I"F #x/+ !FH)FH8@@8d<z<<IFHb V< -OF#F` FJ F|;`#`0J)F FJC0,o(I#:FiP I vi6U#AFTxhQFOL)'0d|; )'m c#!FH0~h++xh` H? KF#F IH ܷ<<$=<8F FV I"F #x/+ !FH)FH8@8d<z<<IH  ~=-OF F F#|3`)FJF FAKh,o(#2FYFiI i2hR bU#@FOb`h9FO/ |;0)'D f"$ FH#F1F,0jh I F*S=8F F I"F r#x/+ !FH,)FH8@8d<z<<RIFH = -O%FF")F F`zO.FFFFyJAFC2vKhB7ѻ.&X#4Whp58Fl4#`𻀹.@8F0@`I:F u(f(M(V)9(:G(+g8(S !211112/21K21111g22U(oC oCgoCoCoC8hO gv8hO `go8hO gh8h&a#,I8hij*I iPS8h%Lo \.?[ gU8FR0?p #g.0gECj0oCg#0+8F.0?L #g cg)'&> ;T|;M d(#!FH0I#F*F [$ dOa F2 Jk'! H&"#N |;8>7" FFxB(I#F*F 0<<F^( FI@ݿhF^( FI@Ϳh("FBx (I"F N<8F F I"F #x/+ !FH\)FH8@8d<z<<I zt>zKIKKKKFH& >>>?E?> 7 " FFfx (I+F"F B0u?8KFF K%*F!F8F I 6!F| (F8@`۸i"?-OFFH"F F!`FIH" FP@8NRFIF8FC уKh/ x28F(S 66555555555555565 775555C755g5555195A95i9955955555555667#755+75U755]755e7996O9a9o995995Kh 4K"`Q2Kh+/K"`i#saEiC#0ha!iCSc&JhC`2iCi#0hD!iCC diCcg!0hFiecC 0hI!iC3biC@iC3 I0hBFiFI )' j"j"j"|;h?AI hB `Bi"aYBiBbaBiB@aBiB"ao~Jh*a|J!` zJh*WvJ!`i"raZBiB2aBqJ!`Bi"BaBiBaD"`D"`ZeI(FidK`cI(FiiCa`b^I(FiiCa bYI(FiiC3a`bTI(FiiCSacOI(FiiCSacJI(Fi|iCCa dYEI(FipiCab@I(FidiCa c(F#iiCCi#C0hR!3K` 0hr!iC`biC#`0ht!iCb0hw!iC b0hx!iC ciC###0Y#Ob hh  Fj"j"j"hj"????????l-C] G%  }H#9F@F*h80"hK+i )h2F F#sa5F*HFOR@##" #>#? F!(hh_ IF Hl^H#`O0B B@}o 砆jU-GF FFFEIP#m`D3OqB BORD %J%Ih0`J<DOsPFD4.{<#`O0 G K yO O AF!L @aPEq $'FVFF FB&4F_FVFFXGGCph(FFFFagXFFIHb砆vApG-AN} x FF!F@FOr(F4)F(OpF"F4$4MN*D#I:F0F #Ch N}( .0F N}A L!D ĕ0FH Lj"-G["F FFGH@!0FEP#pAIC (Fh kF 렱)FF8HN :!0F5FF3HB RiĐĠO3GOGFO'k/0+i+O':FQFCFBF1F?iN0+FimDDcd/iib``ca ph6faa #ai#saj"AALj"#-H@# I  gz ]AAIFH B -OPF$NC FFC  'FFC#`D`yJ`yJ`yJIFlC tKh[ +g8(S B3B3B3B3B3BBBB3B3B3BB3BC0hO#F0hh#F0h02hTI h###OI0hh0NI Xh"JIPF(  PF3x!CIRF 0 ?IRF &z ##n7I"PF  PF#x0IRF -IRF-z ڀ' PF:02h%I0hO F9ObY!67ph707Ir4a,b-)')' nCsB|;BBBBB!CBTC{C8 d(#!FH60I"F [#H#H#H ]mF H ]iF H H 8 h Hh HCCCCCCCDCC7" FFJxB(I#F*F $0<<F]( FI@ݿhF]( FI@Ϳh("FBx (I"F N<8F F4 I"F #x/+ !FH)FH8@`8d<z<<pG@pG8F FhHȀz((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"N54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\d^X|q|pcJcWBFg:fW2F,cbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr  F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg" !KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3" k"o"o"\o"do"2O {pGFFKFFh[KhKhCKh0@UDKXhB h^["F3FH$ Ro"o"k"\o"do"XOy)^#JJp>s!tYh_I F>v1hXk2b&0F =GD0pLJFNI 2@UD[BL @r[ CSfd04 @#F#"_h # +u#}+ZJJOzr>vhSC   F*Isd3ddd#s11hXkPFh2@UL[DUBr[ CSR 2Nn   L Jk@L#FD0>|Fpk"do"Іkp2_B@Ѐ;۲#O &@;FKh3A@񳀎O"F;F !xOzr OAh SCD0@0H0L0O30{C?Fh2@UDl[B @r[ CSR 2Nh Xn  @C. A #FDo"do"T o"-OF-!FND- Gc #s#^Kh+PЬKh/LѫK4hh\C#0 :O;A"E@B%D@8F)FXEFA"O18F?F@)F FD1A"8F~AF@,OQOp]MF`(OR!O1Op]a(zLO2!#h+@O3,5sKhsKh4)qHd h)mHZ kOkJh9hhcZcK BhHJ hYkK BcH@ h2hYkB_H4 hk_ZHOR( hk?UHO2 h BOH MK h;h0BSB@\3ؿFDK8F\sEXhm++#$5kAkW8uSBdO|OKBNvAYC 79DA4E0%D8$<4BsxHz vKhvK 08$<Fx 8Pkw(@DAF8&1FT*FOsPF9F$&8aBA*FPF9Fa#O3sUHAF&F0$-BOCȿOؿ#1L 3KALq*O 3BCBsBL @`p  XK#KCXC3G/3GOCGsG0 PlAG#(F1OpK3@,@pIDLsB8F/('Bv8'F Ho"PRTR8o"do"x:FOK<*F AqEC5jBXSBORdo"pT4o"h!%ZkRhaH4PkR3bisb@bb@5lc@_OSfKhcKheKheKh0cXTcOs0HUP0 h40PYF @ 0Dbij8d| o",o"@o"pDo"^Fdo"RSk"TBSHo"]So"o"o"HO`v_Kh+]I# hX)hOP%ObhObxi0QKhyihh0+xiOr!Wp0+FH0+yhCMj0:4D\Bi"iBCDFhInDr  @#"C@!CF2.J8 -K-IfC(?ѽJ0+P# 0*F+D;#G.hO`1F F)1FOPOb= "FvF(mOb)hOP[# P#To"Po" o"uST g ht@+hj\L#FhjB@MH 8<O{0GF  "KQEA\%FI +B%a`D%4<`DK B D p0C_CKBuۑH( h!i r iK$I{`ȿ`  h{a`Ŀ@;g)2@Ӏ"2x0t[SEgx#  eH;fpI h;3  #f`0fAH {fBdH% 1ihj Db-O FXDh[Ei@ʀJhnREvq nJFh$%* ݠi "@nG\:CBTi i2aAJh*Md GzhRETzmR 1B zhREP%PCm@P%* @=0d TFP00D FPC@:Z2:R8  D * , :BYF 9`#{eO3eKdo"8 TSU pTo"SYhJB5smxBpijYh:bJB5smxBpij;bhkX0@i3DOO Qk1Qc1FBi򭀚B"Dhdn&hikQi3DB@򳀎B2hi$5+O2fj $jNE3h#jzkF=h!jjPn1Rk!b!Whj!Zk`bh`iik _OW8D^3h+aihi9D#hqNkDci 0o+F(#h\%@7cNBii%rCAFhdAq   C #1C OK\%BNN3h+5 PhOBvrn 1@iBj2Bb5ShnKEvqnZFh$5+ ݡi #@n\CTi i3a.Kh+Gd{hKET{mS 2C {hKEP5mXC@+4dFQF"2QFFXCe@;Z3;R80  DU o"TTo"p I Sk3SciZiBZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#1@#  +KFOL O +$eB3FP#`6@#`B . @I 8$ z @J k08`x`0@OFFEͮfiE>D(F6 @F `i#kDBhgK`f\B ii%YC FFkk id Fv F   ,C1CDF k+GKh+@82D?n. 3h=I=K*FF 6I2"\Bii%HCBFhqFBrxn  @B #:C@'H2 BDDB?)3h+hj;[KhsH,+ Khs D #|:x* ȹ Kh I U To"TTTk"TRLghcgOKh+30304040JkhSC#oBIOb`i?Mfib!`+hh1F9Kh7K\5h0+WpOr!1KhCF:Fp+h+hiZkFBhPnHtL  Rk'@Ci1CQjcjB+h#hFZk h!jj1Pn!bRk!:!k`ihiYkI D-+*"do"p7T o"o"8 o"-C}FFFFJFlF(_IBF (]I0FO((DWI*F0F0h+RHIF O0 }kk8j`j`+k#akkca#@0#bB0cbklbD/p@I:F0F0i;I*F0F0/:IJF 9I\P#F"F6IC C C F(1I@F /I@F-I@F,I@F|"!8FHF40' 0BgBOЪ# (5D*#*#0f "FJ l#( d@edAzd@z$5ASg-Am%OcFF)FFfCF*FF@FF FNM0:`12(F mF8F F I"F #x/+ !FH)FH8@F8d<z<< UpG-GFvFFFIF(F:F3F(F8FO`f#TD&O` FB`۽#D# 6P I-G%@F4FFFF F!0_ H#J ## `:F!q F !F  @mH# :^F: F^p FFFr2Fk2Fd2F]2FVppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   -OFFFXF# " `0FP xFPx(PI3F*F m,3a,M,%A,!JI+Fb< ,P$}-|-|-|-||-|-|-| }-| }BSFG700F9FFF$&F 0(0A  6    J J &+FHFQF$&0F9F\"KlV㱴X AF0F0pC O0&+FQFpfHF(FG[l"((`:F3BEC FCh`s"xAUeUUU-AF7N0 0FB FZ,F"F+F@!*3j*FBF[ (F[ x2(*] #!3+BD +\C J I:" C+T06&h+F@qF (F[06pi D:zB2h;`s"}U-Oǰ F!FOKKh(@SC;J1#,0I (%"# #O0H0Nd00 @$LPA!aPD #T0KX0R3I *F+FHKh-=(F(3Is"s"Us"Vs"7D?4BaH]Kl2[n Fг 0ObPDTIUZ@m O* %(Fb&0HDXH6 PF 03CKh(+F!HD!:H9MRF6;B0O [3 , cEO(DO1'KO O !  \ CT"F 2 *C  0.J#3Pf$&B06D&hSFID  !i"#. 7P8s"z"s"8 s"s"*jkiIH3#K/FD8DE?0+f>6𺀳Kh+𯀲H/ Kh.@3Ll;m#n!H\O@]"! (( F zDx0V6kC 3"z#06x%s(( &GFB&~('KN@! 6{2Bu# "Z"!lK#nA#3'4/5Dx0!znH 3"0&#x0#@%((@PaIaH$1FO@F 'bO1F" z%>Hx0 3"z1FP 1ZC"1 DO1BAanDJDIcP(9%C x, 4. 60 2 56J7IGO v@F ZF-J0I6@FZFh 6*FB,Ӵ0 &DBO%#B@FZ53FRF@!0FZ#"%l+ǮJIF% 5B& JI TTs"Ts"z"ZpXXXYTYci"3 #F%BB"!jCFRF !6"DD~`n F1#BHJII jO H#cD D2F%05d?K"q!E=I=H=I!F7I9H6Gp!HF7RFIFXFvXKFRF@!2p'*K@&9F'"#ciDfOb"IZp[ %O)(Fx&00DnH6fiHF 6@KhE9F+FBF0DHDG/ݾYYTYz"s"s"-C}FFFFJFtF(_IBF (]I0FO$((DWI*F0F0h+RHIFO0 }kk8j`j`+k#akkca#@0#bB0cbklbL/p@I:F0F0i;I*F0F0/:IJF 9IdP#F"F6IC C C F01I@F /I@F-I@F,I@F"!8FHF<0' 0BeBOЪ# (5D*#*#0d "FR l#( d@edAzd@z$5ASg-Am%OcFF)FFeCF*FF@FF FVM0:`12(F mF-AFF"`8FlF Fh3,x[x+&ICF:F S-"F-G= -S%mYwcwGg= +dDTv0F!FDT$D46DICF:F>ZIZr% I L ONF H" I HJch5"x9F0F4- bZZ Z-AFFFFO)F F^BqۆBxI+F"F (>Z-C}FFFFJFF(_IBF (]I0FOZ((DWI*F0F,0Dh+RHIFJO0 }kk8j`j`+k#akkca#@0#bB0cbklb/p@I:F0F0i;I*F0F0/:IJF 9IP#F"F6IC C C Ff1I@F /I@F-I@F,I@F"!8FDHFr0' 0BeNBOЪ# (5D*#*#0d "F l#( d@edAzd@z$5ASg-Am%OcFF)FFeCF*FF@FF FM0:`12(F mF0# M xj,h214 F;*O"p $T3 +0$ K"`pGz#1FHO0?FH ]]-OF-h"!F}J`0$#hchh #icii-#j$0j#k'ck80 ck@0B0D0F0G0l,L0)#m T0!+ iHP@#*KF(bHBC9 ^H2COr@c**F3 UH$ZcQI ">(NH "#f!F(GHIlF3 dL ?Hxhf+fpC_HCD7H7I"FXpF_]yrUBUA "AFjPFl蠹AEHF>P H$%QF8F.(<FѰ2C.# #2BB!FHO0.]e]x]]]HrT]H]P:C > @ B D F H +tC!B: E1$b1ڲ%,D*@B!2" +@/!l(i0KFh x F13320[ՄB\c~:+iB+fC+c#:E;E+@̀ 𽀻 ## !OQpF$ B,F;5 -nHnL%OD'Y^F(4D:4Ŕ?EAFf?320_c#x`+`0B$+;CV ."010v2ڜ:CIJ9F0?:B[?.DJ(?&1F0?BCC>J)F0?CE+bE_E+R 02HC+F@Cd DT%?&Ow+F@Bd DT#!GRI*OF;x$!#B HJ@4 ,] #H<ػ#л 5HYF # H, ^ZM[[^:^L^^^;;#OC:c КH!FHYF+ЗHYFO O ҒHOr!F# ӱ;BЊHFnBوH"FFلHF!F; C ;B~HFQ ;)<;+yH"F=>%^+sHF6@'FHI +F/! hJOa4z(?E!F3[dF(fpCOvF"F8F1FC ѧBvCBuLH= #=@EaOs>>a XT; "s !FOD O`OPD~F<:"O EI c@q#Oscf&F;- ; Dй?AzH!FO@\(8 B,<B :FnHڹGF"F!(Ff л @߀IOqBӀCEHBӀE@_K+`SS 31O3z3 r+s ks+ +tktt t+uku#!+ka+b Fkb#bGb 1+$1k$)#01b1d3ih3d_H8h]H2`":d2BXH( d2+sh?oh? D %%+: v`+B+p CK|&AH)F1* + S+ ( h.4I2I@@џ@ џ d2(Hz : +S0++ 0H: *`  S0+k0@@-C6?Y@x{#]z#z |#|#( ! z Kd2+Կ z# Ki Ld2 I\`2"Bȿ2 z#AFHh#N!DB"Dq8!.pR   KhcCս@ a?333333?z# -O&-LM`=`f7BTBBA C<`'@0"1FBڥI #<"9s;Fv(h՛H#"!&(ڔII #<02N@0hPX1FH ghO >/0'78F# xMKF*FBF  OEcrHXqHqK" pOaX`2+F@"D3`2 ! ;jhCWI`S .ձ@ +ih{:+Aqi`h hZBFOrEHq;F*Fh2 @>N {2W (#谦f2ADIQE23YDB2*H1F ԣ@ &! { F BPEV ;j`pDcF:F&|z##]~|#h{#Mb |#@#8#(#ɚ;}#6eH H; jhP [B( ;D Hj`B03;KBj` D;$H#ɚ;6e-GFFFF ` q jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  /9FFH&0F z#-CF#M -FF(F@ h+HCF:F1FHHIFh?  ?H !!h S0+h< IC񻼽@@z#   K Lh K*FI#FFH $T(c MIFF(F I"F(F I"F(F I"F(F I"F(F  "dzdd&eepF FF+ * *x *##pp\* Cx+IH(F;'*"*+;.F;B+I5FHV gg FKhhSIC h\B Kh ( !h(OOCOC`O0$d$0$FFFP;F0O`#S`O? F`,HF+Jh`)Kh[#h(I; h\B#(FÈ #*##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#0h!(/#@#, 0$$d$g hh\FMNO FT+hh *3h[S9hO  A L#"`c`y b2P F0$$d$Ȋ$ K : *B ( QppGIL  F:IFF(8I" F頹6I(F`(FF FDB 0I1Hb *#x/+ (I)I!F(F+F)F xZ'O/)p,+Fxr1/*+FK/,FK\"FF/))2*Zx.*1FFFF2*9F F`Ih7>I_F*3;D3Q+FQ FAF8^F#CCBQ#TY 5 F( F@ hCWF(JI#H8S]Fvh ,h$h$ihhi;iWiwiiiii,jPjpjXjjjjh$Sd$0$gfffj @(I BH^FJ C @@A,FF]F.SѦI (FWHy0[;hI; h\B՝Kh;h+ IHF(ИIHF( I# 0yBDoObJFIH^FHFb"F9FHF26FK"1F(Fz1bEw8FQ 8bFB8F (  ( 7O  SE=3E6cKhr:FdI[H y D C 2 QIFCw 2 DKEFI 6e  +?l[l`$d$X$$$mlI-OFS hF8F\ARF(WG(IѤH #PFYFF(uiG*@*LEN+Fr*Q"'eՋHF۱hHFRF[F(FLFCJKh+0FjѴ0XCY F)F)F F&C&cy+ F8I*FF8H@ HRF(F[FÈFCÀ*Kh+0FHF F_*I+F2Fr!NHFHFHRF(F[FF8C3h+?W  B  B 2h*?B FHF+F"F2d$ylm$l8 ll l0Z+I F.by*(Ocy+9F F" F F.i,RF[F(FzF/ F{K(Fjb[FbbRFdFKh+?M I+FFHBI*FH~0F I+FF Htlm$$9m8 Sm vm7K-Gh6I6H6O$܀&#Bv1K2N2Oj F1F4FCy++Ic h\Bjx-е00;(FIFFPF(F(Fi,j mjcy+Ѵ0I Fk3h; Ff9FFH F Fmi0$8 mX$$$md$mK-AhIHM ,j&GF4.,jM#j$M8F> FFcF5I0B됹XF$0I2F0H/I2F-H,I2F*H*I$(9FO F M yJDoObI:FHfFFF@B8F^"h8F#e 1Fk$[2r rV\r-AmFHx/*p$O&AFpF8x+0F!8$ F m3iFH(FFF(yB02F)F(&h$|^8iP F8`"iFF,F F8$Fh | F@U̾K-OhIH0R+ ьKOaH##KJhL4#+ шHIHOǹI`HhVIF{H~IbxH烉'J3FI H0F 0$8 yrP$N$qNr rTrrss@sRscssH$ssss $$$$($-AFmFFFFF(@H:F#F=Or@a0F 9I2F9HL8HhU95IF3H> m*i0NԀFq2h lmiF-0F F  o/F0FOg:F 0KIHm# hUIFH 0:F F ,0KI Hm#rhU IFes $p$tH4.. .ѢyF(F2B2"Dz5J y@F1A1!D60J0#y+yF(F2B2"D)J...ly!(F2B2"DJJ y@F1A1!DJ0hy!(F2B2"DvJ8 z$`zTzPzlz{{zz{#{7{zzz0$Kh(K[h  pGPȫ$-O(L F#h +9M'h/7 V")$+РKh+'F>Fp`Kh35K(@Kh+)IH8IH`#0HKxR+jЎK0+e9+7щK(FIJKKKH)F6Nh)F0F0(F `Oa0ԝ4 + `3)FxH')FvH `YFtNO )B  1F bKF(FlI `  )F FF'80B )#@C9  2FYI(F)FVHVJVI(F(FV `Oa0  LI `4 + aBHAH Dbh"I?H>K ***8I:H:Kh9H l1I6Hm6I.Hn#3I+Hf !O*RFRch!PF#(hTD&IFHJI#RFOshF?? 3 9FHIOb8Dȫ$8 }P0$~h$~ ;~p$R~4$ޭi~~~~p$$$qKFhM+@iNl"BjKBBИB MeMhCdKhdIdH#` Fs(\Kh+ hg ``hc``h_`h[` iW a`iS`aiOaiKa D nf   k8 c`k4`ck0ck,cl(dl$dz xx||JD>8!hMK+$Tȫ$0$8 ~hFhF(? Nk#BaBMhCKhIH#`Nk#}yqn f "`"$Z$&T& R N JFB>Ob! F#`22`20caa 0#$00&00  2 d22Or0fKa4#ca0C@S #`K-a_Kh*Fд$ & +7 [x3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccf?H#h+=J+#h+:J;I;H#R8I7H5I *5Ko@!2N#A1C$9) 8:'I)H$I(H(I"H9-;B#IHI "h*N*>*K=K F# C5KhF ( NhR"F I@F H Kh3"FI@H $$ 0$!8 -CFx2LF.+ FFCx/+!h-H 2F )I;F h~-A!h%H9!h#H#J h"IjJk hIdJ/I h\JI hVJI hNJiI hH!h #h[I JJ($ h5ZbipyDzTI T-ANODFF8h "F v(I <0 +;#0B#H+pwH!Fs$pmFFlF! F#xE*Oa&H)FPJF v(`O0#xF+K"Z` mpA+ F. DB< +#<H!F*I NU$FF FF K!FFh F FBI 1F(F@$𵅰OL`OI NI hLILH`KI P aGI#ihrF(Цh@!0Fn(a#p?Kqh?+C0`h*F:H#9K3FF `(FR.*4K%hpOOpCco h6%AOq h #"! h " h! hC ZҲ7 *_+-+H1F .FAOq (c$?A!-H, $k$U0ðFFFJOqK" FZ`*FC0t$Lbh*IH#c`$|*\𵉰 FJ!FhF^H"iF F DB8hbq I O%b$p F JF FhF!0hF NiFF0h |"F)F0h v!H^p$FJP!"H]0[)Fð JOqH"C]O0pGpF FKh*F ZhBZ`C!+I2FI &"h!hOrl O2X` XBXAp F$h8 FEx- -K*F!FF HN@hF!FFHD8@H &!FFH8 (7((RHpGHpGHpGӉƉ M FOa\PI M]8 I n; f+X1 XmZe "ppG -CFF9,5x--# `PFhFM FJ.!HPFhFM C J.#(FTIF@F$kF@Fv4 ,у8 Բ$rT$RKFk+%x)ГH@ oxK)HJ!HFx;+ C+++}HF}J}H|Ihah@i!iwH! * tKL*F`ih oI硈nHኡd++% hH"!B eH@ QcHcHcHcH"aHaH"`H "^H h+f+ٝ501 040TH3020j;+ @ ๝=01 0 <0GH ;0:09080706050403020rj+#5H##f硈#Hb))*HZ,HV+H#!i)HN)Ih-(HF'Ij&&H@$I jhx$Բ5/T>R6 rÊЊKjr|h -O$bMFF!FF(l,` (0F*F9F&r""##!"FD D dDkCDH+hBH[lh F( F/ h)FF FAF&h/L0+о FB0 FV\*5O `lF#"2K!F@վ?IFHl `t HpFBMMF.hs+`6(@aI :I 6HOr@aI""H&"  F I" F H IF F F@ )$ $IFHL @Ɣ pFN4hxF324 RFKFK,щ ;Bx1h21 RpI, hp+Fхk`& 0BP m# 32emcP#ep(F`5 7 FFS+ hh"hۚBF)hD)`"`0@pG-OFFP" ! ,FLE ѝ0 +H9F$HR |" !J @F] J^` #xRF !@F~F `3kD#G,; Y2 o`jD.#.<P" !n, -C$F%F'b V" Be#F*FIF0 JI "FAF(FPC4?;HhJI-f K IF K K K K K H  @T]gq 7:MI,hF FL"h"ch I(h(hh3`0@pG8$8FLرRh+;+J"2C#BhP8@IFH2C#h 2C *hPIFH-8$$-AF("F"0FAF0  I FP]F(FAF0FUf0 FAPSK1+K9FHZhIO@[ B L8FV#5 6AF$8q--AFLMF F11[/1 Q-0/1#/׹=K>HZhQ- !F0FA6K"!F0FAU/2HtQ-+3+!+ "F1FVe&HaZ/7$HAn_ H/HF1F "F6 F_H"F1F&#%aH*_HH" A^$8q8 C+ J F)h]K3`pGL2]KhH\$8-AFALm1+?HJ 6=!nPOC #Os3`Os   F8F0 9F#h+ mX"AFOc3`OsK5R# (o@# `#*s3F0 rhPFH,+ Hh#C-H`$-Ro-GF:LFF11[/1Q--/1/ѽǹ,K,HZh.Q- AF0FGAF0F$K"G/!HQ-0#xutsCE/ѽGH1ixHF)1+PF2FAF HG  $8q8 --AFKNFF3h!F#,?DI FȹO2oC##C@F0*Ѵ@ 8"` FB /H"F)F3h+ x+ph+#F1+#j!# CoBB?#)F8F,j2CoCB?#)F#8F)FJ #8F#J)F #8F$-OFbNFF3h!FA'O,P . PFz0RH)Ft%@F F4F IH"F)F^3h+ F@FFXF:@Fh+.PFG>0Ѵ@ a'F1+Ѵj2OC#)FHF,j2C$#)F#HFPF !J SFd! )FFHF,8F ! J ;Fd!")F FHF`$K-C8KMt}wBEO!/!!AF(F0H)F CF)FD2F&( 8F#$CF+F FY K]hX!F*FF H<)H6H0P$8ohvpF F&#f0 p*I"F Mj C3F F=1+K!FHZh1+ORr#HP$8q-OFFhhKh۱#gH# Pp (%^U(F OFH HO6(%6OIF3 F(" D8F 0 - FOO !H(;B+HIBF (BBO%F@F&j#C[#(")F Z E9K !8J(5CF^F P( D    B()ܱS g0%E%%SgE%%SgE%%SgE%%SgE%1FPF#HF########$Pp-CF`"*x FAF/#JH#fP(FO(FP a#O3%F%9FHFU&0 J F#CO2B0I2F J0/#C#C  #"F1F%IhjC!F0F3FBF!u# #5BܻO`1H1F`+ OD#)F8F5PB @FFP$p0FF%#U0 0*I"F KjC+F FO1H!F zH zgzg+z;g+;; ;S0+P$-OFjNMFF3h!FOZ ,o F\F _J _Iv TRF4!pO FHFXIO FOS AC818F h 0BѴ@ / M"@FCFth"*@IBF "Ex*;IBFEx(Ѳ?S  T# CYFD# F#F1+Ѵ j2O CKFOR(F,j2C Q#1OR(Fs)F:F)FF @<0h8FO P0F")F"FF @<0h FOop$xU-OFMFF FLz@F PFI(Fh #O :I(F^(7I(FV #O 3I(FL(1H*F1F{0I8FBFع-,RF(FB &H*F1Fbx+h+!I8F F(W-?gRF(FVBFF0H*F1F=P8~{USBr |GI| $x+h+CoBJ BOs A1I8F(]-? +FD3x*?a)DP!LIMIMIMIMIMIM%M+MIMIMIMIMIM1M7MIMOMIMIM=MIMUMCMDDDdDdDtD$DTyH1F"p"vH:F1FOOO+7qA8"`8FBgH*F1Fqx*$h*o@BABOA`XL TDdL # @ˀ@PJQH1FB"`8FJBKH*F1F3x*h*+q %pa\LDd HL+# 8FL%0 0BDd1H*F1F48F"`8FB(H*F1Fx+h+gGL#DdXL# +#H1F L}K H1F%ո?w-JrDd -@𖀸% H1FFA_|G*HfIи -d%3@cp#LH1F +\%3hМI0F((dxJ#0FP908CDtD @ "(PAB (B#+D0@(Fo E#`##`##Fh0IhNN1FFyH$и-- sH1F-и-p#.!1F ")F0FOr"`"pOs#aK]J8 p01Fh#CYK1FYH"#4qSI"0F(okz=+ HJ8 Bg $1,DJH $P44OC Ow # FOs+`;K8 : < > 0!FX"AFZXp4KXS,YoC,`#2F+`c+F0.hN!FF$Hlh#CXI H;+JJ"I"0FB(aѫz=+ J8 BYO D=!@FF @FqOO P8$*2Tp%dv 4+H##4K ( Or @F0Or # K04/ )F H)FqO!jxBj=#<I"0FF(+z=+?aJ8 B&1.D+WHɻ h#4$ CF{D@0! F1 yHHPFCF豆hN- NjIFoHh"FmILp0 G#0#T"@ F,F@B@Ӏ(ЀVH!Fh0 ! F0O T'&JF F??h"+ hNG!FF>HBx;H!F-0+-++.##;3" #S1F.0 Ϲ Q2 &C '##&0##XFh+@,<,+,#I@F##I@Fx$S8Z$$ '#F,I@F# &#FX#&I@F###MF(IHFAFF0G (FqONh+*FHF I## I"FHF3F #CF l$-MIFF(F`I"F(F\I"F(FVI"F(FRI"F(FLI"F(FHI"F(FBI"F(F> I"F(F8 , .kԕ/8FKhIFpF CF H)F` 8"F)F $F*FFH$N>^mFFOahFW I"F 0hF mrTpmFFFOa&W8H!F^ mp&iF(ZH!FH!FM2C&h k`+h  &2F 2(rT~$mFFOahFW8 H!F mKh  hiF  (rT$F-H'MF6F(/  L,iI F(I F(+*hOa FW^ H!F|I#(i4 f FvIh FsIhX 0FhoI F( kI(,!(F\$-OF MF0+<p/6F-M-I3FBF(hB(hObXF (%K"%I(h`#F,8F MFJ0h320n+?+!a+'p+q+K"I(h`"FI"F(h#0)h# H0" I#F(h"F%PL%a( qT%8% B-A N3h Kh M! L#'h+`!`c'`#3`L%0%T%8% K$` Kh F K Jh+#`H!*@%%4%x%$-GFF걬L "@< T1'h27 \ bE!T(HiN/z.F+L>H+F@<O"ch27p<B7h7 pESѐB٢\+ZbE.F"p$+P2F!C K   xx(<#~H+p,FK@:zм[\aм$@>Zxh7py@50*@w@</*R+bbET2*$( \(*XxB)3x2x(3_x0/ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3B#A$/M$1N1O+h+;B3h۹ 'K"`BK&J(ѓh#3KH,;FR$ `F)hKh{K"`h+h3+`K4`%nXTL%c$4%2c0d0%T%pFm@"O4;K` mp! !FlR$ F4,! /H/K/!(FF F``AObn(Khk'N F1h*1hh;`+ 6-#KJ FhH!F~K O2`!F hZ ` "p" F B1F $1F c HT`%"%%$%Vh(;0# 088KO2`0(5JiF;+1HYh((D.K/Hh+,H\F!F)HF F!F F^--h+H@F!FHF F!F FB-KO2`h+Hh!Fd F!F F$`%bl%t4%p(LO3#`нp@ K NMh 3xKP3x+)h Hp@&JI(h##`p`%T%X%%Сp(LO3#`нp@̿ N M3xK3x+)h Hp@JI(h##`p`%X%%l@KO2`]((JiF(HYh( Kh Kh# K Hh HYh(K"`%7h%% 6%@_KO2`]((JiFx(HYh( Kh Kh# K Hhv HYhs(K"`%>h%%Eo%-Am FFFObhFXo$B HiFH( V$ObhFBObAFhF4K"` mrT%@ KO2`](JiF(!H`%xT@ KO2`](JiF(!H`%@KO2`](+ JiF(+ HJiF(`%y8 L%h0g KO2`8#B#`H%`IhHh%`%ˢ8C L+%hC KO2`8#B#`Hv%`IhHph%`%٢8 L%h0! KO2`8#B#`HT%`IhHNh%`%81KO2`Kh+H3@`%4%81 KO2` L#h!F #h!F `%4%!F #0(KO2` Lh!F H F<!F FHF(`%p8=KO2`p(:J(Xh"F33K4Hh/K1Hhz,K.Hh.H!(,I bF {[z{'Khd K&Hh Fm)F L!N"I0FFP0F41D0F " FhAOh8GKJ h;#`=)F `%% "5$e4%NP^%^x%JKK`l%a`%JKK`%n`% FOF(O3;`(N#3`KHh3h3h"Ih H33`;`2, K"ph"@H`%h%%M%<%(7&L %M#%H+`%Kh+h#`0 O3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF|(`%d%%$%%<%<%($Jh+ ##`!J`!Kh9!JF('O3J`LhI FKpK"`KJ`KhKI"KhI FK0 K` K` KhI FK(J#`J`KhJ\%`%%`%KJh+K#K"`K`h%%أ`%%KJh+K#zK"`K`h%%`%%8F F)F F8@ۿJKZK`t%`%JKKK`p% `%(-GF FFB(yO0(nhBI0FKP(F@I0FKJ(B>I0FKD(&,;Шh ,9h%! T!F OF5%,K+K`+Kh.%)K)K`QF 4IF 0 &&%OOd%JKHhhIJh+ FI.%KK`Kh+J KHhhIJh+ FIgب%%h%%%%X"HK``%0KO2`H( Kh Kh# K Hh H( K"`# Jp J``%h%%Ĥ%X%T%s F(KO2`pKNh31hHp@(Lhh "\)xjjhI0hr#0hRF H Ip@:`%d%%%ɤ8L%h09KO2`8H##`n%`h%`%2-A@ O3NJ`LO;h+KKLHhN(9+HKh#DKGHh@$8h "DNYh`r;hSAJ`"@Lc hchEE3%;Mch;c`+L(F (Nch;c`+O(F (E1JiF(ѨZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhu#hZ"`x +`% %%7T%q % % fϥ %08`O3J`0((Jz(!Xh'??F FIZhKhJ-t##`%y%08"O3J`0((JiF<(!XhS??Kh]h I*FF F+s##`%y%0KO2`(ѽ@H@IhH `% O2K F@H2I@h2c%-A@O30(( JiF(XhF(HJF`xK*F(FF0FD4 FJ"F)FF"FI8F"F1F8F8FD8F#0Jp0FJmMn4F7Fg'p>FaF{(F%Kh.7FO Q6h%F.й%F'F&FE6h.йѠFO &x6!I F&DFFO DFFF/x/?&I(F'%F,F/F.F <04|^P%4%X%,EMU]%+XF(?#8PF,.}/#x+@OObYF `F c4# 00+#x+|KKhvIIJHp zDF/! F FF# F;-1+x+.9I `Ob>C c5N5O A3LOb%h#`3h+70I ` c%`#Kh "!AB(Hx(56M~I>T0*M FRNOS0FPD-UXT143x+;mH #x+lI FI(iH3A3A 3A"3A$*+AG3F@A3x[-!-TKh0Fl((OKhS%%%x-JH(/!H0R%%NBK`(ANAK  ?K: hC%t##-@7K8J(8I`U**(5H!*8@#:#(K&L2C*### )($H`#Kh[#KhO7FF üL(I hK h#RK h4IOR`$0Ax%g%%|%%Th%%%ȬӬNOr!F0F"K`,3,SMH^,KJ`,+,x+𧀏HN(Vx+SO: /F FFI/F(&-уH3x+YFF0FEFӨ1F DF(8FIi -?Ԯ +dqJ2C,oH".+ "L0+.x+HEе& F,8%! Fn`H!F#O2X3(FWZWl1AYI0?sZ3 WSxCY#xcQI F8PH)F WY FIWMYM+h#`MPP&0*Ne1f e C Ihv2KhTD1$#H5J8Ihh7I(FOR(F3Kh3H*F1K(F1J1Irh9F(F6h*,J ,K) FF)I(F*$+OA,mѺr-KN%X% % %̭P^%(%,%A%h%N+9%% Nc%v:Cޫ,c#џI*J*0OќHj 2јKh+ЗKHh&-ГN%FNKhK2FI4hIRF8F-ІKhñK2FIhI*F8F %NIRF8F-,пI*F8F~M g*&$(h,;*h7FF5f(H ! F(08 "58xF;kJ3h20X@5=FO7%FF `J4!Fh8(@4+c[I6665 "WK)5x+#((ȁ<,?j FHeJI6h(IHI6b(6x*+Cx6/*ZxX6**+36x+=J2C;H9 "  9x-+09 "6F B x99 " F9&I6(IPu6FC } y { ~ (?bO3}x+[u4:Th%% ޮخ, %m%)RI6 6XF!I6(mИI6HnI6F(YѓHd#,@ۀ&0FHJ-@Ā+?+뀉J%hB%I(@䀅K+++@ZK#RN??JEs ??@wI??1Bs,qKh+@#!K"3"kI6JjI6EF(?$HF$aI62(ю!ܻ?.nZH1F FH0FH=r*د#@ +xKNHFI! C\KHKJ2+ HHL0FH(F~;K@1Eh$ѫMA)FSFp!.0FH#(FH~55K*F5Ihv# FHp+M(F]!+K*F,Ihb*Hn, F FHU %H%x|+! @ I%0v+++:%H1#akܜ~x%XT8 %%h%ݯ. $Y%yװ2c(K)KHh&??I`H` BB%H"%I +++%%IK)I I Kh*K@aJHKB HvKyLhp vK uKh3Ox O3O0",MhM* hHո#"#` # 2BF^Hh"+,"##`SKXH "3##x *;*QI#POH3##x* *,',0;0K=J" D!:  #<#"<#Bq<###<#<#*s<#"B AO<#*ZF(O*F8"+@ր"+XKh+@*F(Hv+%%0d2cXa%.>$%%[}|%%J<1A1<#c# <#+pzF:FCh(#(]E%H]?DD}Khs|Kh[|KwOhBr-F""+?Bd,?>sKhKrM'9FHPDH2[FbJ@;t bp+r (# bKh^KHx"+?,?ݮ$'$%ZM*QVHVI TH},?IKh+DK(sDJhFJhBOtA?K h]# Y +)?KB&:#??!F\:#b`#)+G+%\P0 (K:h-IF FK#*s (KQ) K ~J!L2BBA߮ ܾ ~ھ xؾ r־%DZ|%l%%%@B%$ԱX#%%*)+1 K%hB3M4R1>A(#(H:#($#$H3#$&#&H,#&'#'H%#'! m++)+G%+%H#%x%s" F"IF~( I" Fx@#FF FpI FFXI" Fb(I2#F $MHX Fp@]h++x+I" FBF(HL𵅰#!2H<툱0Kh++!F3(I 'I 'O'M'NB Kh+3!Fh:!R#(+hB #+`!R#[4hdI F8#x|+ FHY#3`+¿33%4%$%x%XT𵉰FFHI "F8F3h#3F DF@:! F8F(!F H$E(F/#{p#iF kp3h  Kh8c($$0 +h4;c+V$0+FM$|^4`%$"Kh `xJh3``@%$"Kh `bKhSK"IhC Hh3`Ch0!`@%0%%>\$h 5KhSK"IhCz H 13 1Ch0!`0%%>\$ K"`KhSK"IhCL H! J131#@;`@%0%%>\$L%KF "` Id"R Kh0YFF FQH!l@%j%$K $`J#`J`Khxr+s+I FId"Id"Kh0YFF H!0 Id"@%L%$%Ȳ%$FF0$@XN0Y@<# K>I0hS$ d0h(IF @+`SQF O ,@N(Kh*?$-vЮ&Kh+\,,@߀)&KB:$',@π"J h20[ջ OKh*+zѻ(d$Kh*j.$.j3$ٷ9`%% %h%%% %6%$,  %{Kh{Kh .#XF,.,d,л-2rK"`3)lKhlKhs.. XFrwiKiIhdKhbKXFhe.@`H0 !h3`>+.$/_F$+p CE8\#$+p$$hZ` ?`?6 IKh+5/.?'?DJ h20Z,?M,?6d,?AN3h+]:Kh+?XGT1/O5K"`)IF 8QF 42h@BB *L#hk*KE йٹй? G 1k"KE кٺк? G0+(d$0, ѻ)?eKB'd,($V%x%`%`%h%, %%$ٷ9$-A!N 4hdHKO2` FApGO I#;` AFF0h1hH0hnKI@F"`<@ J;hF;--k G)F  %`%$ٷ%-OPLdM"FF#FiC C C #K x2 (hGIFBFxH9F^wKO2` dM 4OrYi F@tBFiH9F$%>`%ҭ,%$XT %2c %h%`%-OMO#LMfj#юO;hO:7 hC9"!(( `zH~K"`"9!( `wH MtKh#"Oq97+mKh+wlKlHh hO3#`hKh[ܡ03dJԱh0O2 _H+0F(( 0YKh;+QKWHh#0TH0+(ѕ97+6GKNHhEKMJNIh0+EKh;+ٸ#FI ' EH   (2K>Hh hO3#`#;`'0Kh *+'K5Hhu 4I0H c(K-Hha,K1h Os87h0CcCC2yB"<7R:'&BWKHh7\%t%$%%`%% %%ڳ`%߳" %~a޴$Ov$4%%h%0 Bh0Bc B^Kˆ(0[:78'#|I h'(zK hI hVO3#`97+ #"!# hp ;hc"Oqf0fH"8'aI hT(aHaKh#"Oq hHPUI h#F P0UH! h87(PH:h97*+P 0+?PO  IEKh+=00+7і , <  # !1'@C`F5Kh5JhO2`[F'2H!?-K*`F3(+0C#097+ѕ;7'H:7?7>7='<0F+?(;h3#O;`KJIh0+?ڭч?$":` $$`%!%@n%h%%% %~a4%%SKFSLh h/1F@N:F!(BF@! h0#h9FDO#0BKh+ؿ<#Aq!! p  t#9s Ozs"!"rCDh+h#+'H'K(6 hAF h+h#+H# h*F!8F'`0Н90+ #"!#8F h1F*( H hO3 #`\%t%Mb%$ص-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or*+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?Kh(@AKh)U9)\ G\#2F#FNx|+! ~@I](F #=H)Fs%K`:K 7I 6H6K C ؉(pCOK,IhNIK.# 2F#F()G"H8 ؉%%(%%l%h%%%-%%2c$%`%t%%aIXT \hT(X8KH#(KFH(ᮓK"`7  KO4h+@8K`HKh*܇K@+1JHK0B 4 F~KLh0 h4 O03! xKhxKhwK[h+vKhvKh+uLvO Sh;S`+ RAFu .@-lbF;+ aJF ؉ L ىbKh0=4-(!\H X # G# $ z F OK#*s5 0(h +cEK 9h# 8h#Cs###BA X M Z3H [ 23B2 0F23B2W hY`x^H#I@B hAK h# }HZ爯% |%%`%rT%Oȹ_$|%l%%%%%%%zM(h(6,` # # /KO2`@ q| l{ +? G t%`%ŰJ Ih# FJ g`JK I KJhKh@ +EщKh+^O2# Jh;#H!(XЀL%#h+OKO2` 3@ك3@ڃzL h(O3#` +@҃ +@փjK`iK`cK $lKh+,Kk x-+ +fKfIhbK cIh+  E(Fr[I ZI K K WIN(Y x|+U !(n /!F,h+ &h + HH.|̹ !FJFK( FF(CKhñ h +& a##p B7H! !z/##ph + Oq( /H-Kh+-Kh)Z+(5H!F(@+a+k!HhoKh+д %%%%ݝl%d%%%$%`%t%h%%-aIXT|^[p%%rTzJhB!wK@vKhB?Ӯ3!`qK#RoH(x+!iH(gH! eH!J(v]KO2`aK#*s K+M ZI<((XKK XK`XK` C ؉0 pCOMJ#`LJ`LKh*1KK@3AKJKHN x|+! hGI 0 + CH19KK`9K`?K   :H:K:K8B < EB,K5Lh8 < O0C0Kh++"KhK[h++Kh+Kh+;+x+PK#RJ G ȉ!)= HF%%`%% |T$%XT8 l%d%%.Թ_2c(X$|%%% JF ؉ L ىKh8=<-}(f:h +]єK  # G# D+@@K#+y)?uC@>Kh+?m KBh!???[!p# ##0JpK h,SmI*FF FP:jH( hHfO2C,$ "#B(&F Sh;S`+ B? (4F#Bv# "#(IOo hY`x43 $ FS9h# 8h#hAs##2Br3B2 Sh;S`+" F ,+ [-\ Z Lh +gK [ j hY`x aDJ13A1` Sh;S`+& jAF ,N ,2- L$%%d%X%(DZ%% hY`x$H#$I@B hA K h# HLI hL!hHt $I 8Kh+?# |  +! & +?* G% \%%%ʷ%pGKHh6%S81KO2` L" hFt( HKO2 @`` `% %`F IFF FF"BF%8FL hF F8)FE(48 L#hK H I 0 `#hOaHhK*FH$ $L4S H I 04OaHhK*FH$к$TF H! FFhαF,FEмB20!FF"*Կ8FO0-OFF9I@FFd, Ԑ<,3O ,,N,K-J ,M)F+IF (hH F! FO 8 z+F F5WPFCFISFBFSFBFYFhf "PF$+ԦG?I08x!*$*(*+FxF2 , ,,Q("*&F%x",5& ,)&3K%"((x%K!*F0"8("("8(\,\x3$K8(3x,",%K3K(88+ #8#8#8$8LK (8 K8#8`$8jFF $838$P^%P%𵅰MLNN(8{I(ixF#GIDH#OB1F(ڂ0)$8+ 8hhlCF 6H(8Kh;`+ hZ ` "p)H'HCz3,8#H)h "#8F08 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI mI i $P^% b"NmpGFI I"F @hٽ L#h3P `KhB~#hXBXA %KJ-OFhh-CC˰O!2ah8t#as:< vA0 8 򎁵@PF1FA0 Q0 F F 33C@wKJOq h2J{IEFPF(IFPFJK 0DFJ[FFqDOaaPF OaaFPFF q0DJ[FjD\%%TF5F$%FK 3DT+# K#*sh KhS K" IhCb `%0%%>\0%lF!FF 0#iF33P(O0 ]-OF-3LͰ ! F## !HFKg2SG!U a iB=j K #BA$MgOF0+3@vI  y0+R(𥁞I ~Kh+hJ 1!^ J;+{I0F9Fv A FYF( JA1 qHD! {:#sd+d#F0KhK*"-:Dh * |K|I HDqSxJ[ wJ DvH#2F9FFB| +@#!qmJ[#0  1D bh8t#as:L KKA0 (q8 Հ ݐA0 Q0 h$ z/CSO"q,@[$ 2 CJd!q  4K (q(J 0  {2+r ۵ٰBq-JOsEs 'JOqF \$Kh0Y FF N! ]H!Y@.A%%%%Ⱦ%rT%ʾ%QTѾ۾%%%l%+ ! O 3BR +# F64FF3-z 8JYFHFD+ q3JD2K "FhCMV2@aA FF"KA0 ! p {jB?0Oaa0F/FJYFHFOaa0Fx F\%?~Oh `pILcn` p`nCh;C`+3:BР + (,("(=;Md&`nCh;C`+0$A "( \(`nCh;C`+C#+p#x+,L+M h(I hZ`xhZ`x> #H2O0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`x)F`hv4ȯ%$Bɯ% FOF9FD.!0FF!FDFp9F0F*F8|]d F$$ȯ%-OFLFF#x{I FMhf`*h+ВH!F0 m@+^.!#1&(+0K(F8+p +VCS (}KhFF(&F;+N!RuG58jH5 ++3hn^ bI(иaIȱknD( YH0YH,hnTO0~A(0+IHknBf(DHEH}G(0+8H=Kh[hnChZ`x ( (hnCh;C`+D1K2Hh (̰)*K,Hh"+OQCT xT(IhnCh;C`+|A#IK"HhhZ`x h 3@ B""p (1)=J$pri2`5%Tȯ%\T`%zlǿ%%7 %,  %hnBh:B`*&BѩhQ`x!J`"qhKBKHhshnCh;C`+ "C p (0~ B 30@hY`x Z< O#p4IHF % %%dȯ%HKhF;sI FDxI" F`hK"`320[K"Z`I FDK"`I FD K"a I FD(K"Za, Od%ȶh;`+ڊiB ( hZ `ppG@KANh5hO33`>H(6ѕ\%F&Mh g+h$N3hc!BN0h#3`N0h(!B0hO33`#+` s+hN3hc!C*0h#3`#+` K `ZV$I"F |`4% %t%x%,-OFhJMgKFgLFhhfJhr4 (N#4狹4 $Ph(F4 M4+@RKObhXD(0 "x+J3h20[( Kh;i3#;a,0+L H!h!h 0h%d%% %, `%%-O FRNSO0O33`NLchk%MKNHhO0FgFHH(dGH !#pCH.!#p@H(2>I""\TB02*p K J9{BcP#F)ж4%`%XTP%TT%X% pGFFFF1F8FFZ鐹 ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H ( K#`o#`3hZ2`x +0 -CF OFF8FbCsFBFH !IBFaB #H9D;U$BKI J K(hhhhB+`  2`P^%# )3(%,%%-GmFFFF _ & #cIF@C@FP}I@BzI2F(FyKh+6И FqhBi.F2i Fi,0%#! bh1@C1ii0eI `@B a`aHO0 m"! FBFYI+FYH@! F0TH*FRO#0;h+ !29h[Br2JFAF F0ih$+7O ;h+=! `X4`$ t#9s Ozs""r!FCDRh+Nh#+DhA+?|"H*FO20"OqA Fz0;" #2F! F&0I+F] L( <#`,%D2X%ҭSMb8F F=)F F8@Up FF I FFhI F#x 0FpH)F FB. I"F I v FJ0I"F h/I P<I XPv𵛰#FFF03 FKhB#HB#H(F(KۊLNKh8FJF(FFD4 F~"F9FF I"F0F"F)F0FBzH(U(ԀwH#h*F0h+>sI#rHP"M(5oKoI0hnKO2`%Bz#< F!F FdBj#< F!F FTBZ(FYIT h8~SH,F F+ F!F F.KHbF(F!F(F ,,BHF F F!F F x+?n8H8F(F!F(F,^/K`/Kh#ibhY!aTh%iB m`h5)FBK(0 +}FFFF1F8FFjK,o#bK#` K#`O08FC\ *F"T,##`>B" +FF0 + K#`#obJpG!!Hl%K!Z0K<13H1hGpGl%PvKðh#Kh;Kh,@ C|L !F!F yHv! |! xtHPqJ1 qHqI !<hGlKlLh!h!eKkH(FB`MxA@+2dLxk#ZK1hG+l^H4xx,+x#Z"p1!h[hG(33MMMI(hFhKNCO"FOq(FH F)hEHDHo1Fx8x + F~=H_3(FZ"p(6M)Fxk8x + F`0H@3x;x,+x +x#Z"pMJ1h[hG F:3 F|K!FFh 3п%L%t%l%,ePd%dh%Կ%Tʫ^,%K! ``,% I`K"`u$%w!KH`r(%t% Kn:f*oB (КmQeppGI{ 8 -CFM O"(hl1+`&O J "(h @0s FF H>I"(hu,%Pt%$%&H! !  vCF3ИpBH! ! F !F K/!LA F^`A" F I H, I J!FIH"I"P (4K"sLXhI1N[P+x;(FV)FFphI"phK "h40n+HNp%Pz%>\%? HP"iF Khs K\A F(H!F&HlFQȻ%PW$F K!h FjH!FHB ^ %lq K|Al#x[ FK!FFh P,% K7FLA/! FHAJ# F+FN0!FPVhF pFx# + + `F+FKl , ,њB10kSFB10x*p-GFMFF|   *hjhFh!FH$FzY$ +ѵ,1+  - & +е1+?~<1+.HAF2l1+?n#0n!K"h J!K0 ^b+h* "" @BэNBY fHXdHH%V`eܿ%%%,%P%̼%Ļ%&,%$%p°9HOr F(@6K"6IXhZ! ! 1J! F/K0I"hR%,H&F+K<1C (Ha'K""IXh,%J! ! ! Bp FFF"(݅BK!h )F v)F r}HV(F%V`ܿ%%%PL%̼%,%:p°;HOrxF(@8K"8IXh! 8! 43J! F:1K2I"h%.H&F-K<1C *Haa)K"$IXh'J! ! ! Bp FFF(݅BL)F h! h~ ~)F )F H(F%V`ܿ%%%PL%̼%,%:0MF(hI FJCchCc`!(h J! 0#ch#c,%̼%0 MF(h I FjHC3(h!~ 0#3,%7HOriF(a4LhF:cy#cq0K"0IXh1 #10D#00#01 1 #11KHi1#!1K`1# 12 #2 23Ht@HHVP%2$%"LI h hI"@=,%{t zt F,!@ 8F F 8)FG( 0MGI M0D(AH?JOa@F;KLA:K,F | x2J!F F LC -HXfd ^'IOb"FTBѝ 03 +IH,H.IHoIK`!Dx *#Cp H{B8^ghjPVh@u% rbt%IHP"-HDOr@!L( ` IH@@ HOriF HP@KhF!hkh%0%P0P"MI HLHQC+H M0@ (55Or@!pH M0@ JOa5hF J)FhF M0%t%8'P"IHFй HI(8@ I Ha M"FlFl1+Kh8@8%TP,%pP"m I!Hl MHQYBF*H mp@+mIFF8H1F mp@J5l!jJOahF< IjF F mp J%t%!TP9^AIHb ( -O( K&ĒO~OO45F`OS`;`KO J{AFёJNh U)ڀIW *щIHPFt+"`+ F+L"9+/+0; "6>`a;+W\c WyO8E+0+їP+rKrIh(FR(oI(FJ({(FmIDF(kIfK@F$(gI ^K"cIh FN(haI" FF(c FYIF(?lZIQKHJh`dOKhWK`#]0 TIIK/!PFMNIRFNHG oB###"#"FLF8` (?/ @Il(?K"`$統=I-%'J#O1`9J`9Jp$$O4 O5 2IS"PF ,J`+K,I *I (I &I ;h$J !$H#H(N!IQKh%̾%t0 ؿ%Q )'NnƄ Aп%|%$%L%0%s0v%|%(I"(K2``p0&I&H!|5-"H#Hb c\B\A#J1#<1K Blh#13h8hSh:h IHK$[h[ rI 3h#8h9( L%0%8 P$%N%H!@%6I s(2H#`1Khk -Kh+P 0h &Kx+ !!#K`"L h(HK"`Kh+!F h+O3#`KxCC L! h I h"<! vO0i*%ؿ%0%,%rT t -AFaM+h+j@_HfF^I ]H\\J x/)7>UYI"F>2VNDV)ySN3hCSI2F>0OS3`ONPI2FOO>{0Oc3`LN3h+f#3`;h+@HI"F GKP``BO;h+):hCK`"CK`CK`" w:"I>:h#3`*(8Kh`KhI"F%̾%nP%|%L%uh%T%ؿ%= rп%uI:">`sK8 `0spKh)ր0h(8hD@ iK:"iI`>gK" fI:">bK"l!bI:">]K"`_I:">YK"`[I:">yTK"!WI:">oOK",!SI:">eJK"[EK"Q@K"!GI:">G;K"!CI:">=6K"!/I:">31K"!:I:">)8K"p8I:"> (K" "4Kh 3J`3Kh 3J`3Kh2Hm2Kh1Hg1Kh0Ha0Kh/H[/L/I"F>.I0##`,L"F>+I0##`)L"F>0 ##` /$%h%T%Pd., [:Y̷0%8%4D%?H%@%4%<%"0%1,%(%ؿ%MIFF(FI"F(F| n JhI %t HCh;C`+0C hZ`xK[h+ ##@ %L! %H` )F%ȾJ! ̼%J! %0)MF (I#`! !H!F hLDch;c`+ FB"p  KhXBXA0#hZ"`x (pB3 %]0rT 9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+$%.( K @0^"ed""f"HpG(? "de"%$%FHLMNO < <Kh2ùlF0F  <T< "*"F8F 4;P@D%0 MFl!Fyl!Fy#SC@rp"CCI 2C32""b"$ !b#sCcl! 0#c%PpMkh FB (Vh+ HH#x+Dq2;p@Hp%SK7nM0FKhIJ*xb Bl " FBjx ԝF H FhG 0) 5P%rTpF,L-M1 x[@h0FA$I F#k`p!I F#k`FPI F@I F0I F8I"FH<H#!FN$M+4,B+! F!#!P%Nbhl $1%K1#Kh4 P8%K"LXh!F"K!F"@h%%%p°#M "(h&FF0 +M##p1빴B"#1y#0K "XhBpB*(h ";Kh( I0FK`n#y#0#1%P%8%0dJ 0[ `pGP!m $VN! TI TORI %3h#0;h# 0O2!hF(ݽ0FL"0h!F( #xS+W+B+L08hOb O@, %Kh+(F +Kh+!!FE"F @1+0+к b"F!x @+|)84E x ^+ xh:`* hZ `piB (%4,%%Ļ%P8%8F L hF F8)FL(Рh )FD(4P #KCBA@  F F@y! H@'y;+&!0h&)F0F렱P0F?n(F`H#y#P#qcyCcqhB`+x !;#B`+x"{:JFAL#h;!+@NX#h"+"`.h0F#hD+y `;+O4NGNNNX3n;3f+2oB۳mZe "p9F V 0{'I0 ` n; f+ oB ۋmZe!"p)hHX1! 8H1Fh#h3#`6Fl#h)FD#`0h `1FHr#h"+#H#`@ۺ H1Fdh#h3#`(H<% rTBXȾpFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,`-CF9I(=7O ! FF6=! FF(9#p FF(Oy5["(FFHFn4F`y! F4#h+L#h+H##`LAF F(FF)F?! FPpp F\F@y!nh(F#x!+ ` FJ!F!F8Fgl<%ȾPh@M$L%F h\1Oa!JhF IhF FXNO"F@1hF F u0#u0 M#y՛~`#y4BT<hD<3hiF8FH !hF#phF3PTȾ%pF FFy[ FJF(F pI0F  F|F!F h@s$MNI"(h (h1FI"(hI(h"<H Fp(*I(h("0!H|X HO!v( HK!p( ,%f@xt yt @%0!I$ K,3CLF0 0KjK "hz FPP~B +! ]4B)=@%P,%Hp!H,0@@%"%L&I h6 #I" h.! hxn?@ ! hxdI" hH}0(3(H8H6 I hI h" h!x>I" h h.,%xt yt f@'0F(g=K<1FF2" ;$k . ;$ F& $.$ ?1 ) $; ?% ) $  $. $J 8#of(?H !fF3+;846:@@*Mp[l%*<и?ɮ2F O36HUO5F g'2H2H2H1H%2F#lhF B%H O3F]JzD+ $g+ظ?H hBH;2 $d+ hB H; 2 +q H%7Me-OF O0 >^FO0>YFtHtJP &hQhC +F   "OsjI8#iK& o h   l\Fp`H4F8F?+(F?(FO6FFFlF&FFFO2)FXF?PHO4O8F?(F?F 0FQFH4PH ùO2 9Fb?H-HF9F lv Jz rF !j (5H58F?(F? !j()F XFR 5C BH+FO2 lt H J3O1(FC#OcC#_p")FXF( H48FH?}(F?ztMx +I.@-CFHFF 0DH#&o` FO3P??e" F ??4Hw$&F8C0H;F.HBFFH;CLG@@p@BgGG/9!KBv+&C4Oc!FXCozs!J kD I, ,."H,H)FC4F@d@pDtv K#Q8 Kxp (HpCOK ""[h;K#F9,p$.F"F)F Ch$D K2F F!#,HHRl%-OFx]-+Cx+,FOO F(D00h++ F FPD0>9FHKh ]O}v! ]!F2Fh DFH)Fc@F ]O>pCOрH!FnO@W)F F| !FuH9l(F*T8(FnH!F(,vOb!FpCOF8F88FR 0B>1F\ꀹ0Fx"(F,(0!F TH 0 CQH!F PH#"(F# 00Or@!8F(FF 0p;H9F&0KRF#(FO6F1F(F4F(FF1H.0F.H?? 8Fp'H!F=*)!8FAF"H9FPH9FPl#EE #ZFHSF(F8FF FB+ FBF"H!Fxl%"N0p\q 0[#Mv#JOah#Fo hvhp20Dh 0vOr@!RCFHvH%P)F0FM0Fh 0+(F`0H FH!Fxq! q=FF+ * *pGF xx B0 \ܱ3\ %FA%F/ 3A/ a,٣A( 3(FO0KOh`Z` KhK Kh3 K"`   F2%%%|H! A ^>8F!D)FFx2 F8Jh3`pG%8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F^!0I"F`$shu`+`hh!Fdhp-hFJ@!hFhFr%uF@1Kh# F@%O0%8F F@Kh+)F F8@8%FFF1F(` +`#` 1F8F `(H1F `KŽ-Fs(x08 Kh+ F@%𵙰)OF-J+x+G9F(F4(!80J1F(F]J 0FM FkhB F!!l` 0KhB!pG%K!i Xii%-A F xFx9 KF!a F M' J)j/`]J F)j/`]+hCE4F%L-AFgNsjB$b/^("#b #!8wb kc<#cwLot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕI%!'T &7 (IjF4'LH%'Hx(1Фv b0P+#b HhHh"(#jK b`#j+ܿ##bűfHS0R(nfn+ܿP#f0H( H;:f H(ht@%֠%K((8(  #&) 1((2 H]HHHHHHHH(#H(#Hl0p#Cp #D%%𵇰HNL@ 0`H#`K(FF^(H#`z#` HpHkHfHa aH]HXH  p(ĿK"ȿ`KHxKpHM(F+FH<(F+FH< |H{K(FzHx8F<->L. (%{x-;۲L+JWVpQCFZx.+CF#X.`"`# o FXI8HO1@yiF F(())H޿K[Mb)) H޿ K[M 1)HP)H;?EPB8FFF((F!8@չx ++!(F#x++4 F8@8 L H! * !% ! !#`%BKhCCH@ `pG8"MFF  "!F "!F KhKpo FPF`8 "!F%% KhCJ Kh4@ӹI F@%%FKhX@0x F@%FF#XBXAKhH K! [%-CFFFFr B??(H!C dO0 2??0 H!( (FBH!H)FE<,eT$oIGCH!DBLE4B<d-"F"C`tAdaKhB233BpG%8CMF+h3H! ,`8-O#N3h+ "OAq:hB 2R*DwO2`(%HYF (ZF Kh("$&\%%%U%%Kh+{Kh(v*?siO 1)DhZFO dCg0+pKh+?? f%D & KhsBC kIAA@ApGO0FpG%L#hO0!C#hAqD"kB2"cC !2A !"%8L#h+Jha h O3#`L h=Z##`8hC@3S Sh>Eli $ #S``=30hB#+b6ki  (i8h,@O3a=K!F<`h@»%%Kh@@ipG%0F hDHh8#hBC!B 0ZR@hBQT20BS -OF1MȀ$Đw?[+K!F(FZB"O b+B..+A0; + "##O O  AHF!  >B@F!  5K;+#c+$3x0;2 ($$%%M=pFFxM)h! FhlhM)hY6H1F r 5 F@hnkh "` p 5缦eFFFFرK1A?+x2*+!kxcxSn!X(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##% I=HFH H H H ,MNO#x+KуKH!4!!8!!FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p%KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF %FI I F I Fh Kh+ I F8   `%X%%FI I F I Fh Kh+ I F8   `%P%$%J пò\pG%(FIHuH( @F0ӲHJ !nH#FT!p ! FpH#FX!(Os4$(FK!F"p1%5%FIU8I FP8  H%,@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF F|FF<`@0FrF(F ȹ(F2F0FO1 J)F((F( $$$%FHFHI*FQFI"0FJFxHI*FAF*F0F I@8I*F4F8F<, F8FHiFpI FD I F>p F8@}(F8@ (8*-O F F2F(( pCO5I FF FpD+%@%sL8xhFK (h2DBF(F8 83D 8 8x[ p;B8[x+hF+ 8%@%pLXB"8^]k. KO2b 8B x@ p 0F% K8x %8 L#x%X8O2pKb 8 % pFM F(F@sBD p(+BB KO2bh@ xU;;;% 7F% xX!*F F (0K$ `pG%-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@FTPch@F0; F;LFh1FB(#h`%FF"FFpGL$XKjB"!F$8"a% K-OƲhFL8(h+Z($8+Z!](b*O(h088#h88+;#8H1FO +"+(F +08Y#DB0(h((7 #80&9(.ѠxJ!kBA(F(F(C+tz#=)pXde(#48&#48(؜#48f#488x8x +#488B< + 8Br< +?m:7#488Z#488x+?R#48J#48#48!#48 8#488B< +8B(< +#8B< +#48n#488x + 8x +8x#8$h#48V;%%% Khj*(b(5 /FB RFHFAF(ѵ`N"HAFu H8x+?48(@΀8 ;#88AV8xF EyKEFEF-q8)/ sH#48F!8FFD8x+F )cIdN405!FE)oѺ*0xxFBшEFO x O Eث.F (ЈEFٺ ERF0F( 1D!6E F@+; +p; +R#U +R#7+E+Z/+ѫiFl#+b)ip@Rhq`p@ #x%F4++ ++L h; +x #`(F `Ax"+ixp@x"+i@xKh+p@ ^x!+hj; FhbKh+ohjIHp@Kh+b I Kh.YF(<1FHp@̽%%%y-pFKFFX`0F)F Fp@%NKMi@4@F/#s`c(Frj(Fm Hi, , K!F`@|HZH%*G% p+LhH7#c`*h&H6hZ$H0h"H*h^ H$hHhHN%h A+F2F!5-ѣh HK"`pL##L H H%%4!Kh@<KXhi8 pG%COppGKiFH]Q!F KhD```%Kph\#xK%;.FM%B p]&>#x5 %!F VJ#`hD` `Fh%DF F-G#_Le&-]O`]Kh3s[;`O ch 0 C QKhO0*#hOGo ( hP @Kh0k}P6Khܠ0  1+^[ 8#@ch7+?OCOS#;+?Je(EjH")F @ (? hFP0I#" f0+?8e&2+rzJ`#*ssKh K"! i2+riJ`#*s"! i[#*s#"#YKh+ #*s "#*s"##"JK"FhyGK"Fh#*s#"#h=Kh+*#*s$ #*s"##M"!#*s=(Kh+"!j$Kh  5F 2+r;`Kh+ "8hFG2+r;` "8hFU e %9>L%0%%#N*s#"##3`gci+#c 2e+rd;Ck+#d"##ck i*(q (q+ci+ yKh?SqHwnKh+ #}"l hK`blgK`lgK`(?mx bKhC`#*s#"##YKhCB`h`#*s"##g)!i {8hCsh&LCC`#*s"##F!i Z`h&s#CsFPBPA d+K.Hh`*K"dh`)Kbdh`d(Kh+@?&J &Ih#Kh+@5 ۭN0hpIzFH.0hHIFJ#I h"ZKh! `0H! H%U%%%%%%8M*mD %#*s"## i(?{H0r#H*sKK H!#*s"## i(?J#H*sKK#*s"## i FFH#*s"## i FFHv0F( ???Kh#*s"## iA(?H!L?|Kh0F0F90F#&abE-F(?1F"#a#hIF fKhKfJfHgIh.F0F޻dH!`IF F( -e& %P -??.O1(F!t#QIF> F(u - -?p(F0]#FIF F(^ - -?YB(FaR3Kh+9IF% F(B - -.%(FF(6&J% &I(Ph`.%#(IFx#*s%K`%JhBOvv6!i[`K"` h+߿Khs[2-H%%%D W'4@H,%%%@%#*sK`J#ih Dh+߿Khs[2K"`K`chi+?ϩ|0F I#"(F+¹Kh+?#c,%%@% x%Kh0pG%8FF ^$r!Fv(F8-OFFFFhD%FG E[եB< +5#+p-PF>2F!F3($B!+JhZBB8FZB,<++*)HF.FBFIF4(FzQHF9HF:uFIFEK# %hZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B" *+*F`xETDFh(EEF=?0F+;M&FSpF FFR ! 98+hD`4D(``` pO0-MFOO O $ò0 *;p&  `Sh 4O07F e 00;+ (ݝ0;+ A-@,A, Kh+B C Kh+C B 0m+KhB# K"`%%%-AFFFO d +2F5B$hxxBI)]Xx](g(B 5=`@(/+ '%@,A,,e  Kh+ C B Kh+C B K!h;B# 6K"`D( [d(f(Ѧ縱Zxg*F;+xF0*/*r32i %%%L h`hhh@D% FFH(ڽ@!HpD%U FFH(ڽ@!H\H%u-GFVKh''8F9F(FqF(FO7!9F("#(F?? F92F!F(F~F(FOsKEE F9S  #xCcxM+ѣx++xG+ <<+1F FvGQW4K-CFhBY1KhBU0KhBS  %FOFiF8F 5i(F-B( e$ F( C1*crd,-=x]x +d$,Ф+($$%%%-GFF FhxF+?CE=F!F;+)\+/ +%NmF ŖnFPFfHEFFQF8F옹shxG#x+4:+F;+!6dp~C HiFH9Kh+ O#HiF,OsB , FiF H??iFH_U%f-G FFFF F(`FDo`':FkhB@*@nB 2FAF F s"D4#x!F ##pkhFB!.KxF B +khFBkhFB '.Kxp4kh'Bӽ"@A8F FahkhB F+*ЃB 8F|! hIAhF)*ЃB pGB98,*ЃBpGpFFh(F!F0Fp@{p0!LhFV#?? hiFJh hoFh h h3F(F h!T##`K  0%%KhSL h8G h@%%L h! h%O1pGCѽ@!M0FK, F(#Kh"H!Ma( D(O( A(!(Fd( o(Oq F6K`Kh+0 ! FM#"(`# ??(hO3+`H%Y-OF$0B"t0F0F " HF(HFKHFa 1@FVF@FwF`@FO3{F(@%F&I FHXI FD0 F Fع%FI F6( &&Kh+f(c$(_ЃH (F K&iyI(F O3&sI(F O3&(FFxqHs9\CF9F F(F( Fg`Kh@F&Z(]H Y(FvLKHF9F@F'FIIFHK1F"`nEK`EKhBSCN"CKh3h 5I(Fh (F@3K 7Kh(kO@S3h#/KI F"``눱I F\` Fw(K"FFh(F8$Kh  F8 KhHFQF ??FFd0s7%n*P%%U%%&%%%%%8%D &%,FNFбFXDZEF, *F I"0:!0JE!F,@.KhN%Ki0H!, @H࿘%*-AFO FF.@F=F\ @F(ѽ;hѠFD &KF"h%@K" `@%KFO2h%K" `%8F$ FF@HB F8@ 8pF9 FrF FzF Fh.ep@ +"!0F(pO2!(F|(FFF FA F1F| F8s(Fa0F8mB 8F -GF!F$'FFhF!FhFEF8G0F %FF)F/F@F86F('FPF8& M8F)hH+hB0F Fk8FG%KhF > F@U%F xpG%*Zx%*33s*0@0pGL#h#H ` hK#`%&4-G!Fd Od O FFsh;s`+ 0F (F'#8F#p3hZ2`x - 2BOI !HF~9FFr8FGF8@F [CHHK(FP -AF!DUK"xxBFI4F#x##8F3p xBcxB4;;>FFF#x+5*FAF F,D;;@A-OF8&F'FF,K,JFq%!8FFF/3'p-x7BxB&-FKJ(/D&O 6 F!(FKJ)FxC KxF0F9F FIFr,D0;F@A_FHF FF0I F@!8FDF(F@!D4 F KJ!F;FF(F8I0F}F0F8 FfK-AFFF %(Fx+ F0F!D4 F8F( K!F JCFV/!(F((F8f4oFH!F"@-AFЀF4F%?s!hFF?C(F#p#+ %+ѧBcx%+#KhB cx#+HD<#+5<%+#+ѷBrx#*F Fr FD%+ ѷB rx%*Jh,#*;,%*%%-CŰF E$"#(F??Or(F1F8(p5lB,Կ  0K)b()F4*F!a0+F F8*F0F8F(4%T%-A08KhF+]6Kx*F,F(Q2H$FA0K(F@FF FDq6!(F)%K)F$Jx$KxCFF&8F8?SE0F0D߹I"F0FVF0F8*_8FPF8F}>+x[(F8 F:FAFh F,F8%*ulA~@??FKh#z! F3F!FJF(FcF^)FFzF F4F88F8(F8 F$%F Ib`I F\8I FX@  *nmF iF F40 F m@|hFy mHK-OFhFF3EKhO0BH=FбFxFF3|*-* F(Fx(F 9H!7I F($C FF(FFXFQFD4 F-*F[F!FF4XF8LPFqFPF8E-й *е@ "c F((F}L(O3H;`F F4P H<`(F<F(F}*#x+ F8$%%*n*K-AFh F.IO0%HF(?(!H1FA(FF FF8FVF(FRF0FNDD4!D F!F+F:FF0F8(F8@FF@F8, FA%iF( p@CXBXA'] 0FL#hx(F!0S)FFqI Fq0 iF(F((FF F'0$hpCO(F!*0.)FFqnI$P%@PF((#" F#PF܀@󥀸DFEF F)FJ00hC׀??@ЀzKh+@ˀyKyJhhC@Ā#0 ?? 'qKh+PpK FpIh hC@sC)!O1)FE F)FYF F/|0XKh;BBB  F)FO EcoBBw F)F30N'O kHKhCF(^DKh+(AKh+@H@ F)F??F FQ!Fc(G!F\(@"K h9S(?7PF??%Kh+ !( " !OT# 08K hC K"O0`ON_4%h%%T%%%%t% %(%| %% KiS Kh( Kh+Kh8pG pGBppG%l%%%-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+F&"KhCѹF  F)F:??F FѸOEAO0Ge F)F".F%%%t%(%-OFFFf'p  X FO`o??F F>!KhùOK h9"(#"F@F+F,FLO {F F (op??0$%FF F %%D &-AF FFP??F F &AO0>C*F#F8Fh8 MFF+hB(hBԿ  8??4%K(FFhB pGK(FFPhB pGF @F޿8F(M+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8%%KhpG%-AF F"@FDE/8F78! F0F`0F #BEF#wa#a 3+h 5`\`ki,`3ca#hCE'J Fh3`Bh8F20FF@FB8F7 F@F70F^`$hZi2Zah%hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7@ec8@kpG-OF FgFF:й7`O #!2F1@F;FIF^F-Ѐ= !FO??# ZF0QF#F(FBF x#"(F2QF2F;F3FXF(> \F< * -O FF  ?? O4%F F)F Kh+sѮK FIh hCEs) O1!)F F)FF F F)F{(ѡNFF3h MB (M @FIF\W@FIFFF\OFBw>DF (f 8CBCA$O4%Fp .q@FF F +H{Kh.I&EN(wKhCѝ8i 0m2F;FF6G(iKh{ к  6G ( ( 6:gw ҉#(е  7F euE[RKhCVBO am 0F"+9F!,@FIF`( BKhk[E FF@FIFFJh? au . .)F F ( ( ( (F F'%t% %D &%(%@%0%t%|%?? au/ Kh[ . . +F FF# 0W^@%7F F/pKh*Կ""#(F!F#20"%-OFF.y#O3  $Kh+ѡKh@BOqy( FO32FKFKhCpi(ѓKh><Fwu , ,ьL0i#hf ( (0 L#hX (QCAm([ O8 FZ # CF?yjKh rcE (FUF!@t`KhC@_Kzh+~#j{o0B8Fao LF KI h)'KK"` :# F"l(+O;h;BTO0 khI "3k`F#`"QF<:FOa(8Fh MqI"$,nI"8!h!hg hI" (@Fk=.-!.*<.Ц ^+)#` 0ZH>.Zx=*ј+&Zx=*ј-& "FFELIMHZx=*ј!JJ 3F<.T+.W-.[ki"=.kiYКB""*?x(?uFFF; +L#+ѓ+<\+# p3x+ *=!0FF(SІBQ,+*M  Jx(f!hkiBԿ""kiB̿""kiB""JBJAH@Ե>%Q* 4 9 ? H -o  !B!F43x +=+ !h"0FCx=+:I;H!h !!F !!F3x + !h0FFxFFk . .#0#hhhFHIFHOd IHIF3(PF`x*!h_i!hx(?:!!FO-    + K!B(¿Z`i`D`pG%K T@ wYc%JF XB0(O0pGxF JhBJhZBJhBKh%%%%-C!LOH8F6!F8F6F6@0F6n (hBF0FO(FIFHF6Xh6U ep%FO FF0BhU;iC$`(%8FJi]a FFF F8@P% JFhp`e  Z  O0pG%8Kh+Lm!.P M 80 L (8"!"!T%%; HLK0HK0!O`!`O`Oc0 aHH H H H#0 %  %%%%%(  pGK8pG%8#Lca#F0biaB$H%`U8 :UU@UPQ H H~ H{ HxP8hT#iiC"Pi3%%%%%%-CF, F0+3FF>J0hC*0+8F1F5P[ #jFhFF2N%3hBOnF%BQ! <,K `'>F(F!Ff%KOb!0+ L!M +hB! K0??ЍBt JBAJOq+ $! 5 @Q5%%%%`%(%KhKhKh+Kh3pG(%%`%%p LeiiBcia0#`p#iS%0+h0FY]5%(F FF0@7Kh#F(bO4 F1Kh (A(: F,Ni($$+2io@G;D)FR#8iD3iS'D(F1(гi (F*'хBJhABJhBJhD$(!F0F2iC;)FR#r(СKho%%%%%%-OLgF FF0??)1+@Ae#1ih+@O1uFiPF+ÿC!i3#ȿQ#0)F:F%)^r0F9FOG(HCD#??вBADg#1-%O kKh+oѸ| O  1B 8#??08g+xHFFFEr 1Bs SKh 1C1+#1F!O HD #C ZE  Ѣ1+\1+ј ! "g/  "S#h(F  Y/KhDE F0"!]60B#H & ")F-H_2BZF#aiBܣiN a0 1PBl1h" =}h\T!iQ"2A#3%T%%@%% %-AFF FFKh+ 8")Fg( Kh0D(FKhDB T%%@%8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4% O?h/ # F!O8 T%Ki(!h,!pG%K(!a,!`pG%(FK:8  %(F HK!F$8  % ( ! #3` Ch F) h\) \B\A` h+J\B[$)3`\+#C`O3` F( F(DpF FF!*F FU#hBF0F(p-GFFLFF P*01;0#10#0(1F(FF((JF!0Fx 01[h PH JF!0F`F(059HN0q}0 ` K)F0 1B qHF 1BFۣimNh0kN+D*FO1B ([^H3`05#01.}\Kh*[Kh):BF;FIF Gi+*_i+I`iBhD @%i@8U 0BF;F N8 g*9)/)`hO1DcFhBO1aW!iFi2FQ (FS< #h(#`#*) " F*()$+05F-aIhi h\iB"iR#PF_.2ѫE(BF;FIF0FnO3060 CE%%%%%%%%%T%E .dCKh+BJh*)CBF;FIF 8_.hEF _(E0FPihD1FF(,I0"h01+0݂B4A!F>d"N2F)F (v<,~I;Q#B;8AKh+?c.`0+0F`0FBF;F ! Kh+JF)F0F%%x %%5FTLFFh - (#! -MJKh+IJhʹù0+ #g0 " F0$+i $0%D &-CF;TF FFF??.0BEF7 46/ѽp%K F-GFhI *Ld'd??7 46/ #BFSh`hFQF(F(IFi0F"x%p%*Cxm+F )xF(x +) "K%hx + "e)x *'hg`BԿaa4``003%'K7 Fh5&H!0@(2( FmK`0|H)FKh+H FLF h4s(FF `(F4i h 0@ Kh+ H)FKiF Hhg%%K"`% K7h* K%LhEyK`0%@BH%(*0 x.+1$I\#K`#"H!FIH!FKO2`K`Kh+KHhJ !`(C\0*  #< HF(*@H%Tv} K7h* K%LhEK`0 @%@B,%(*0 x.+1$I#K`#"H!FIJH!FKO2`K`Kh+KHhJ !@(C\0*  #< HF ,%v FF@ F HiF9 FF@ F HiF'.FFp+pK`Kh+p@!H YyF 0Fp@???F F0FoK(F!Fp@hiT%%RH%F+7F +K`0MF(h KB3 F,F'(` F0@3KiFHhHLp F8 Kh+Fn K` K" H` F@O@%%%4(7 F/0 xm+M+h+!=+L h s+w+L55L5T3Q(F- `0 L5T L5 L5 KiF HhKS"0J &<48%U0KhpGX%(pG08(<ؽ@JL HC F@H=9H6H3 FzD#p JCc`Kx8HH*% %08(H!K"`pG%(Kh pG%0L#h++ `%0 L#h+HiF#V##`% 0 L#h+HiF#@##`%90 Khs Kh[??ѽ@%%(0 x J^+pKxp]KxEiFHhp()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhH%%w(0Z09$?+GK`0R++D+++BHiF0e *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF%KhSKh+Kh(Կ  pG pGD%%%Kh(KJhhDpGL%%%FxFFEHiF,F FB!D8`FO!xi;hK\)cxS4;;$)#+p.0F(%xBh+h FHJ*!nH]*!JHdX% %LIF F F%!(hS  pG(h ЀipGHpGo(C HKl8 pGX%KliFHH]X%Fh FFx-+0''x0; +,##`O0- HiF "1F(,-H ##`/@B0L-OFpNlȱh+ +Ci G#d Bl"iF ` FFx*\x-(W/$( (٠ ۲)F(+(#3e3#F F(#x++Dġ3`s F39(/(z$ 0 Fa O O F F,F,HVn(0+Xx-(3+(@3% FO@!a O O xF=*ూh**5H=J3h;+"F23+'H'H2U`ci!F G,n6[ 2-ѻ;#;#[xd0x +iRF (x+"QF%X%e%%𵇰@#@FF FwHW-hY qH煹 nHoqAx  h;+@e_bi*@h+5F-bi--l!i h[ `*`%h.gУh`*M%1[ `*C%-bi- ->!i h;#;#[1;#;#[+1H!l---!bi+#i`#`bi%H!Rbi* Gbi*- Gy-vh+ӱ#ih+H!#i!h3T# +#iih!+-tv#iihK"`l"=i%FhFF xF0; +#O F xF10:ײ / "+.`<##`,##`O0.HiF+ܿ3 PC30KhKh(   pG%% H: K"` L#x#i h`h!ciFG$4%FHx FpGBЁh ;B$0-O$,M#FF'FF*xb+A#`O XFnh~$5O 1hRF@Fv, A8(ټ- IEIE 0h7FxF#F@DBDAhպvhO # `+?h`H((ĿK`' pGYKhXH4UK" "`"RKhBPKhoo ]WHJ#DIhB `G #13BKhBKh+AKh:K1+2!.0 :J&0h"oO293KxB ,JohC`&K"`+Jh**J#`!Kh{X 13 1+ J 1(h+?gh#+?aO0~ KhB?y(K"!qon%%T &D &h%% %%H!%hF]Fjh2F(F\F0FX!D4 FJ+F!FF8F F2(I"FH H(&-CFGF"F;FtD;F"F)DebEu&ICBA4 A#d"#]7 L2EE0@B! K22JKXChF]Mb@BK IhT "FXh`lBK"`&%FK\`K$""$]pG&8FM K*hB+h FZ*`p"K$8&&KshK"`pND FFB-4Z4(FD &%&D)-C FFF@BaAH Oy#02FKFF F FS `F--8F-#<!Fl (˿-AFDppFF# 09F#F -(-0F-",!Fl (-OFF FO O O :F;0 )٣a)أWBc#C#F`CK A)أ7 O0O1-OFFFO O %BF;0 )٣a)أWBszCFC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWBs#3C#FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFD #jFx FFF (CFFFFF fO`29F0F(FK FHEK"$& ( Ђ*KAս@8o!JpF 4 F3 4]@)F F]p@ ǽKh YO`K)F FhEDHKhR K44DhBp@޿"K`k&%% %@%%KJo]-(7F F0)F F0@KxJ)FJF FN0<(6(8F F)F F5F Kh+޿K"`Q, F8 3@%%F'KQFFh+!Щ! "K!Fh!K:h"[ CBF3F0F2H!)O4)!wF ##F!FFB $(h \(h2.` F(F2d% &%T(Fh B h2##`@ pG-OFFF(V_MFDFPKPDE pO3`+`&F"#FQF xѢA 2ҲEшBЙE!13B ,`3`#s`k`#KV#U# B 3+4+!F: "B"6  :  +!dp F9/ۘE3B#s!``) F#  /F"@ E"\E"@ F"23F*Fd%HpGd(B Kh8p@Kh8KhpGKh8%& KpFh F K.2hOؿ"FCTp%&Kp FhFKJ)hOOؿ#DD!Dؿ"ep%&K!hK"rh %& KphCBq Kh#BO0RoBThqXp3&% KhB $32D*t0 &K h9%K)phڋK$O6h9K&h<U1 [h??1` U1 [h??#pB1D&%NM2hkhB#,hhF! F2"!0h3hk`F(`^??S;D3B`p %&K(h( BF8pG%F"YxX:)ء.)F?)\)љx)И2*pG:pGFpGpFN M+hFBF(1F(4"Fk*`"Up&H8F M??,+h;Bܽ8@4 Fy8% #jFhF] "iFhF]8Fx FP+ b;۲+DB"cxj+B+ b+#+`m+ t+ 4(` F8oO0oKhKH%8HKMhK;* F F p M(`ph`p`8%&4-CFMx..`;'#xC+hBГHH :+8 %+'.+𪀍0 p?+ \+cx+𜀍0F# 0#VxF ظK ظBۀD FFtL,S(iiiiiiiiiiiiiiiiiii9GUyaggiiiiyiiiiiii(hB  X@0 9Kh+4=6Kh5I83Kh+?sC -Kh+?g??]0(Կ  2(KhZ???Ay(q9C?5m(q.LC(a(!Kh&&-%%*`%%#HBF6?tS(] !]]]]]o]]]]]]]]]]]]]]]]]]]o]/]I]]_]]]]Y]]]%)h"B Fр+`"p??, #rCjKh(qfKfJhh E8a:0A??TP !n8aX(qNK8hLKhLKhKKhqHKhlEKheF@F1nq;KhXgP5BA*s(q8aH(wsFF??F F*sHFAF \-PFF?{BA*sqF F5 9 ()"" Hw HuKh*(tQ%%%%% OKh84 Kh Khd -U K KXhXK"`%%&4%Kh 4FhhH %i-5`dBsh,vBs- FF FdBsDh,`%dBsۄh, (F`h h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1# Fc`@pFDhcBv! p0!F0Fk#3kh&``[`l`ch0 hYa` p&,`-AFFF Fi&K`h%K``@h(< `F/B$#J`hXBXA@KBF1F`#F(F( `h1J#c`(FA )F``jZ:F!1(#1/e`O0d% &-AFh F^ iPBp 3PBrڰjBrh"jE|/ۚBj#EEW## MFŔfFBA۲hjBPBABPBEhCEEP8Fhp`Fa `a`#ka.`Ɣ)hѹia3iSQBB8F3i`F` a`5aKi+ hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAxKhXhq@ h8 &-CF FlT# GrE#hbhYBѱEZGs2CB#AiF@FEchZGs#  4 &-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fl3hBB4 0"#2"F( F &K""`ZapG &FKh 1Mj>#bKh&b FM??5 FWd4;h;BO$% &%%2K-Og??W-J h,KhQh #O޹&Kh %,F0;B(C2O F??FF@F[Es ۱??ІBw XFQF F%DF%%%pFh\ KDD  p`1 F14F &H &8F L 58@ $i!8@Hj[ b &j(H0 &8F Fy 8H*F#Fd(#BA 0 &-OFF #K2h KhKh_YF FKhFKhBOrr 3OxFAF[FF??+: 2?? K3%F^F # Kh@ 2?? 8J՜BF{MںK4+Hȿ4 FYFĿ34B#SFF3H??K8+:_??FF33S??FF'6sV  B s 6 K ).SFF;hLFFO FHFQF'GFEKhk-mBoJFSFAF FYF(@6Kh39KhU 6Kh 55K5Jhh+l4I h)k+F*F1Kh+E)FFF 20FFKm-O(lH#"!2b(Zz KqV+JEE@%%H%%%D &`%% &%%%T%E*)+А)&hb"!HLEK{ iH00MFVFLFF??ЌB{ #B{p-i-l ; +TKh+ KqV 2F(X+H!*E% FBJ[YF`R#` Kv##FEv FYFS(PO Ku##F}Eu ڱE+K `"*K` 5E0H0E5 K# 7+!+! JFWCH7'FFR#` Kv8FAFEvکEO7F7x5FFO30 &%%%8F F H*F#F(#Bt(F!F8Ti0 &8F F H*F#F(2Bt(F!F8S]hB4FF0 &FF#;`&Kh %K#??"LEt ۵??0ЖBu,F FHp F FHy(е??#BAڀj(/#;` Kh++Kj+Op(% &% &pFF +xKm,K"eK`p%i F F0J,F! #2F)F3F`a#( Fp@02Km#a &%Km8  &-OFKFF Fk[k(?`OEFv+F FCF&B3ѥK??䀸??ЀEx,(LKhC HxFFF??JIFBF5( #8FF6FO7 E|E|򿀌Buۀ}KhCBOpuӀeFFF??ЏBA9FBueډFFjOh&F&A&oF&F c# #JF F)F# CF( #?? Bs򢀲BAF#??ГEzڻzXFQFh#XFFQF??F Fe8KcZcO BsVzFFOs??Bu8'KhCBOru1eF KhC HxBuOpFڜBueFtFeFO F\F]FtFeF2O F\F]F,FF;O F\F]F5FFFFc#;h &t%Xc(?\#F??FF?qE0!T??o^F F(FO1!FU 0"KbKh+ѽ@ &%8!KFhbF M#"F(( Kh+ѫj  8O0< &%L#iKh#`Hvh@ &d% &-OFF  x+LGG8Lh{@ՒH!8FяHO9HF M+h+ЉKh l+h+ѣj#bW#bk(6и@O??F Ff#CF FnMF ##(<(lLmN#h2hC 1#b#h+3h+cKh+ ѸaKh>0F{+ F ѸYKh8@FkVKhF9`#FF F4??06B7O4%FE`@??FF(Ѻ?W8Kh+7Kh 8H!C&FF F??Ѹ&4F5F0FF F FO;#O2)FO3LFx#h+Kh+? { ?? ZF#h+ Kh+?B@E &(j(%(%%%H%( IzJhC`Kh@ͻA3D &% IbJhC`Kh@q3D &% 6 ID J!FhC`-Kh@3D &%FбI &KI h+!I ! I@ F !F ! !F !F3%q3A33-K-Ah,SСO`'! D}}(F)F )F !I  tK"`bNM/h3hCE+hB +hJ3s[`C K"` Kh#A D &q3%@%%% %-CFKFFhHFT)FFFHFp3+] +@F9F! H &-A!F FFF0F,!D|1F`i#wa F(F!Dh)Fai8 M,hB K""`8#hS``0yi0v F0s@H &-OFYMMhWIF0].RLPF#` F2FOa8FnFx0F~h++hHF#`#c` M;x!+BF9FPF(0 + +XFFx+F )!pqx+!FyFHFFkh`C``hh`3`ZZxx^*3FaEм ,$*O3!!pF\2])!pCx0a+[+\+TѐL[40 p!F3)K*J,Ihh[)ѣ.ɲ)GFcpFDF]cE 04FKJIhhFE0; F;n0 # p!F\BpF pB#0 pnpF&&oJ FpFhF F+""p0 JIHh h&d4 F"F)Fp@ *26@, && -GF>K I  %I CF FxJFAF0Fp1a(V1K1Fh0Kh/I"F+F z\,ZxU38Zpx[,[$[%x[,[,ؤ./ * [-<[+%F], Zp3--[-,B=La]&IX &\)Zи]B@QRxz R2hQL@ FH@8"+QD, hO 89#FO2 0 089+@8I#xg+|9+q0+M+' +$JKIhh2 hx9)/)q&)> 8, d `O\)O: `,,2 `48H8 \ px0ҲH@hBjKhJjIhhB ,,8)P8 xp8)Q8\!p )YKXJ[Ihhm;+I+#0'p+"w+Mi+1h8)x+?o310\i28)DKBJGIhhWO #089389Hn 8 "8 Fbh"+,/K-J3Ihh-89@;891h48I8)x S38)x T"4pBKJ"Ihh 310X28) )Q8x+ FKh [Or@ a F0?8IMxkjiSaԹ#xF]&&&p&xjiSa1h;+?Z1 R;+ F&miMhQhaOp #haF@30 \+чKJIhh 8"HF)F[0KJIhh X8"AFJ2hx0#320[ # FF.Fh ! yNjKkJmIhhZ # FF.AЅB`KaJdIhhFcKh+1#T3 c hxѹ1hF;+?Z1 R;+}+?JKJJPIhh*h3`*` "!F%,"!(F.n0+F#cU5 c ( x* !.XF"U! y(h, !.JF x ( )h xT JD *hBD*`!TOH  +!Q JF @ )hBFPD(0@ x ]&&0x -G^$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hi(FUF.X && (&'&'&'&&D8F F#`KTh``8F "B`FJQh`CKS`KphNmh (F(h1FF(Ch;C`+ ںjC !F F phZ`x F`&T-AFSLFF"j*8*\%(Fcj.3`bZh*"hFIcjb h CIyh%#c%bh!?J@H,>M(>Ig\cj%c%hcej9F@F\Fj3b+ј #*ј n*a.j @3`cjjhcbPjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?jpj3b.#p"ceBp`&TrTB&GLmchh Ch;C`+ڹCСm hZ`x@ `&-OFL Fm#hhkchI yKJeX3eK"c#f#cfLMmCh;C`+ڹJBСmImj CF@"k IyhZ`xmHE p` (;йp0۱~Hl}I kJꀱzI k,XyHp4rHX *#p0p4m@@EйbmH!k(F#egHp##fbn#hڹ[h#`#h+hch c+D(!k ZK F ZIZKy6#cfchxObOHTahMHObo"k NIy!kOb(@!kOb `8(yFDF `zBJSFOa(Fo(Fm@Eй8I(Fe(?BB m Ch%fb(I ke( !kH#aK\#f瘱nD< + E ;F`n0F*Fj 3b @ `&M |cvT#&&rT&qztV2cT8 F-( I"F y| F @F. I"F yh8F F-(I+F"F yX8F N F0h.)F# FjNF;F)FF0` FjD0h'&])M)O&khB&Kh@>$Kh^h+5Zh.I"FF y #*hsCX+6h!;h@hbI@hF(OR#F!hFF F;h!hFH 3 ]'&&&UTsFMF(h#I y`+i" h libF2H( h^IF y p '&F-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1Di*DF+D'&, FBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OԲ#L0H!3#cKh-c#d. h¹h+@ހak!k@h(@k~.k~-hh*3h+@k~rhB++~=;>+R#c X X X X X XZ X X [#[ X X X X X] X] X X X X X X X X X X X X X X X X5ZAa}ZZ X XZ[3[ X X?[ Xa] X]C^m^^5a X XGaaa XAa"`+v_+ bk"!kph=8 +ph0PBPAk~xhh)UQh BO`"`"dD+ Ah k~B?<%hi~h*Zh0B0`*[h+#d h+ bk2F!k@hk~(?+@h0xBxA(lbhB! hYCZd# `fh #"h!sC(i6Px``f`'&(&X&&#! 1h˹K(ihVKkhC ѐM!bk k+hk)h Z-xl+I(k+ek5&kj !0F#cA0Fbcc#yH%#xIvH"## tH#qIrH"#kK(ihd#kgOȑck:hiKB<#03 eHzPxCt0s# _I  (ѽ*0+0"!&C06B9hRH9h$ 9h ;h[KKhh+h-qFI"FF x -)FP "!x XO +8K6hB9h2H9h$ 9h &CDF-FF-&Kh2FB9h&HZKBF!VDh+>F-BF8HLK9hhBHVF:6HIK\8h&x&(&>\$(&8 ght@c&U0 9JOhB9h&H |K+{IhSEDx DvKkhC rN!bk k3hbk1h mH!  #c4hIfH#"dH!(&k+![N!bk k3h4k+?1h k+ x !28FF8kcc#c !bk8F0 k# .?ccc>KkhC 9M!bk k+hk)h UlbhB! hYCZd `fh "#h!rCki'khjiRhB i %K $IhxRck9FHF#F(#aFkibk3к#i !@Ѐ#i!kHhz#ki8Fj#ihZ9D#c&x&(&>\&'&O KihVhBB ЮH#9Fhki8FjZ"i2BBPDO hF`ڝN H 00<Ϩ H<jaki[hcO!rk0k;hk9h oih(Z!}Jh C`BpyH9D#"#iO J1CDhF"9FHF#F(fR9FdHYBB2A!#Dh #"9FHF}( !k+;i3Or@ at8a0kihKI x:ki iskBki"DIi(?~h+?f#`mi@k+]ki3 (iOr@ aBha0*i hickB.I"hi(?>"m"*I#*H)N 0 <Ϯ 0<6Ɯk+ 4?J&kh*&f3xp(p71B*#"1F!'&'&&rT>\T$(&(& 3x0; 2DBҺ #"1Hp#"H"! R BE10F,7BF!HRj(1O1S 0Dx0 h0<ǜΨ H<h x0h0vK Ihm<(&&c'&Kh#"I#Hh`~{) RihX&T$(&pF FO6Bp#~w+{+s+ciiBP(cih I xcia$h`iC@"ifa!h`irT-CFFFF ,qFBI x#`@Kh`O>I8F \`X.U(FC-]Zh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F x|C`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HF8F(#;0B+  HF a/T(&AH8F!Khı`h )F|(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$hT(&!'"0FMFI*F xiF 0 I xObiF F F( M0rTe K : * B² *IV QppG  I0;0+ B0Z "ppG1 2  2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@\)&KphkiAK4( t fx.($x hp|p~pqY}p, F F ɲv!ҲZu"&'\)&Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p\)&&'-A4L#hZi5#2JhҹkC#h.J![ikL,N%,O3hB-%Kh#"hRi( "J!L#"hRi, J!Lx#"hRi40~HA <#h[im)FNh J!LV#h! J5[iLN9F@F(+&')&e)& u8FH`3I $ I0"FHJHOqM, F8 !(F#p+x3,IHL  ~\(&sX%Hb( pF"Hx?+Cx۱0MFN! FN0 Fp/!D Fuv(ЀhFS+ !F0F F!F(Fh#`! w>IFHN B KD |<0BєB4KFIH6Kh[i1cxB [x;IH@OK,IH,؄@I@F H,I H"F I@H\)&ׅ/ &'6(BK^h4IFH  7F Ff"` F#xx(FIF+FF+ E60h@7z"F]K0h@+F"!0h@"!0hIl0hFh0h<|003x(ʁq(Ɓ>(2d(0<(EI *  u(PE аڰo|`D(/;K[h;OE`jO F@SB+x+0K[h;D=Df0+?  [R#s"ri7x(c?a80Bi[??z(`(x(8 (8orD(?ɮS UC ' , ' )&( +?ɮR#C   ψ U         1ڰ?(?ͮ?<(->( ("C0hBo `p3D7D pB8FBֿ1ؿ OаBc@00ozwF.?@W&وUy(F8FiXh *i3D]`3@F>@FC6@F?20h)&KiS 0YpG)&(KhBiS pG pG)&-OFFF*$PB*=F $ FD!Hm PPO U$()Ky.FFh.=320[ Ը 7I d.F>.=320[bd-nT ѹRFIF8F`8FzFBnb"D;"##[#C RF9F#;U:8F O*̹KERFIFF)& *b,  FMh౨`@F0F@DC4+hB F)Fdhh*F"##8F)&F M(hAKiO3+`" FFBFO0p#"#tN#FaF (` F,hc I F 0b t)&.pF M+hZЀ N2jB 00iB,hD Fplht)&Lh6"##)&Khz)&KhH)&wFUk F1F*F p@pGSK!F*F @pG R]pGF F@FHrTu@FHٿrT-C 0FFFX F8F ZIF*A"F!c+FeLT-OFFF@@F@-F'&* )FF(F&FxCB 5'D3DB%F''+x+DB,''?dtd  O !T(VѸ*FO.ؿAFܿvv[Eȿ3FBF(;+Fi@IBF%F5F*9F# F6!FPFBPF>~ FC|(F>v F>r0C FBJF !KFhB8F F8?F F?"F F6 FE sB`F F8F0F8b F`?F0F?]6 ')&L   T𵅰F F FS{9F*"F!c+F LT-C 0FFFX F8F IF*"F!c+FLTSK!F*F @pGI远T8Mh@Fh@" D8)& 7hFLH* PjF!+IFF+Hx F)u h9FhF #H(`.0F1FFF FZF( УD9FXF =*L9F F ID FJF!F&T@F  T^~a QQ80Q# -O#M`F F~F(?0FTF 5 "AF(F(h #`9FhFc IFhFc)FhFchFT( Fp(1BKPF`)00F Mh ``h)(``hF  K*(F`K*Q|^FKhKKh@¸ L&&HB(H - Op(@@ c|^-A -PM$O3+` F(> !F+h+5B'iF +ڀY!#]" uF(@Ѐ hF(@ɀ   Z!F^ 0!F y(,`6nMEp!F(h0(!F a(h!0(!F VbKh+  ! J hB+h"$!(5E>*hX TI2 S(j+h)A;(a(\ (?uU!)F(LBp"6B(&B5/F.FB>$&OpB>ӷBS(F)S)"BE$4U"B2Yk)"BE$4p3U"B2U& 0(F)UE6V h0G(kՃnczRnhR1 [h 4W (&d&<&rT( FObF |IOb  Ob `pI `Ob  (  ` I#F"F DDDD!FN a SXVy`V FObhF2IObhFObiF $Ob I  ` `iF %  ]XVy0P$ C FK ` F  GF& Fɲ(;L#h$*!P*hѓ)ѹ@a0*]h0CG0#h$h0G#h$ (>(9"H+(4!H&Fx XKMhE6"F!F(hG0(h5,(hE*iF #_"Z! np! cH HG HD#0眄&d&wVV ' 'P$C "K ` _ Fz F Fɲ((#Kh*!$=FiF 8S#`"!F F I#0眄&d&-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " F B $B5@5H`\(x+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?{3P,hC) UhPziS)L, 7hFL8%hhFIF  hB h##` 0IH `xI(FhFIF(F h&h)O J IF[ KH&Q2cVVVVpi KFh "FIF(Fp@ KF H&Uu&7hF#L%hhF\ IF(F h hD##` 0IH,F `XhFBIF(F hKh[vh)JIF[ jh) IF H u&Q0dVVD&VV sF5M F(h5!(h@z(h<:D" i!F >?B _>T?X X!F >?21F!H4,?H H>>a 4`D(h?!"bC(hAF0IH h!4F$h(h7F F7>(h>lF F>" FFGT FDR Fp 'rT  !W-OF- F F1 "1.0Ā1&O ŗO:FMI+h뱤I*FF*h*ѠIPFDI*Ft+h+I*FjKhKh6CFp(@ *F!H`1!(F;` Ϭ)OCs)&)Fvx18h8zI8h=`tM(h@uI(h#+`rI h<@qIh8`h 4 lH q& ;x 7 2"hFdH RK"`D^KO0`}ZK!F h{p!hXHWKPO`OOR;` 76C   C C T \Fė#YFOpF (v03.['z $[" B "8FIF|)H7$d,$K h3SBF"FhK `h t L&HptbtlWf@u&H&foW~a~Ww&WMW[WW&bW4h+VH<@L(h)RIF F$#"(FB*OrB*(DKh>BK$`<d (`# 0GIF)'FA0+;[SLF ̬̬D0+.LF1 Fd0+m FI # "!F>D0+?. p0,* OrB ` FWWu&&0#"2%K!" S#1 #IO3e I H Kh H )F5 F 0@aL Wu& -OrFF(S+!h (HO0#0iOpG9I(xF6Kh(5J(5I0I(mF(O OW 8F(`F(= F;Ѵ:{Bػ(F(W#0(F9F(+F(6 Fe?F# FUѴn> Kh J( I,0F&nBO6n<Tu&WX-OF'RK !F>.@ZI"F sH'-6)F !0F$F0Fp5 FOAF(FI2FID3F@FHI0FpB x%+@+*!:0+x'+5<*++/!PFF(@րPFF F@F(C XF(@ȀT'0EPF(XFrI(F67.5x-D'P;}I (F(0#(0*0P#*0oŀrM.hd"0FFZ(hDV  !FKFFgHdC?@ -(F\N?VF(F?Z3hBF !F =3h/𾀝BѸPH=> =>?D@@ƀ3hB@EH= =Dr?HCh;C`+򴀴;,3hB(F= @0h40h\\X (0;(0(F?!8F_B?HD?f3hBѸ?LG> =>Oh3`ID C;p%F(4U H F(.8FWШ(%/ OpG0ð@Fx0c.!<F0H"lC0"[HbH"!F)&*&-GFhVO`FB# F#p_-и/-у k20#)F@F[#1) F+FJF4dX, F!FFF"CFА"!(F I"(F/a*F1F FF F@,F F+&pM(FF @)FF 0˱) )D<.+(A`I@HrI@plHp)&[,&*&𵱰/I "@0h"F*H*I "@0h"F%H!"FDCF*PI"FC   I FF F酹MN1"OFHp1F1)F"0F=F"!F0F!i-&%i.&+&8i(/6.&-O6]DFX6 +WтJ© ( KhH~IH Bx'` F3x+PF4DVE1,«hi(F(0F(/|сOrkH©`;F0o«# *shcIP v(b@(\#X6# IF0F1F|F(Fv#IFp0FSKh0DZi sOp")F04,ѧF F (F ( \23 R 6ROs82(F#"S,(/0F(,,r! FO3! F'F(>-M rF B:%Os"FS1F#u S5O3U,FFOz t O3+`& )F`+hX4 0F( 6]Kh `rX3C\~Xu&X XXX, +&&)&Xl pOq"O 8FXI"8F`F(𭀐I"8FV(4ьKMF!A`@!Jp#A0hKOpJI[hn ("A`"F0vyHA1s+ ћ1l+tJ2h320YypH©{()v v"!4PfIC   aCs0@؀]LA]M"`ZI~ #"F)F FIF FбTIQH먱RIOH뀱QILHXOIJH0NIGH(@#:48KY% n(? 0F'BI - U3H©{F(@9Id$(?5OrF(3J#x Fm1J#w Fg!FH(\8# \8-@Ɓ@%J#y FM,!J#z FDI&F(>/%fOpXlX Y+&Y, |^i6.&tX-Z6Z\2N\)&*&-&5/&ҡHOA(? J# F\6+?J# FIH^F(?IF bI F^I FZI FVI FRyJI FM[7vJ F~IE~I FA}I F= F8zI 6yJzI (̮uKAvJOqAsHOA%\X\ $%FnI F:4+fJ#FjI (hJA;F (AAAA'@!:(VK XJ\IF(@R\8VJ C\8("QH'NH !#pKJ ("HH'{EH !#pAKx+\8C\8>J (":H'\0s7J ("1H'J.H !x#p0+\8C\8(H!0 %h\8C\8%$^,FE$YX0&W1&0dZ>YfYjYgYYYYYYY+&YYZY>ZYZZZS/&H[&[*&R\)&,MJ#} F\8ԛJ#| FKIx* F,YЛ:ĔJH< FsF F9żFF FW9  Fp  SF{IwzHF43( wI"wHvJ#{ F?+rI"8(pI":gJgHF< FFW  F7SF\I  *SOO;x+=XIXHfFpWKh, !FZ RIbQI(F`fMJNIF0FT0#KJ0FKIL;x#5J0FHIEHI A 0F:3+<,@Los@I ;2'4IF &Kh0B\310[#F9JOq@F"Y(hkh0(`8sk` FWF'+~DjD3l*F:\ )FsO #O"F@"020FFKh*@"`oO6>!F0F(x>Fq10F,1L#$p + K(hh?(@ڀ(? 朄& ' d&rT+?+h$!hR+hM!JCF48F,K"B`E BAªOsM$#&F B6Kh+?hªOs$Kh/EK"!Fh#T }1(`0U (h""0"!FvHL/h 1Q$,"01(,48 1R8R#$)h1(1)\L $R ,10pF (LO,148 R $)? h\?EA !?O P O O  X!HFk+h@F$1hJ[CS!k.KhP*h,I2Q H $1hh+h$1hFXhKF ! L PO : YF O30)0+sOp=(?.$h0G$G眄&z&&d&&Tu&a(( K@pGsXBXApG pGB-O L  O30##h*!*@𼁓)Q-@ЙJOa3 `BI `"V`@e(𤁐I b 8!H.#hJOa3B JHBFHK!\ B!F8F p"F}K h@hP8hCE'p"Yh#Xahgk Ct/rj*o:h8F3OcxBkG(Y;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+Fx+𸀳t+#m@̀*ȀAI c F%/nB(tcn#5J!l3I)I1Mcn#0J!^mC!-JV_*#nC!)JL_ m+$J%I+ F$IlYI M Jm;"n*SCJ!(IMIIMId&bܷb|^hb |bbbbbbbEbqbb_ cc~b&cb|&(Ij'M(IE(Id'M'I>m&J'K'M)FFV%I1!/&%#mAF##e-9#m5-?24 FB"F(FF(?%#F)B" ''8cbDcLcbXcOb7bb-OM+h*aNHerIHCF,IF0FN7hG"+hI3F8Fp 1hH!F  FI(h)q/x0)F y|^dHF^`I FzHF`OH4>FER8F%,xM+x!(FUvI F]uI FYtI FU+x#nJ FqIN#pH#F~4(@FjJBshJiI F5hHgHgH+xeHeHdI  F zYFr(F^8F%@g!FCF8F%.NI*F FF}Op  [ 0jhC j+km+k +m7hBa+hk x"#h#2OcxBFkG(CF# +~ km +X +\Q#sxld&c2cbcu&cccFdn&e0eJeceeTeeeeeeY^d>]c+{O 8KFLIPF()mHIFlGH@FJGM2FH0FCH 0F?HFBF F:H0F5F FF 2I1F0I$a%Kذ(F!IPFHO KF5k `Ob K FIKkh[ +RBIcC FIHO ipKFrO hKFl#j NJp|^>lcfcctc{cccdbc|dTdddzcܷDc|-OF|M,@g,&̂UFU+AF~64,ѪJIp6v!60F$F0O4 F MԂLH. Hh`H"K(lcc H,eTDO  ZIZF,IZF$KIZF;~Ka``~Ia~K ;84vKDKA#2##Fh h$5kh+Gkz+6 $+8F ] A0,!$ X`(32h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $'R$jh0G4#B $&EHIFCz۹P4 @4`j[P3pB3BhF0G4Bؽ@$$&F$F'F%FshB F9F 3hjFS5IhhlG(FG50 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c ;@ fhKXBXApGbJF PT!ڂpG`9&0 `pG hh8F M0i(DX~0 10`a18`9&POFt peh/-!1-~ a0-`A %i41.nUuF`02140.55FeFC# `K0`# aKa`9&]0w}F F:OrFD ЉdETAD !LLAPAi#F IF(FAĿ0)2BdFK*"" F:L!:M&h9 1') D aD!DB @  #<1L P D T PaFH0FLLFHFFB8NFD8FHFH%A=L"F F FL7Kh|#F6J!x | ("|!1Hq/I < o#H"+K !(FU)K #2 #"1#)F (Fo!  }O)Fb~0FO32(Fo! x:J!JH"F X  J$i`9&&[:i9xai$hFH0iMxzX8F1F\ȱ0FF@8F#J!xj| V1H|!"q2Os K( i, F7 F? `9&\X[x!F@< iF O3]iF O3]hFh#hXh"## 8FLch/+ !h)(F z84|JK( FF&y&-O/IFЀ\8,O-NȠO =Fİ(FB"FQF HFv(82h[F I %O (KO F FKI"FS%@XF(ѝ0Py+[D0a#0030 xiTu&{i &w&iP&-OF-FF$L$$!F0FF)"F({$!0F@=FF,;3x+h1F(F\0FDEE_6K@ 5J6HB   "] V+сE Z  ; $!zF "XF ] F V*KEҤ1F(F"F,D FZ#P)F\<(F%$!XFJF,p8F ii-AFFF!FF#fFAF|8F)F"F;FG(F# FA#޹-pC F-$!&oHO ꘱D " F]  V+хB p$! FFHS+]pGMFHS+]pGm@m#@o F F'7/puFIFFOp}I}H}I}L F\~& +;+=(x8 [@n rInHoqI+) O3+DkO;x+jN3x+#x+gI `\H `_xcI b#F(Fr c`I2F;F^Kh1!\LOpZSB'wSA2F7O3dTH#( k+ CJ9F0F7۹JHQ~쨹GJGK)FFIF FF(F\@ =J8Kh2F!@k O3!3H' (+3N3x+?X1O;x+?S#x+?O"I `\ `_(K bI(F%I c2F;F x(1F*FI oI b i `ZF(F\j+jGjj&Rjzj&$&jvfjT0&x TT^jB&u&jj qM iFH!hFB IjF  M]jM iFH!hF* IjF  M]jsx%8% u+ #X H $# N` z@0F)<IT  p [kK|+H"|+K`HK`HK`HK`HK`H K``9&/k&7k&Ak&(&~S&^S& F!F gK@hD&p#-P!}  V"3 ! hZHعpCOVH"xRI"SHRISH" }pOr! LM.!"F@A"@AaC"(ۄB?K@'!>J?H>I")i <8K"p O3p(?(@ )(I,H\ |(*Kh+!n M%H@%N"$2`B\`t#!Cl 1@33O3NCF tm F$ F t!Qz&q&x&<&D&Lkin& &D&-OFdðFF0qF0IHh.h0FkF0FA#FDJ!`R!Fs0F۹,;Jh3` *F!!F F"N0F"K$(hGF( FC+JSh3S`XF4kh+%I #ICF F0Fj0F"Jh3`I !F}I 0;Kh#I FjhKD !B !/Ji3aw&^&]kkrTk&k`9&&7FCh F+ + HJ#)F F#40JI2+ Fk|^k-Oװ@FHFKhHLPJ%N)FD  Sh/+S!`M#Ģ nh/.V8F`h+@ր!i"hB@р  yL/@ـ1iI WHH 蹌HA0ﰹ 0BBІHH&8I 6IHhP3D 1+1%2+h+J  1+Dchh c9F(FI( 7=c``1kK!h:6>)h#a ODaI"h`K f ** PK3D !B !ci3ca5U*$`iAFBF.FOi61+O 0B@.0BOp 0B@0B@0BG 0BH 0BI 0BJ 0BOp0B@x0BOpj0B+hhhZjBE-030iSJ/1kkSh_JB_JB^JB@]Kh1ZKGh#0aj X`&0BhGIBGIBFIB HIB GK GIiCb/O/MS' 5 c e () @&0 5I)OpOpp)Kh)Kh#,0 'Ii-KhKh#0hIBѫjpi @   I#F:F0F,IB#ѫlpim@ L& # = @&& B Tno o  hIB ѫlpim@cIB ѫlm0 _Ii^IBѫln0[IB-ѫl[nsOpi`@|TI2F#F(FRJ!@l!JIF0 i,`(F!Y *K0 AIi,Pll>Ii,Hll;Ii,@ll_8Ii,8ll5Ii,0ll2Ii,(ll/Ii, llZ,Ii,ll)IiC,&JBѫl30hP!+FS+hhdBFiiG+h "hhjSFJB` + o+ e" og$o,o3oP!"U FJ". *kJ !g(H$Ah"3k@PGHe@& L&aoo T-OF- FKh < $PF<(ցPFMlhg !8F ZF(ǁ/F:ݔKFO`2 B A#KwE$݉KtEAF 0*h2p"pbD  2@Db \b $F@ 3Q$=O3:F#"(h"#"h0G?F/(h"QF"hlGO8 6dFė#$" % G ;B2G # F9F&g  SS D@ D8S(D D()hS D< D D2@O@F "W X-OFӰFFF?ӲGӲ_G":" :_ :O<:): `!" &O EJ$$#2F'(#@F DDGc#)F@0F FSF "F "*! 7[F6OK 8FK!D|$D<8F #F aORO3@~#-A F aklO@Zkeh9FBu9FOOzsCCBu#XCBuOS FAOqMOCOC@Ci-AF FñhhmG+hihF@ *OD hB*?н*khp!h `+h1`i h wF (D1FOs  E0#s K`ca3c# FA 61D: c;I1 -Oϰ FF"!(Pph/! WET0+ + ##3WEO3 Rj -FHKh O#F@ =P `eFžžŞ @T0+ + 4žŞ pWEO# 0*F|HYj#B%FWE80HFlG(?@F 9`32 05HF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "JF$ X @żŜO % #SS C!F=T :!FU 2!F.L-A<SkI3F:F8F^0F[(FX@FU_K%h5 + s+FXK h#YJ!-&+x+"RI*F#O1& "F#B)F(Bkx+@)x`)@ B#h0a9 FlG(062!F"###h F0GWk;CF"F3 DCv@F1FfEv jBAFVF2CCEFA8  JIY a6J!_[F( IY#F &opyp@&p gptp xcI aKh#VF F]I16XKG0h#BF F&SIQKVh#4F F8FMI&7IK!hObFHd=IFB"F!쀻 F7L7H2F)F h4I3F*Ff h(Or0Na)H;FhI+I*FF[ E!F F }QFBB (F)FFFHFF(0=+BBJ!D|V F LV h(IH6I h'K`Op!J( F(?~[4|2J9FF 5F-J +F (@7@9(Ѿ#K$Lh9"F h< h* h9#Or2JF&!JF"!o2F59FF Fq&&s5tt{&|&&&sVt ' 'Q P u&-AF1HFU0I.NF(94h<@FG+IF F`%H?F&H(4 K#J H.l0h8*FID0h"I(FF(F6@ /F HHVI*F F$ F\JF dt2cu&tuuu'tu;uku!!npG pG-O%,F FB ``.=-;1 DBt  C Ey Ew # C Ey t7BBt h.6`g Gg@@51Kh"0pG&-OFF Ey #MF FTFF*#gs#"#.w2F;F F)FFCsG2E;F F2F)F8eBu4F=F2IO Bu EHF 0FObsE5BA   E  K<K<3BE.FwsG2E;F F2F)FeBu4F=F\М *X *TS OC BBFBzAیBu2Bu 8Bs TJ.wsG2E;F F2F)FeBu=F4FBul4E eEBr   a0%##"#U#( (F)F 0rpGFBh IY F@fup FF/!(F{FH(F2FFй5Djx`*ٴa:BaBp034O0"H0WZ * F("HF 0FM+h'(`r#BA#-hhB##" F  gh B 4#+a\)3B 0 Ę&#`FFFBܔK#`ppB,+$@} ` !tb!PBBt %`E%1h;` 532u8OrPF!0 #P`08-A$N'MV;! F, F)`F"*/`FFѽq&Kh Hq&r&-CFF FE0F*$+F"Fpp'B2B43Eܸ@a4 ؼkh J   Fih JkhJJuBg0g5gF0K@QJH@h F@uv8FMh WB# 2Bز8 J#3"+ K"h KhB (4Bx2Fq&&&-CFFF0'(0'I F@ DM7hQ7I+:+ #;0a+I(F[#0#0#00 ++ ї(F0#KCI0(F7;B̿IIvvvvvvw, 8 w2c,w;w_wvwwYwwwwc>\8FM+h'(`# IBs IBsڣh@"Ob#r#8"Ę&@8-OOfq-FF$M PTtF%Oc)Ft (CF F $M_I0R( F0FO1QEFu RF F\Fy!`  X4%F'F+O+  e``` Fo0CE&0FP?IP (sд *)#XPBB+[37B܏0;h+` #0h3`5  +,1+01#1#0F# Fx"HF 0HFBFs C( 2Brڄ[b2 F:edAw-OFVF Ofq F({OX"t 3+ #O0!FF 3+#O0!FPFcf#fSCfK#`VcaV`` F IH"bV#0 F9sh3`#0wFmFFF+Kg!JHzmKh!JnKi!JCnKj!JnKk! J}CJh`haOȿO vvvvvvh-OF Fh"F Ki i S ###XOpO9 7Y GYEw"- -r#UC0mG(F9Fg W g]bR B FFA2 WKErFFFF@ GKErڳ b 0&X0O FCE ;JhBcӺOpOX  h ٸI>*) O1[ jpj D"kx[@ pD(0h3`2Br[b2HF*ѱZF B#1#FĘ&-OF&KFF<h Ox T&h-AFmFGhF/C<4! F(M F!OBЌE./@q`!YFJ`"ZM3OrM`J`1"a"ROrb"Z03JC,Դ#K@y1JH$1F"BOra"Z J 3C,F4`Ys&-r k Dxxxw Oy sFN F(F|cap8s& hph FjG!0FI# FB%K "!F#2 #2F #AF)F#A00F\ FiO0 p3Px 7k -O F- h)F 4 @F( =hh1 !(h&P-z`C ,9 1 3 5 7 : &+h(FlG:+FFv$ !}`(PЇOCEl )FKh+ŀ3 O0  !O3:PF\F(ZI 3FSE-O @Or!D 0#2OpQJ2A"#!RF#!FV,747 F:+@F3P+hQF(FlG8F  :SE؊O4O S8Ih0PFlG+h (F0FG(D (F)h"# b 2"0Gh# (F #"+h0GhC(CF+h (FlG" !#F3I2FKF FZF1Ff /#9mm -C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hY hk*Fho3FGpFk0hKĕ#####0hH phlG(pFk0hK-lFĕ#0h0hho#G$bBBOq1 phjFlG(𵑰%F F.F hB-5џ#hh.#hFXh)*F!FOp FF(F#h1F FlG h* 5* ڛA####6-#h*?0#iF FGp#hh#hFXh*F!F@#h09F FG%𵋰%F F0FF8F K"O1g#S 3BFHck(F x-CD" FF! ! #@EF(}TLFŔ 4@Ŕ@F0lGHKPhTxO3FFC     h[kF FG7Kh Th#Bs *F#F#"0 G(J # 1F###@""K"K6#2O3"#AF0FT # F<0FI0[ h0G0 !8Fh;3O0##d&&uk ;j  Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"Z&'#h"O1h3#hk0s#hhlG0Fa G-GF FD"! #!00h[j HFF(?:IP"40P7HYj"F#B55Mĕ 0E0QF@FlG @"(K1F&K6#2#JF#AF 0Fk `32 FM0FZp0s hB h@ G /q(8F O0h[ [t xuk ;j -OF-FhF0G#h FlGWKhTx/xO7FFF@!hkVF[ Fx F2"0 G(FwP C C ## ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO d&K-OFh#(1+@ +h3K@AJH*i.فJh\(FOJ#@OxO FqJ>F"(O2)CF@I#$h 8+hd @ O Xh 0hFph&J#! @FaO@B#!HFaȡ 1F@  2s 3rH!0$1hh0$1hXhPO #C +h " $ & ( * 0+I"YH@`!Y`OpaUHYaUHh(Y22RI bOpb#Oq3133o O3 GF CKb0F0F_+++@&7F,(FG(##z05K" O4 F-+h9F(FlGp2C !#h;+67hB~Opc 8Kh)HP(FF Op+h0+!(FG\B\Ad&xxx&8s&mm n 08 k k Ș&%k уk u&xT+?!(FUhO#hh0Kh@!Cb@!$ 0F4+OE&O$!(F((?(zaR hR4 Ch(FQ$4 YhB0F~d 24Bz$$"d&-OհFO2@k+FK !h FF@! FF@@FRO PFU! F (@8FAK hS" + 0BY+Nі(1+fO Pe,AR#d `E"qXO ".JKCS!B FaF@oJFIO FH"G W @,=*5H@~J` C 0+0G( 3 qK hB-"O%FO6O 0wG O ,MFO6a6F@mZ(1D!O !SIHF ! FaOpd>!FXFFPF 0F #D 3D F^YFFTXFO ! QFFTrPF 1F  Td0FD F B*K@Q*J*H F#"AF23*F33#O3AFBR R#FEѹ F 8F@F s?0FLF[ Ș&̘&Ty-k y+xx-CMF FtH!/# 0ToIOb F4 sxpx[lgJOaF F!'/! Fy@B"8BFx8/* F"Zp(ڷ&h(F:Ob1F Foӷ?#&F0FFpC O(?ѷ>#`*@20F(*0/+ *OaBFF F>*Ob FO0F(*Ob1FoOa Fkx(#x/+0 fx&v  FF*3;DDoFIOb F"o*Ob Fo}(F( ڷh(F`/(F F M[vf|^@)!R F(  O F!R "iF@ ( Fp .l?@ B-OFFFt"F(?иO&(Fu0(Fs8FC+ I" FLF(#FRFYF0H7s3FIHFYO7yz"yvf-GJmH9"F@怜H(jH(e(@߀H#ObF((xF($I( i(@\(LF(чI(ObF `~I( bIF I(ObF `h{I( bvIF qI(tIF F(@qI(nIF(FF(@kHObF `8bI(_I bF(FF(@THObF ` SI(m!F `VIF(bPIF(FF(oPHObTTF `GI(FFX; `JFOa cd `0 b;FQF a5 -$!Op0F Jm(($0I(ObF ` `FX(I(I b$F(F-#HObF(I( `DH I(F F$J cI (?1y:yEyay2yyUyyyy$nyyy@ylyuypKyyvf `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#J!(FK,h6 7 t!P"FFH F 0& g@&Pt&-O@F# 2 C bh[0C#kHգk31 %k[0 o S @Kh#LKJFJ!D# +@2O3 Khy %[8hkh0G8# %Op O3c{hBپh fk3 ! 0BO1c50@F lG 0#BE1cmѹ ! [BxIiI FKF#!qJ# S #! hI IFm KF# # eK P "O10 ##<+ "PFUXKFFx+ >@@%+@e(qң%CBCA #;08hhlGFF2YC^Cf3I2.D FKFBFPF1FVf#kD##c;0۱P [ chBAO Op E@΀#kC#cUEFNFPШBqFF#k [ chP!cC# mBfF 8FKPf`LO3 F2h)z#;瘄&T z@&8, DK ;PFhAKh,!<1FFPF(R#*s ##R @+>1I@Fr(8F E,IOp94Op E يk2S Jh0BE b C J`2J k4D#;0.B-v 00&(h 3  k"c$&d&k|^-CFFjShBgp&h~C#0!k(q ےYdhjJAh0hJ!.hR\h[mM,?_JdD &!4h4Dj+HOpWJ(!F P$h2DkY񓀓kZ=# # JI%(F)# AJ &!7K@F!Fh#9J#k 5J(!"~j$mOp+JCF  Уn@\hy&J#F`kh[o+h3Dh3Dm\Op^J(!CF F~Op$P!FkkJИG(+#q@#o瘄&Uzzzozazz) Feh#p&FFB9(E+O+ F, P!%J#F 2"Hq* !Hg- JF!hJF. KJ!H)hkԉk1#2 ++ P"F v, p>\ @&a@zt&Bh!-A2Fjj5 ;NO FB=9HO@P"Z5"a3JaOrb2Jb1"c1Jc#hg2g hhCE$#OpE0 Fgj(ۡji 'j /k2p50L"BlhjFAFlGHFGkX IhgFF3 @ɔ ! -OF4FFFO p' E6ѹlp'q0(a0IF:F30 F6i1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  fK-Oh FF8F$(th! XF;F(ZI #[E$5F@O H0tOsO5"AFOpGKA#2ZF## y@FKEiqhj1 ]F(`qhOp b  h0L(Psh` DAF.rh!F  $PZFIF FH > # #cc5Ff8Ff3hcc0F[ 0sh3s`,O03PY8FR8FN d& -CF FOp 0"O1+OkD/ Op#3z0 /+ "/#0eh'B?ij F(ahp'hq(bhP`!bsa:FE O5F"hFBcc"b "" Sch F3c`(Fh 0.쀹@{H!Fl(F{7&P-OFF#FFC &`   2Br ڵ iiI BB{ [b B p!```0KhOIO(rq'#Op B qj(Hm3oO3##K'!hO3E򐀳j+@,O WFh3hRE&l0FGp#E٢hZDk3tM1|(u0A 1mI#+:*@'3+#h Y˱E@p XC;k2:XYh2:PAY`!2A!-y'W 0ByE@PB<[a L#ZG Pp#SCFhC(DPP`p#hO3BDjVccPQmA3hmkGhhCDb!hhjCDBZm**kB cj+HhX hAPQCQ`hah , *B;F7#* IFȱIFH S)r T R"T "X *&d&& |^k7jhBh 9FlG(h+++# 9Fj#F_'l QF0FGh+ 2Br  [ BB{ #FQF0F7  e#E-yV2f#F"803W 0 3BU @G 0 2VfEW 0 E@p!ACxyX@hYB FOfE@.:E7!(q1p#hKD S 0 _C8h8FAFhBzF}HjC p Z`chB8;B7APQ#GFPC2 DBBq򡀫Brڧh W G BfF X 0yhzD A Ez 8k8RL Ez 1bhBhB@p a +FBDH0Q`q )s!#HS`;kH #;ckCc##ByG 0 G PEp pBBлk3 2S9kfF0p7F F_PB4 a D#p"H TC"FDDFhCDH``H -O%-FLhF(Fp& #B#-u(Dp!uF(npFO p70E"ӤDPԧK$\CBTХK@]QJH03nJk՛k35Sh0pBp" FZnc#k)գk3&ѧpO p4 p" FBn.lhS8IhhlG0##W<[hEp4  p7`0! @wKh;Oj&hlG BBO3 H$F0BpBG5p'e[e+X u T B2E # F)FeJ 2+r JBrv[H0br` %Op 0By (`+ sO3 3.@ O 0E1 'Opp#sCk?0F6 XkJ[:FL(XFhlG0DkX2jFF-z ;B2]J #(FQFj -H ,F607?H0m۶z/ {& pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504L3h0FlG FFA#0BJp"0k3t+kqjhY+rj 1h b0F2"0G(R##ihY#BqF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c#WG3J2GSFBF(F9F g 043t2[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   bhX b2"0G(9,FĖ##)F"h0GFHH*FhlG#d D ;B2D #0F!F  d ' hRB   o" dhDXB2"0G(  05bhX+r h     b2"0G(9##ahX#BqF F#0jhkGacmam*bmjb"nbbnbha+?^j+?Z#mC"e"~*?RC#eMo h    [B3 fhDXC#"0G(xk3r#knщXbh)rh  +dhhBO5l)F.G5.BB0BB0ih'kjGacmam3bmsb#nbcnbpah0+u"1FGBF2F)FhlG0cccm[j+#mC"e"~C#e706B~#p O4BP$Op 0BP p$p2 [b2VF#CElp!0F=Fp#F O1F BkO Op Ej' GE$p'0Be;P1FFG "3c0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4z300B@XQhCВk263cp3C(  kCKkB k  +hB Pp"  vk3h.9FlG0 72d0##3hb.##5ce6e7p4XFEcXJhC Ћk3Pp"4JpF$M(h%(h4j+`h!0\bO6 Fb%KOqUKF#1 #c#FHP0j^Bbڠj(Fb p#!F000jj0 V ' Pt&-OFM-(h)1$a#.@X .@S(!3F1FF( 5(h#0Q##"#GF(+h$A+h"0FT#GF4F&FhB8)h@1<1@1V2HChR# V#V#(@5,O NO  ! ^zJ#!^!vJ#8F^#h*hhO& O% 2 #hFXh ! [FPFT+h #hh#hFXhZF! SF' MYH*#hh#hXh" ##P" # #0IKO #$"`GJ!GHY`"aEJhYa"b(CJYb ٠j0"c?JYc # 3Ow3Op73o O3CF 0Kb0F0Fq.?+k+hTjV##0h0G.@vW!h@#EE@0 FG:F3F !F:F3F F)a4hd&&Tp408   Ș&# +  у#h 1F FlGP$%#h+  6 L&.:.h!F #h F`lG"  FG( ####&#!'#FB=&BYO1F;#h F0GO0>1:F3F FGmh+?jfK@aeJfH# g!F#2F;F, 2F;FY !FyFp3l!#bFfFE@#EF(h "({э 7j+QFF6p4 lkC dhlG(p# ^CC "hk@KFG"3Dld!jp6,3j,,Tm,(vۏBvh?ThF By 3p2p$ \ChDl8Gh C"hk`#G"#DmBe|!@F0"0#0$ 0(?k #"3vTH{@ {|^v_W 7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-OFhF-FhFh im%IF#n+#J!i@? OpircnFn+J!i@A n+J!i@B #o+ J!xi@C OpiFcoF q{{{{{{gF@]FF+"FhF.3&4@LD)O`T# 40Vp8#*hsC"D lٱD3IDP *hIF BD(@Ё@"YF8F)h@"8FAD68.+h#Dj+ ݌J1FB@"+h#Dj+ ݅J!B@"+h#Dk+ ~J!B@"+hB #DwI3F(@FOaYOx+h#DCCDXBh)r@"!C<!XeJ+ n#y#@"B+hCl!#DCDX\J+ n#y#r@"B+hC8!CD#DXRK*[FQJ^@"B~+hC|!#DCDXJJ+ n#y#H@"Bh)h("D\RAJ!6B@"V)h \R9J!&B@"F+hx"3C`#DX+ 0J!B@"0Ox+h#DCdCDX+%J!@"B+hChCD#DX+ J!B@"+hx"3Cp#DX+5J!)ఖ&&{{{{{ ||Tp|ZVr!|-|4|;|{{̷B@"Ox+h#DCtCDX+:J!@"B+hCxCD#DX+ 2J!|B@"+hx"!#D3`S3##&Jf@"B+h"IB#D 3aD6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B }B|I|P|Z| -CǰF FNF@bOp#FJ!IKF"F(F#G "!!{ JCS!OH"]I"F|n|T||<#YC-GFSF}dkWX;+π#L1sOpI"Fi F}G𢹔|1@Op3hx-чIQ3h9F0FlGx1{S'0cxS@[F  F yJ!Ft###F0#"9F20F"2#G(OpphI"z"1FtdI"p""R"ik#h+? xXI&`@Fhd0i;jS"9F&D"QF>,7EbjHI0F|@ !r# ##FFi0F F}@ i2F  F#h+Тh/IJ&{ivOp 2F(F1 @ D###h+#lki@% IF F F}Gk!Jckh#lFal$hlG#H## |XT| |g|rT|FO#h+?t5J!b`Y̠D W<["9FOv놨"QFr87E`Q/L#1 Fx1GEѸ!0F!a!J!& @- iBF +#*sJ!"||!Fx"Ob##@##gRd!d@ FI|JrF!##`# 3O3#cRd!F@ FI|pF5Mʰ F+hX Or! "!)"0N(`0+J :@F(h!F" Jp4#"CO1#@3 )j(O tJ! x#"O1 F 3# }>( }:(`j,@5$#k0@6$##`O0gpAMO3 F FkjX Or! "!("0hb0 +^!BHNTZ.K"hj!FZ` p)K" +cbOq #i@$J! #"O1 F 3# }( }(`ci@$iOti@$#j @$##`O0u&g-OF$K%FhF (  +F J!XF#"O1@F+F90HF5##3F:F.(q YC0D1@&z&00Ű +&(06Cpdjv|1#"@E O1#?K1h#,!<@F O0 k[ c E0Kk[ Kc81#"@G #O1mXOu'J!#"O1(F3#}(} `m\@I% n`@J%Kn[ Kfnh@K%nlOu o[ȿ# gKo[ Kg d&g00 FŰ +K/7MUa #"SO1#@ S#{/+ ")F*PJ!(F(F<8 D{/+#s E01[ 11+AJtOph,!<O01[ 11+ 1[ 1 1+1+$1u@!$(J!N#"O1 F3#}(}(` 1+1+(1u@"$ 1+1+,1u@#$ 1+?~1+y01uO t# `n|d&g-OmNFF(FkIFP*O [ EF ` $?Qh{@ himB 4F*FTI8F" @ hi1mBFC '1cIJDhGJ!(FhOpidBr"FF@ hih1mBF+ _3F1[ 1s S2J!F(Fvh@ idB 1K13$1!'J(F`h@ idB 1K13(1!J(FNhOpidB 1K13,1!J(F:h@ idB 1K1301! J(F(h@ idBu&XT|& grTgT-O#-F Fװ!J03`OO >h>H1F_Khs̲̒03D[hkK/F6B8h(𰀐}1a3;hB@>`0F$P|h0G$}1 }aC #0x"3D2CQX)RCPQXBh)rI D!3JO;h+BѸ7  #0 Dy1S %1@,"U (1O81""0;h[0Op;`qOrAFl x 3+fO1"(у}!1F1B11Y,O-L>hO<<i.@3:F!Q2B?Khs0)F F3`v7N  ά3h)F F0g,Khӱ@##6,K 0TF#ά3h)F F0I#Khs0)F F3`7POq0B P3I`@B PK`Kh+3Wu&&|& vf&Ĩ&& Y &z&I xPi*O3 `+P`)1;#ca3<$q?hO #Fc$@hSE%lQFGջ ##$GF  +_+ݻ'"i3i$1) 6`#Ec09FXFlG(7 0Bؗ+i_+i+ `"/PcO02h-GxFtFF$O3`)hBOq N#"nhF\iXB32DBCFRF!`0\8a.<` 4B|&-CFDh,FiF&F'FPhjFTlGh#Bs ,FFX04,Elkj+ܫJIh+#+`(h FF;+<c3 c g &jK-O}h# }M$(h D(+h!J#Dh&IjFx)IH4KhI. I O `*h|I0F"DSi#VxI0FR,#)h !DP0+3ИX.F0 YDPPTJhOFoF#G*h'"DDZDmho#ImGZIF0F  0VI0F O ,#)h !DP0+6ИX0+2F0 QDPPTKhOO FoF#G*h'"DDRDmho#ImG3IF0F  0*h0F/I"DSjj#+I0F*I 0F 0+h%I#D hOQZ+h!I#DhF D+h I#DhI*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhED3h#Dl!2!MF((h(?mIh F0(h(?cI"F]кQFHF(h# 0O&u&|~f~&\&~~#>u&$1pF FF phBx1x1S%0FxAD%8 !x(PJ C $1I 0# K #3K K ]a ۱ &U % h J+ IO2 K JKj]&۱ U a % 00X>J`k;+إhݱ1{"J1@f (^#10K`0Kh0I*"k#:*  ,0=!F 0!F $J $I2h2"K#J#K "J "I2h2 K J K F{J I2h2KJKK JIcih#KKou&d&u&Y&ٴ  &  Ĩ& 5  <& e m %FL")FPK%`hCOI "FMKyh0:qXhhBkD";P! 3jDJT" Ft -H3B>Kh+6=I "Fx:Ny1h0;Jh hB41'D"$#h7'7P#o8G3h,J+DP! 3uqoѽ$Kh"#I`"K"zh0:A^hFhBa"#`mX`2,3BP!Jkj""0cBчO0&X\&m&}&z&j8&-AF$AF,)h'hF*FhF(u&-AF-PR$(*,.0F8O60F2($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlGP     FFVXK "hCD8"G(P"!hgc F 3"c0G(# F # ##"#h0GBF#h F'>FO8lG!|0!F$@$"(F$hB/WFFE.K@Q-J.H$#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB BBѶ?>F7hBs! 0~O2F(F/ J#|1`'O6T)-u&-C}FFFFJF`F(_IBF `(]I0FOEf((DWI*F0F80ѱPh+RHIFVO0 }kk8j`j`+k#akkca#@0#bB0cbklbH/p@I:F0F0i;I*F0F0/:IJF `9IJP#F"F6IC C C FEr1I@FE /I@FE-I@FE,I@FE"!8FPHF~0' 0B ZBOЪ# (5D*#*#0 "F l#( d@edAzd@z$5ASg-Am%OcFF)FFCF*FF@FF FM0:`12(F mFO`pG-OFFE ,# uT:E; C "FPF+FYF k E{RF[F"F+FkBs7\bEsbFFx!Oii@1l a!ZEs B +k#1kEA@ F a9Ex#71 H C,ubF8E9C "F@F+FIF i EyBFKF"F+F J EEIBADrEs 6Bs:EAZA,u8E9C "F@F+FIFi EyBFKF"F+FZEsi2Cj EzFFؐe0%##"#U#( (F)F 0k#pGB30pGD0+D0pG0%k#F 'B05#lB C##d@,hEjB %jjCXl"d 0 pG& L<'BX##`36hhMhJu&pF0K@aJHk=`h7 Fp@20[`hw%`(F 5FdrFBh I F@pFk%O5(FpD1F( 1F(@5CFVK@JHiF H! GF(K`8FP0+V #8#c3#dff# c`VD0`` Fr8 FkF# B@3hXjB jBCX@BD`" 8-OF1LFFcB[[0XѱVh+08Fp ] *єD0+bKtC4\'hF)@p]J1F(F OD"@0+ѨFO QI8F0 B`  EIF_F(BI 8F(8F "0C0?<ظи?# 0"IF@@"@+I@8F  EPF8LE Q (ؐO  0@\){b#f Ja2FF(Fr_ JU JS؀rʀyd, ]|d{dЀ{bh\jB% $jbCX@B@Bk#B 3h#h8  0+ #*s K@1 J H IBs IBs@ !O` r@8hkBF#Bq" F  8  K[hHpGu& 8FMkh khB(h<" 8u&Lch `hu&FMkh #xW&B$ !F<,F F6FFu&F F7I(FF8 "N 1I(FF0 "N+I(FF(!$F()!(ph ` I(FzI(Ft( ("<I(Fh D`"I(F^(O9FF(+x+N0h()FJ#lrhC#d6"(/0 #J(IMxI"@`LM!F MlPu p 0)FxF+# D<>\^-O]$DFOc@h! $#ۨI 00FO9)k#FDD0+<Ѫk*3МI zkh I X ] "0 hHh( C23?(CF 0#D0lkNlc ,k,k|O,@ (FKFkh1F #p FEF# 9B$31*F2@B hh*F)-*#p( l   <*FFhXjB jBCXF"hF1FhFiF@BD1*F F -AFh&F3F20h+CATk ukBuF6  EkkEkBLkt ڸ Op"  EkkEkBTkt +`` FFFFĕeF#0 0F ##"### H%Op(`O0hkB-Op # BsO#.F -K+` F00*F!FC0 B(;i h3`2[b 20C03k+УB " 0R-AFkFF#F\B +i!@3Aȹ2 BBC! F$Kh;` B0#0"!F04:F#AF0#(0C02[b!a F!)FA+BBL0&pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`2[B 20(FFh  " FF(-OFd]RF ЋK@JHrKh#KOqJ P I|F(@ɀKhx J (@H! F(|IMb 4vI MV(UFFF&`` oIX +CjI(K C  <0k@08Px+Ц,3F F  "!MFCF@W,6..Н`0#OI"" "!MF "!M (CI@ k=I8 C  v +?s5I "츱! ?F + sWHF d] kD0`"1FcPcE0 [[  :(EP#C0@ 03 0&@r&u&>\^\jL,5$ 0 !X0  0 0$050#D0Oc 0pFϹ=I(Fw`#\C F&F0F+(FHFe;hZk(F #x@F`2pb2;hk+@0I(F`(4FFCE0Ak(2kBBk*2kBB !F0Bc"44$|dKh Kh8 &&{ {S{{zzSzzӈhJz ]-CFhF F ڈ z Zz ۉ0sxs+sxl+O&F"iF8Flp#*F FCjF)F FD'F"iF@FPh#*F FB7/67.h-G 2 FFxPE #`,0.0〝00#r10cr20 00 7"I*F 6 5  3 1  . a ( ѝ0 00**+8ONF9Fl0#c˅  O0hpFpL&"F@!hF6hF4G. ph-OF8 zFF By&O P-X(ХMBMADqD BGлB?8DB> M EBF2FBtO  s0;PK JFF+ +*!ER@BN+J+4  B*Z BTٺђF"Oq F(IFO C++%Ѕ+23# DC#lD<2D2## Fp@"!O0U#1oU1 $MO F-ACFF82B #111111111+h1F8^aq4Bѫi+J`BF2+2224+h43B(2+ѐ!.-O,m FO !!FOc$pO4 F ,mkI 0s@"!r2 Or!Fc2K13]K@!\J]H: v"hZ1psppqsqq26*JU#&2*F ^O[#0FYF W *F8FkJ(zB,8FT6+P6+PFP&@;SCFFFE(FO )? pp1?A pPDF8FFE(FO )? 1pq?A q(FF0F*F8FJnFEBh Or0DR*F1F8FJTF0FOsE]EO4d@) уFR5K@ AJHt)F FFjCK@AJ Bq#d`4+F@ @0u у-AWN G$EO6FEt qi ` B xc p D6E 4Jh` /p&&-OFFFFFΙ Ė4KB"2 #qFA\aEz3()8B,S2*K;`'8FD3B"+*" vFF4]\ ,FEF03+) БB /Op8`Fb t 2FC F#IFiBs4F# CpCEU3&1A\I )ИE36.BF Bu1*+O8AO   ơ2 )iB8F F HEo/?W2KS&!{#F2ƑD1  NE~ Ѐ C EyĀ2*  и#\) * 3+ K@Ta J H1B| /?@$p&ׄ) у (B y93ZFq;F!D `F(?Ю2ĂH  @EHFD"06D&0B1E!Kp"!(F2EO32A"\. (2*K@laJt+DADAEOAڨ/?fOsa ) -O F4FFFĕ{iJѫB O0!SB9УJ$4 O4 K@JHD2B#O5FF s\-F2*%+$+,ѸOsK0()SD41 ! +oc^Esp C BAahh C B s ڸ?tOs8BT F2 Q!D#RCB вBA By#Oq F(_Ѹ?EPKh!  CBpՁ!FBQ-=v"CF1F]@BT(FYF8ZDPF@ tw#y{B?0*+"*@p4Bi @ |JU"!"!"+;#(FFCCF By8cC v 1F2CF]@B(FBp& у5&UB (FIFi By F2"D A1@B ue1vCF1F7]@B(F2B2E sOq 8FJU#1#1F22r-ٸ?,@n-ٸ?#Ose1"BqF"2 D(&KEv$+v,# 4ZFF F1Ff\Ev\F&F#9DF@ BOq ڿcCs 44"qCFl <@B F< *K p"!A #\a BrPFD3+PF 1qB?}Q0q#U  - ЎB?l03+1 y"i 1Bp '?TOs -AFFxFkN(H4 )F0F)(+,O0:FP!$P# FvCF+"KO2h#RZEs FF"FQFXF*FkCEE@30BFFF@13h0F`!"d!*Fp#FGP@gd&-GFKFFFO<hRL5E8AOr`FFo-?, Cb#@2?$%BFF;`3hP@@j #BEs җ&MFM+h[3 ќI  +hCK+`(ВI IKh+J )!vEJ;+{I@FIF\z A FYF( \4JA1 q(D! {:#sd+d#FHyKhtK*"-:Dh * qKqI (DqSmJ[ lJ$DkH#BFIFFB|+@#!q aJ0 X1Dhbh8t#as:@ \@KA0 (q8 b۵ \A0 Q0 c$ z/CSO"q,I 2 8Jd!q X)KD(qjJw; +{۵@Eq L%JO ~! % 3BR _+#d F4FFY@.A&&&&&)5 x&Up&*&Q-( ****.z 5J9F(F:D+ q0J.D/K "FhCv*N&a\A FYF\#KA0 ! p {jB?rOaa0FFJ9F(FOaa0Fxn FO4 1Ff0h2ù! F0ж 1 p 4"-"` Frh"F 808F1h2[Z`bh`eiUi F8@Ͼh"+h jhZ`jh`hh(F+h jhZ`jh`hh(F-AmF FFO#xK4=-Ѹ.&I&H *F! FX# I`!H3 mݬ 7#I`H,CFK *F",#h3`BF9F\0 Hh+Ьh#+8FgF, [+7+I+m@2FiFhCF H FHO0 m( FiFy = @#BpFF F1H1I@"2@*Gei0h@E T"hH,0Ѭh +Ь|h9+IH Fp2Z`jh`#+`#jk``ci%bsh"Khx0 IHe Գ Fp@վa Fu0g+Q e +: +pF$ FFF#FaB?aFB?`2bC``p+pFF FF&I'H- Fj#,AF3"! B1@! F0)"! FC"@! F0F!F(F"hK0I HpHH Fz g+: + F" F"sOsFF FB*F"K0IHOs)F2F FCF" K0IHp< +< 8FMO5~O3p1'0%J(F8F`O31 1 CF FFCF   F:0 Fp+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,52;2b.b(F,5p2;p2pb.lplb7F# FFFwF(:H1F! FD1ZN33@S,B@C,BS,B2C, FBS,BBC,)FBS,BC,S#N#0@0) FFIHq"(0Ь#`H!@)" K0IH@ g+%A +) FF$I$Hq"D(0ЬT#`Hb!@?1+ڬB7#||(#"1 KG0IH@1 g+%C +oOrF!M0H"H  +hF81!IL03 F F033S< գlKI FJ@+Fg+++p!FbI\#jF[FH"p1++033FS< F@ l(FCF!@|t13t1c+H!d"K!+B )7F F2I2H`#|DBC*He%!)F0@<(1D1B0|18\ "T_HfMQ-I n; f+X1 "K/0I H0@mZe "p g+8  %A +8!F HCFѽ8@ I Hܿ)F0H)F F8@+p FFFQ kH0I F3 Br K F-)FFM"#FFr##b03 "r 81@?!p@p,,+F<1FCS<1x1[hh#j11Q0C=CEUH PA\A ! Fhh#j Fdh-CFP8qj44T<D#SD<T2X#C#D2qCCD0+3D&0 HF(F5FIF(F/AFbTI>H(< ((>(D9H)F(S(5J6I6H@-03H2JO1I.H0M+x+#+p81:F3F F AF#+p#JF%IHn#JF#I'Hf!J"IH` F}D!\1)FH1xJI HJxv"!O0d(m+-------&---N---F F$I$HH",  AFH-! <1IH,,, O3,1( I# H<1H!Fg+,.F.l.jFa!b#j3 F F@?-CFFF*xFF0#`O4jC JHuII F2S`h F$`B FxJ`O2iFF;H!F{FO4#`8h(U8FiF0F xIFaFj# )H-cjkb> > ***V jF9F0Fg+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F"# F/2+`h`z`....-C "FAOqL0NIOH#%LH0Ob5OzqF(FF)F@F7Ѫh7+Ъh +:H)FW# FF01H  x1hݹ5h%0F x*x Fx. F%oh 50F)F(*FO1 F=F2`h x`tFPKF"!r`x1h`Zh``*Z`+j+"#(FSCF:F../=M yL ) FFIHf F0Ѫ>h7+ F@*4h +Ъ0hV+н@H:g+-AFFFFFF-+٪7#:I `9HABIѐ>p/R"BJє>p/%j-Tф>P**F1FA"B+є>pB8-**F1FR(#j+<#9F*p AFFH)F<#0FcAFFH5F#j+H ;F'FjS>0#j+ф>P.Ю5FF  a/~/1/-OhFFIF F8I"@F OI FH00A Fj!FBI FxF(𯀘I Fp(d0C0 S&6H0DB F F(ҀFO EG$1FHF LF0FNKFJ4`8FI4}J{KAAO6h81FCC81#x1h/[ "(@x1h/n81#C81$&S*  F"FFHFD < # ;k( N(4(6($U(IIp( x( n(O I IYAQO $FF;j FPFS+8  E۱E "F9F BDh;jhPFS+8  E۱E"F9F@F081#C81O0 F0ժd#` SXmзB T(FJF!FDx1? *P F////// </(FS*20  E+P5R F*F[# [c KDc`> F*> FD8p1pFFcHJF(p1tAt&p?J!?H th+8I9H (6Hw$p>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+""p#FF (C  "!,jDF IOr(F,0I Hl1+?|77Up7788Kh*hQ`X`pG&hpG-CF FFF0&K@G%J&H#KOq JK@#BѪ#`O0h`''`okg`<`lc4FbA8O80KO$qJHL#eT0A8O80K@!JH8#T0A8O8 pG pG0K@1JH dCd A8O8PFFC 'K@# 0%K@Y1%J%H'$DDkB 2FiF d0O0 kS$0;>+٪#`4Z R( CB(<$DDkB k"S$>04Z A8O8X! GFH 0 F $ F"F#4B ?"a"FB(?b"FB0?#bc#es,=%hE+h.hRHh ЈB0jhZ``(F 5FBjhcZ`jh`C6h;`b`b`l #UU0hXj k#V0p@pG2+Z`Bh` f"a2+Z`Bh` [b2+Z`Bh` PbcO1F F@ B-CFFmN'T0۹3h;3`Xh#l+alGcK@AcJcHjh+ my F}h+h*A2cZ`jh`0G#+`ckk``ecb.#oB#KFmFU0lVp+5lKE"IF[Th l"h2hh?QhkY`Qh `!i`Q` `"aF7ha`a0@ |HB ,U CF*FhlFLCF+5o2h+?i,h@B?\cmW0S0;YHB  5 BqX0G AqAa*-?)&A8O8F HFJIF ~Bc4 FF -AF#OmFF43OaCF2FAF iFXF F m4((@- ICFH2FF4BF1F(F $0 R]pGM FFFh3F*FOahhF8F IjFF FT` M R]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpG0K0 PpG0pmObiFCF ( lN#`O4 F mpMI4d0UKpG0K@  08F|M"OcH)F[4O %%*")F 4fV#`O08 0 F b F i F h F@ JF TO31CJO31 F@{pF FF!"hF "hF+hIjFCн0C$ B I#(hjF0O0 $p iiCjFГl3`022 C3pG pG-AF>PMV#O5`(F-٩7#">FF"CF"=2ѝ0>0F#C0<#: F H]> 1F FF(є> *1F8h F dhhpGh F Udh#DFB +"*+ ,F$p FFH#/x+F" F( "1F(F(:!(FF(\oB0# !# "c;`O0p3p")F!Kh.F;#Z1 R4#oB# "0Fj# c3px.+i+#oB0#! "R`cO3cc O3c:+}, -OٰF F#!Or& OC F8H'8FY#0 Fq20ѕH8F  0[x+g;F(_ 0DZ81#JB (F90 HQF\++,йIRF  $$# #(Fuizskd@(F(0#L0klckd,b(F#k`{h`d`5}`@x9R90 FF1$hd#`(F0$E ( F0i+dh𵇰hF F' h۱ah(FhSx+ai2 ich01!0F*F $hh(#` iB@hx1hpGCj@hF"!hF "hFr hI#jFpC$~i-AFF - i#\x!hDr#` FRzh* - -*FhF( "\052i%BD!DB,D#iBdhF-0O0 I" 0I" 0O0 |04 %#F3S 2AҲ %D"0 !CS!"bC!S^!a"2CS^!A""CS)""C,0-AFF FxF0H(FTAF}0fF H F 1h"(F1ZHH F #8F 3hFZ2`@#p-AF FF x+#3`#` /!F4Fh1F(FpbpH)FO0F! "@F# # " HAF$!F E(1F(Fp6(/#;p,0h V `99-OFFFFF<+x"+ 8<"+@ :5@/x'#;'#0UE~E$9F*x+F\*@Zx5x*/UEs1FE&7F$F+x\+Q,@5-)F F(F ѩO77#`8F,@E)F FF7F$3n (76666G666K]1FF,E6E#;E`", #DE$6FE+x\+jxx*{9F+F7FFm*0*Nb**,pѪEع7,иE##p #, #" 3Jhx 0 Ѝ xU0J 0+!UEӮ"8UE 6Eg+x\+;U  3" `F*FF20 ؓB F0+?l"! ,( F7F+g$(7Fm?', XFxF2 + +pG+FpGXxCx + +pG?FpG-OFhFFFF(FHO =!FP@IBF@H FO ]O F-IѪF F O@FzF( "(FZ(U@*@"Z`8F 3E `8F6F0F  8F E #0U 01FDU 0SD  U*p/=!8F4BF!F8F(O @FF(H#9pFh% i#jBi% fjUjB `j # 3p, `5, `5-OF1;FFF+_] ] ] ] ] ] ] ] ] ] ] ] ]  | ?] D] ] ] ] ] ] ] ]  ,[n>Gq] jF ] ] ]  ~ 6 G =    " K 7 A  ] /  ] ?  ! ? 4'-?(FF{ *F!([" 1Zz(N7 Z' @# 0FpFh$+h 4-P#k40C0 )-@40H~KhB !#*FFFG #1HTO0 (#*F!F0x#I8( #140C 0-0"p)F450C#0*Fp#!EяIH!(.*эH 4T<"##Dp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1}z::::F:;.;;@<;@;)F@FF(?_p HU)FptM40C0D-41# 2=I(F(4# 22I(F(4 # 2'I(F(ФI(F 4 H)F 40#0 40CS0m0*F #!FFѐH40 S#cC#040CS0ܻ40#0һ40#c0Ȼ40C30-<1?3vO:041F8FBFKFZF(ެ0BF1FKF8FZ8(Ь#P4S-̓<1?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ~-=!(FR4H03I "F(FF4O0p#0"0 :F(?0#sC0 I "(FF4p:F(?I"(FF4p:F/¬E;I;N;V;m;v;;;;I"(Ff퐱I"(F``I"(FZ0I"(FT([w4!]p")F8FFHO  :FF [0 #0 RFIFO0 #0F0qF(? 4  82F9F&(?^pJF)FVI"(F(Bw4!p")F? :F!0?a0F+F(?Z O( 4 82F9F(?pBF)Fq _I"(F(]I"(F/?? D"##" F8FE 4+?NH9FMI "(F4zF(G /PI Ϲ/!8FFpJF9F v(% "h# 1F#2FE {4HAFJF9F X(р#1+p.p+H9F"PI p)FR *FN(/!(FO3 4"1Y(?7 @#  'C`Y;;;;;;;< <<'<H< *F (c/!(FHO3 4" 1Yv(?K 7 @#  'C`-V40? X*FpX40CS040# C0Hf40C0ܸ40#0Ҹ40C 0ȸ40# 02_@@!00##C0# 2RORC `C vGsP0#S0#T0O3V0OS^04#0-ƀ<1?|2#4S470'(?jh+H)Fl-4$ 8(Fd$(O}H̸-81 33S<vH?" F(F  E\ [`40C30#*F!8( (Or(rcr]H)F40CC040#C040#040C0޿40#0Կ40C0ʿ42#B"Cc2#-~6HQFÿ40#C04{t#``-к$]4{t4{t4{tH-hH$ (4(FFH)F{?"p F (F E Fñ H)Fd]<y</<<?<<=/=pF0(FF#;:!(FDFб" +o@!HF FEL FHH=!(F$FI(F F 8FXFGF0H{FF&I(F F 8FFV>F-FHaI(F Fh8F-FF(O6&I(F xFp8FFFF}H6|I(F cFp8FFvFFuH!sI(F NPFOnH)FO  OiKBiH&v1@ dH/@bH)F{aI(F FF^I(F Fv[I(F FVXI(F FUI(F FfRI(F (PI(F FMI(F FJI(F FGI(F F DI(F F@AI(F F6x>I(F F&p;I(F F8I(F FFf^4I(F F1I(F FFN.I(F F&F+I(F F&>(I(F (MFf5O=@=Gh===GF=G=2G=@>>7>=G|GG=OGGGGG#G+GIGoGhGYGaGtGF<GI(F 2FVI(F *FH)F{!h31,"Y萻H8F ;8FF#pI(F F8(FVF(hFV+hB@kh+=  ,5EFO %h#j"`,"3 36 @FxAFFF0Fz0!ܪ >`(FFк`-?&H^4P7#P7Լ40CC0ȼ40#3040C#C 040##0-?(F@h2+~Ƭ^H)Fhh240C040##0-?(FF(#;FII(F8WIHEI(F CI(FDeGY.>U>I0F0=I0F(~IIC2SC$e40Cs0640#c0,42#BCs2# 40CS0-?X0# 0*F!,CH.4 40C040#0Gu$=/X>r>>>>>>>40C@0ǻ-? ?" F(F 4 E +>!H)F-??" F(F 4 E +>H)F-?ͫ?" F(F 4 E +>qH)Fy >>>-OLFF &FOY 0@6m.<1H [j+Ѻ HOLD'BFj(F8OLg:#?-OF FFF+G%K"`Q33S,S<yH<10FTJZFKEnBFO ""J)F8Fh"F (Fm22 p!A@ A2 FPFO /<)'/-AF F)4 1+W1+ax1+]"9F0F  ~ z$ v0g47+Y0 l8g<7+Y8 b@gD7+Y@ XHgL7+YH N( J(FA E C 1Y7(F :' 51Y7(F ,'"F8FfF(Km T"0F,6047;470F,6&<7;<70F,6D7;D70F,6L7;L7-O=FF I OF(HwO4O IU#BCcE##"-/#0O3`P7CP7fN#[BU88D Bx + +<\+77D<[OsB0 D",0BF0FO[5$ D 'F3X &E? hI zF  +./DbIPF(k (WйGIF$'  (++@AF0F#`UF8D Bx + +<\+O9,U#F#H*F!I!H*F% FH&H*FH*FbofHK*FH*FHs K*F H*FpC\WBBBBBB-BC(CF0K@[JHp p@CdWB80KOqJHu"F(FfDFHF(Ff"! F F(Hb F8CoWB0KOqJH!K@JAepCwWBKB8F0K@JHnhF!F(F8KBWBF0 K@ J HTCm@ xh@pgpCWBF Fq0K@3JH4pBK@5J"(FFeF"!F(FeF6cxBД90B(F!Fe FժooB$ F81 F(($DH!F#o-&)F 0`!F 0& h+b8H$,.8F)Fe<(FjmcmB885(ojmcmB!F(F'(koZco[88F(ѪooB!F N0!Ѧh+H(&h+ H!F ,0$FoCWBC{CCCCFرh"Fu(Fe|F"!F(FetcmBF(F!Fe Fw+٥#`4Y  Q@,CA@+٥h#`7Y  Q@,CA@<lHdh3FRCFO4 F0@pG)F z0F FFjOV?  *F9F FCDFF F&B<K!J +*ѣBx*K!JHH6 {Bq"W({z<FC{B"`)C+EDD-O {FAFF,@qpEVF(3h81Y@;I:F F^008FIĐ(I8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@ɀ3h81Zڀ FI3 Z<[LJJ 0𨀳l+JI+ FI F0rl FI0𐀖L F}I0rj FzI00FwIF F0uЖL03oOr!M0mI F0_Жt0+@3h8!PAȁcId:3hx1@^I F`0=ZFYFeF(@ӀF"!FXFz0*DI8F(@ހZ<@\@OAJ Fz IHdHKII(FF Fk0 DIF Fb0AHO4%2>I  FQ0;Kl*?(8I FD0!-?#@6 1+@Y F FWCF@R%H'J"'It F0^ 0+BhXESE+++"-bE.+E4Fk c-EEEEEEE(&EDELEjEpwEEXFF(?jBa"FdE T FxI 2t0?Q"YFtJ FrIh0EqI8F(|oI8F(vmI8F(pkI8F(jiI8F(?fI8F(`-?`K`J)FFF^I Fl0? \I:F Fd0?0F%(F>0h%(F?Z<QI FM0?-? 0+?0+? FEI2F0?Ю F@I3!A06O:F5O3J8I F0ѵ3hx1hG%*2I F 0ѧ8Fk%(Fh F*I2F0? F%I!0ъ-9F F50? 1ZY*ѦO%CF@F(?k F'U SE++bE+"-4FkEE'FP FF9F8F h(FCF F8@8FFF:*=ьlb"P$#lc $0۱Ziʱle1F(F0O4 ,(J (J ,( F( J1F(FO40$//$4bE++pFIE<;NB H ~#`O0p"1F F4 Fll Ff0D=F8 FhF1AT1F:F(FAF:Ha F8I"8Fz8!F@!0H #;F^BF(I)H7a$.3i y0F206I H$6h(" F^0 ѥh+IH# O#I"FH (OsB_ I"FF H$BFGF ~F\FsFFxxk$KF &F;F+Z[X#` &F *ѽB Њ Hch0F (@(ѤV#`O0(яBѤ"#|Qjx C   B)F+* FBDPHE٤7# F#O. 9D ;B@BE٤t#O [FFFD,B ",+F+##p-OFF FFF%CB*뱻,ؤ<7#`O0TKO X\YF\  x1Fp@Ly"F1hFl xiFlVF(Fpy.x1hP#>0B*2F!F(mh !FEi!F(F(Ѥ2`./#0 KO+qJ Hn!K@!J@ xH"HHFh FFԤ#`O0Fx+Ё)F1x+x:G0А"! FXh Fcg9FhZ c+cxcwh Kx+ыyoC@ghX+kgx`e h8h0FL9Fx+Ф#Ix`e(H-AFxFvuE5|2xEAFx29FD:xFlF.8x2F!D|2 +D|2%O0PF F !F"D   C"9F I @@= ,٤*7#`O4 F/ "F(Fi pG pG pG/J0FQhhz poFO00"%I" F3#OBOq#40IH#@"Oq#"0IH #""!0 H"! x(`0 IHI0"HHH8FQ(hCп(F#x18@8pF>`ư FBФO5#`(FFpOr!hF "hFOCNOS02F)FD`d#hjFIOsh<> *FDN#hIjFOsh&iiF`LT  <( "1 KOq J HhKh++L@B O0 I"HCjFАlCXBXApGM FhBF##gD#M00PF" FhFM    jF IB + ")F FoCXBXA 0 8i(0PFT ["!C C"!FI ~+0 :i-CF<]F1K@!JHKm#K@!~J}K@!yJOb!8 F#pHF1p31caso`#`-F=hB`hC`FHF xsmXihC`hC `hC`h/Cso`oDCc`2#j"cC#b#cchP .]5xB Xh1FB ORXC X`*Fsmi"0-W=E5.Dh /N /F 5ǜhY 1F(F:F/K?G7=Dh F 5Ϭh 1F(FXo2F솳>F65D*"!FV0O0 <]Cv%IFkp(F:F/?G7=D''&pC"H\CC-C$"#BFF!"F#!4D0F`F!D0(FO0/,F.DBxB ң<#`(FO0##DBӣh@/ "F@FF H/ "9FHFcB8F#D"p FIiPF"hFQ kM     h-Os000h "i 0 I@#jF0Fp-Ii@ih;|2F CC#0'C |2""!x2-C]6FObA  (н BУ#`O00+ѝ0++ˀ++w*<+6(F^0@瀣hhV8O0+)*+:96սxF(н 9> :0Н0+ ajѐ" " lI 0нX0bj FlBKx+++vKh #Zx* [h# #Zx* [h#P 4" C !FF     OsX0;hDI0yѣh+Уh1+0+)D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2033S<ԗheIpF F OqF0`X+ha K0#h+0#pOpp@B0 0cSc-OFŰFpFİFF3 ѭH O0E HOs: S<VOq CF(d0 `ñ*.h( B "JBћh ћh`#+p(0> kpS+ *p.#@R,h#k r q"?qgҀ(+TS,sh`jH $@D,IDB. .d9h0щhB @2C0$00#)@tF@5$p$DB..<0ӹ(1+@c#;`#-0;Op#F狱<0s,@B6#p#q<0 0.Ѩ+8##p#cp0KS BB 4.R.C.њ 5+M0+<Ш+@ 3##p#cp0+@rF7#;0" F2,3"RER:O 07,34'bE@t 5cFIIcScI 53B+#; %1 Fq2 5.D..GS<ը+@2##p#cp04D<}S(? S,  ҲќBМP  .ѡ:*DEp  ,3}2x,B&ТBFS( S,#Ҳ|BАPB .ѡ:*DE>  ,3V;0W0Ԩ+@'9##p#cp4 D$ 4˱Y 3B M#; $1 F 12Z 43D(1x3B=#;( F x2B(1x3D.@..􀮗W0Z:F!; 2F+(o! 0BbpQ##pa 2PF Cp#p#q .y..CW03 2081Ի~՗Z0Ѩ*@"FP!cpF3 2˱3Bs:<#;1 " F 12 2.DOs@~+UQ#p#p# q4< #<Se:h+KHhS03 " O00I H1%h" KAh40IH!  < J# } + FFF2CK@QBJCH>0 bihh1#` O *: b`)_С`3# *F3F8FO3`:#*F3F8F{##a;#*F3F8Fo#ca6#*F3F8FM#a!F@ h#hc```hc`i#!*F3F8F/0 h``#*F3F8F 02c,J#:J-CFPA}mOq E(O3`fP#!"i +`PKHFd#+e#F7V< hIFa(#(1V<Nԗ cV60F((n12Fq0bP#CI((EjF@# F,H:#hta_((=6p(1"Zp(1  #h(\0>`6pA(p*"(1Zp(> 0>! A}jF*@#\ FHHO0+gJ}J##p] `FFi0/Ha.KBBAtBF!Ѣh+&Hi '8F ] i H"F9(hBC!F(FJ H|(h81E[ 5# #F0P F0`HR"F<J J$J8#F$ Fpx+pF(2F)F#U-OFɰFTI@FRFF(d(hZFQFF(mО1FXF@EH0FIOWOr3F0FN6#RF[F(hv4# RF[F 5FU T0#0,0+A.@ѝ0-N=@#+JOq8F ,NE$ICF*FHFhE6F(HIO$EICF*FFHF F~;hNdEzICF*F`HFNEl`J$@JJJK-OF$M F$NFUb FO, ,62B&p%B&F, ѽ0F: V,XB3BѱFV ,Y,PF&FHF*5,6#T ,@FT,5F0F$KK*-OFFآ#`) FB1F v0 B O #DBҢ"#1F v0O0*O!FZF\DECFIFF0F&0T EQFF0F0"C-*F Mآ#` & FS (ћ(O hE9FF(F03)F+ v,"F@A0O0 M I(F0\#` v04U 31]aS0[#h( +D(8D 0-OF+`h@p_0՗o0IF0h#FK IF0hy#F(НK+Aآ#`T0@$P0RIF0h#F(GC "E=0FF(U;  89F(4$B77W<0h0  oH^WKKSEK LLL7LLWLLHS6MLM=,LLMM  M-AF@F` "hJ(h+F"!Ak66V<%w! *^!F #(hAi;(Fcik`jD F&Hg(F:F!(FD(h+F"!'5h'`iwciV,Haiw#bR(Fi#3(FcbV#"b#F#A=AF(Fcfh0_M-OFpPFF=(<5 0#՜J{mH#2F!FxBFhPMO O8xB3Zh*Kl[@+(@#OzrdO`zsD F(5 0yJzzH{zgjz {m#xB3Zh*mK{n+$*F F($<и?1cJP#h(^J \ " *" "*F  >0zNH ~ F 0p FEF(a2FQF0X#kr>K"6ka(h(FE#+phOpB@#+r"!h(FOaOsBF*FkmwF(F6'&H +h4+/1+#h81I FP h#F"!PFOpH PFh hKF!7+yMM@$MzDCDCMMNMJ!e Fp&P>`5 h#F"1Fxh0 $7S : h1FK?2 r D1FF Hu F@sHC1FJJ N3NyMP8 PFHph# F3d8@MNJ!&A 8FP+h;+h#F J! hjDJ FH # F+`=# Fd8@8M mNJ! p PF1FH!1Fk*kH hJ#!+`#F#c Fd0p@32!a"2NNA J! FP`6hW# 3F F(C0H #h81T,I Fd@`6 F2F9FH#h812  H@ι9F F!?2F9F 2F9F(a F0K@!JH  #hf+` (ah F F#$| F@NNN%O$:J !h0Ch0"*-CF` F hhiBrjBX0F(h3Y {ȀDJIFF&H^ hiaі@0 F)F" FKF!%#F"!I FdN2#C"#[ [C#h!(F h"!K%0O,q 0Fh812>#F!Phih" F# F+`# F 0iZЛO*` FQD FH F 0@EDO8F0P3 FFȹ HnI Fd8@ (aH F8@ 28NN8 PF HD Flh0 FCh0#d8@^OJ!i -CFph7X<@N233C23 ,FFѧHC)"K/0ѠIH<1 23ѝI" 0(F0їH C@ &q **j(#j+;7 cE85# 2F h;Fe0;#0 ?0"Fx;33FII e" ^"\" B2BC FHQ#Rh Bł30|H 'OX+h+wI3F"Fx (+tI3F"Fx#O L pB:F h1FU@dI3F"Fx HP3+ѹR60X6#2F h;F0VI3F"Fx3FTI"F x$1F h:FF@F LH*0F+h +#h81FI F^ hi: h!AK*m+m##+e'[<+<##F 0B"1F:F h06+7#3+[RԹ@3iO #I3F"F x:F h1FFH HF,V3i+h;3@3i;3@I3F"FxFaPxPQ7PPPPPJPPq QQl#2F h;F8(+h3+!J+h+х@3ikb0kd#c3FDI"F xu+iBh8FF`( **XFXH IF2CFRF)F FEdhR-OF FFFB DI DH+F Oe-! F*F-i'x@*dbz*a`B[.VBR T' $ RF½((B0DB?ӽ& O:h1F F"H2T'½0KhP #i"POS 0ʊ !PF(FFXFXC F H !DHF:$*RIRp)`]F FmIHh#`hBBiF F0AF3hCH  I(F ]phiF(F1`.m,$g+ -A"hhF AHuh- xhCp *FAF H0+1h;*FAm+1h;*FA$fR0!]PF FO PX`` C   a` X`` Ba`O0YaIH:0n "FC H !] 0 F$g+ FFh F!8F@|i]`iZhW(S FP,hx1h K JO32BлO32,#38 h*[h7FP50j000>1(R<,C#B<#+ +R"F00_("F00_F(Scj%00 F~F(#yn81ynX1)F Fh+iiJH 1Gki hܱhhB#hhhBaiPah{Y`bh F`5knB#h0kf0FpQ`FD$ZSS 8F@L dF H F8#0%-GFFFFF8?H$ F10 hHh;hhB!` F"9F(FF(M4 #F(;hEa`#a#a 0`0#a8h BFwJ F!PFkjKMFB+FRF9FHQ!F x0џ|h+ IHi Fi#i##`shc``t`%"C@$@S TF@0 aiA3OP3S,S<RSBBДh0;`n(h!l(F&0F(h!$"gn1F<رhjBijB  "H1F"(F'FH  k(1F(F#k,(h+п0"Xfh ?hcjBF8Fu#!h0ff(h#h+ѡl(Fh(hXT@T0 hpGiBa-OFFFVFJx0#`F(F#")F8FF"и(2hhB!*`Q`ch`+h;3!F ]F FO޻б3h+BѹC0#ai#a+h;3!F O:4 F(HOT*hGa`2h`"a` B``3h`(hB6F0h F J! |hBѸ#%"C0-GFh O Աi'h.hx! RF4CF0F3#3 h`0'(`0 #`O0p#`Kh#xF p40p#x:+bF;+^1`v\+x310[:+,F&, pF :(NxF_3B ,:*ДBBxC@*F -@,:* :,p(FK`pG@ pFFN/F *|(:(pBFB k+2:*|*FO0-O4M\4!++dєL&h.`X0F(Xdh`FP #`o8F 4M41F,D;cKh/dF'I="(Fn(YFxF32:*FO<\4 3 F(ڀ?À@F;_FO`)F(c#((FO7!+)#"# 'FFF,FE(ObQF|"+ZОh(F`k"Ong#  VF; +/Y<'o:++O \++ + +O ':+ѹLF;BY(Fad(F+?&X!FF'CDF#O2 O"p+x+#+?~X(F(v4 ;FT(а? 5F:#'=&@ >FxF3:*ћF  <:+:# 0  B*@F De)F@F9o / #`DDDFB 1F (F=JFYFPF DEFaK`B(F(FoF`qon## FO3=]Lh#` a``a&-GmaL#FF#i!ahsx&p#h+6Тh*3"`o' e&F;/*lhWF(@h(@ э`.p\#iEIh`(O0 mhWFйh(Ѓ@э#i`"a]h(FQF(F`(Dl*faxDE1@:(#(ai1<\+#ca,\*"ba:*#*pkpoF+"@FpO3:F}F+=h\*?o+gDla|*:*+&N, 8F F)F F8@'F="F(d (@𫀞x #`o F^+cx:++:pyь0Fd(n0F\+cx:+o+mУ0 4#˼B0 З0 ۲T+1A+٣B, \$  -   - - - - - - -  - - -  -  #b_ّ # # ##:# #Fd"FFd#/A:*в+O4p(F8` #`o F;p L(Fd(FFd#FO4pF#"Xx0+CxX+00$$8"0޲ .١a+ءWB 2 $A+ء7 *`pO0#L`h#`sF IH``8 &TB-CFCLFF#hk JybhOa>Hr0 ##`  !HF`hCh;C`+ڍ^ (0hZ`x +AFhFr(-&1F (AFhFrAF,hFr( "rX(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+&8&&NK[h;"FFe(HF( &8&F:K 8G& 8%L`h%`*e`8&F "F! 0K87F ,H&8&8+FO*` Ȅ ,`8 F !F" K87F ,H&8&-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-GF-FTOFF;h8cPDzhPFr`@ #;`  !PF^xhCh;C`+ڍ (0hZ`x +#FAF hF r\ `-&1F(AFhFrPAF``hFrL( "r(x+Ѡ`EAFhFr6( "r(x+`hFIr&a(IhFr(IhFr(IhFra(?|IhFr b(?t IhFr`b(?l:!(e lP& N#L`h#`r IH``8 P&TQ K[h L"OcFF0 80( P&&F KFFF[h["+FFFgH %`(  `P&FK 8DP& 8%L`h%`de`8P&-AF FFF #F*F! gK84F P @P&JOc0] &-AF FFFD #F)F" gK84F P @P&JOc0] &8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8FFhhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFDCA9FCD QӢB ӴOغ_=#cC ?XFiFFF&FFFF9FF D0F1FF <(F)FF 4 F~!F@F O30F FA Cc"TBFܱB)F0ў^@"h\KhKIGKz #F0D >\d&-AFNh3б3i( "3iwi@FB8GD8FB` TF0 i"FD$!FF(D&8? M$?i*j#DBiDa8 F( &𵇰FM$0+DLEKEH&hFFG&hAKCJCIDHG&CJCK%)FAIBJ/z( F@HAI&h/F?HG*>J?K))F=I=J(p( F;H\n0d͆ */iFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OKMD+lD(#XC00F(yEI0].h$4FO bkB"O(xO 2( DB(O(xO 2( D*lDB.8F@FIFH] 1F04(F4IF]k01F+k4F30~F4IF]201FDjkF#D4@ dF KhK IFG+z klh&4%D TND%p$NjulB(hpU$0LE$4&K[lhpG&-OMoLHP-@b !"#&@F#,#S0#b0ObAF(3 `aZHO3dC`UMGF\??6.. OH\Fh(#0'm&/A9*t ssssss&s,6ssss?GsTs_esksqssssssssssss"s(.ssss;AsNs[asgsm##r##&0##%0#lkh2B;k`kh+3#$0#h+;`lh:B3h+;`lh:B3#'0##(0y##)0s##*0m#0# 0KQFG]&sD ^4$0;H:M&h2BO`@hfe`cc@cl#cA9!dYe@e#jhi@ca"fY#bf!a2*B"f1fn@c`'0CH "#3 I&H\( Ig`H\ j`F`d  Mj1F.(`(#H0 %" D /T%&&KH0 pG&K h pG&-AF4LFoB70B3 z0BѪBpBp0B hBр`"1F(F'BF(`cia@F\RciD1F(F0ѝN@"iFh[KhKjFIG#z tciBF(ci`aHA&D >\d&-GF9OFF=il @#i@"#aO3D  0 0&0",nB 030Da`{nBO jHiDaVaciiB !F@F\i!F@Fca\iB#ia{h!F0\&0K,yi,@yi FG&0$BKlD0v44&KpiB l@.j&DBЛ@DhXipi@l\i&Jpil  @@@"iuBeO4 D0Da bTiDap2&-AF_O;iB lCh@% /DB{У@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Cakii3kaB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AF+8)F\+9hB=`BKi+8\8)FAP@*FZ! *F!Fl\FFl\%0#"iZ!h0@#`&4%-CF>MkiBki3DB*n1F F(Hh3/$ F"F \4F/"9FHFh\,9FFHF\n0p;`oB0B F"1FFGF "+i@FB<F`Bo ٣S@  ј%0+ЬB*8Z!7 )|0B0B!  O2H\BFF/H\`0" 8FSFCF&HIF\ FFh0B?o*Fp IFH\%0[B Ҫ0Z!,.c*0+ЬBbp! #`h)0+Kh^KIFG FF/D &T&F K'0CH "#3, F@6&/ܹpGpGpGHpGT HpGT K0h3pG, K0h3pG, K0h3ppG, K0h3pG, K0h3pG, K0h3pG, K0h3pG, K0h3`pG, K0h3 pG, K0h3@pG, K0h3pG, K0h3ppG, 9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG &𷺋hF;+`ڌiB (]Kι h\ `p]KpGipFN$V4(Fd Fp4 , &K +K[hG pG&F0 S pG0pG(h9!HBpGXK0h30o O0 pG, @FFR;BpGFpGF FK0h3pG( K0h3pG$ 7Fx M K*FhTI+F"FHX0L%F眕T (9 xH+ pG pGHpG JK3( FFpG$T0;+AA- 3,۲ ٚBГBO0 , 2ҲB+F0KhBKhS HpG  *KhBKhS HpGT0 @pGpG pG F H I FoHdh IFHI p@H/ VR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBМ#` I)qF`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: (, $&FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00X]h;iP!0xCC@! pGh`K3pG$&8FCi FB "iMF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:D#iQ-AFZSBF FSA'0ip0iF FG2BҔtu(F)4YB7x\*CZx|*@0iF FGhKiBѣh #`t0+u 1R"B0XB`x\(]Xx|(Z32#`x|*xBoiF FG3)YBxB[xBBx|(632#`*=*7ѝ0+3c Fi DOAA3OAi Fi FSRi"OA F3\Z*ѝ *ЙB! F+  FiRiOA F$&UiFFAi)DXi#ii+Da8F-AF FFFhiû/$ݷ.󮀰F#3D+(+++)Y.ݶ@)F F?FFOݸ &&F#FFa2+FROA FCF" FiOA FRBi)F FR"OA F6i" F9"OA FA(V+FrOA F8iiOA FRi)F FR"OA F i" F9"OA Fi2F FGhiF+'2OAR+F F6iOARFF)F F.?>FHFFi F!AF&N FF3h+#OsB-#@\ CTkK52hh*!Oq30B#@"\C#TKh30B#@b\CcTj"j1Ml 8F !@pjbZb P ( $ -AFs*hBPBxB Tx], N ,8x(`!(FA "F9F@F8@FBB0y6! #BFӃh #`K31BґBx[)Yx.)3 F#`2B ӣh #` K3"`xYBx.*Zx]*3#`$& HJh0')б` pG pGFpG, pFN$V4)F4 p , 3)KS<GFpG3F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6 ( $ -OFhBhOkB"I(FFPOA Fa#h3#`"|I(F|FO A#j@"hh1M ( ! FO##j@"h`i`!(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`C-*\Nt1Bx]* XB-*@ׁ[x]+ `)F F(2BXh+KK3U-*@ȁ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BHYBEx:*BZx]*?3#`2"`:F '|F(l FQF)F F70:+#OsBij"(j1MJ !kj(bZjb h #`fMY`$&,  3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fb#Bӣh #`f2B YBx=*Zx]*?xh+#x-*@ZB@Yx])"`-& FFWE0+5WEݣh #`f0+#OsB ںE׮:F7)F F?3#`Eɮik"(k1M !kk(c #p3kcQF8F(ݣh #`SK3O YF8F{( QFXFu()F F  эZ"`x]+h+:k>#jiBkxCkp;K Fh/8+9*j+Ckk+@kj+=k+:ѫj?4AF FY#jjg(k@>(j7D@"!(FB"jh;`#`W i\A B2F0#jO@Q FhO0[*Zx:*?@=*?Ϯ F1BF:F)F FB$& j FpFi(KI h1!I h10Be F#`]#0#0 c` se pIOQ F p@۹, ( $ -CFi `\ и[@HVB+xChBӃh #`K3"h@)S#`xBxE𶀸Dڸn"jOA Fl]d -*Fb2B YBx\*[x)+)"\! F -OA Fid*Fo6BtZBqx\*nZx)*kѝ%`BUٛx^3ܸ"ڸ"Vt<+_Т0O`Q F*FDVVt, F1*FOA F6#j"Zdq/Тh"o(Q!@{E ! FZ#jifh#` c`[KBV@ O Q>"OA F"O Ah #`KK3!! F ih"+ #`@Kh3* FVB$XBXA0*+"Ѣi;F F52OA%`i FOAi F;F2OAiOA FkB+x\+kx{+5 F%`1BF0x,*-Z"`B1J[xh320Z) FBFݢh "` J"*F9F F2BYBx\)Yx})3#`S+F$&^ ], Os!`#hB YBx\([x}+ ! F!6h #`K3ܸ*?K.?hG$&h^`Fxi?)πء$ڲ * +^) [)Ҁ\)Ҁh+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! FE .OA Fid2F2Bӣh+FБK3Z"`x)+!0Bx*.@?*@3#`1hK*53i+FOA F2RiOA FRi)F FR\"OA Fi" F9P"OA#`! FP"OQi#j!jBbZj2Zb"OQZ#jjBbj2b !ji Gh` C`UKgO Q F8ChBӃh #`IK3#hZ"`x<) >) РoX Fe"OA"O A!h:K)+*3@𩀢iOA+F F2RGiOAR "`${*ZB,H[xh^0@"`h$K*t3,+Уh #`KZ"`c`h*#` F2BFx,*@Z"`J[xh320Z@ FBFݢh "` J"2F)F F 2Btx})q3#`?$&^ ], 3#`)+*Тi+FOA F2RiOA FR}iOA+F2 FRiOAR Fm "` "`+*O 3`?X"**1BTx*(?*{*JZBFJ[xh320[= ! F7?*?{*?e3FOs3#`#hBx}) ! Fh #`K3, $&+-GFFFJ ЇhBCL ZF KB _ "FF'!W%0 F)FP" GDu .O" H)FI+FK%HuPO5" " R""tpOa!hF)#a+DaY#B #}K32BC"OahF"KaaaLX``( !hF]c`)@ch FFF !cPFP{xC@_->س_!سo𔀳_kB)Fc#k!cO1ZhFx2*F)FhF_rг _kB@)c#kF D)F#c)1% OسOسOтFOMгOOG9سOeFPF'xGhxCO5гO2гOk#jC#b-?!@`c(@!(FF(@🀠c`kD#cc+k#0O $pB OгOpkB0)Fc#k!c[)F#cxGok]O3#c`h"F08Oг@OTUUmJ w> M> M $&-F5x))D)e)D_F!c_hbcX+xG_+B%s"T}AFk+"ME##`#ld`s`Oe#3`#j[!hF:0FL [rC_Bjk@!0;X!(Fc8FWj#:@#3B<+FbFG"0Bj\E:3Ҡ Z\B B2W# B$ P#AE@#@#W#03ELLBӫBB8W" 8FH,k+?n3PxAOбO бo+?_#jC#bYB8F; F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6 ( $ 8FK Fh+#OsB \k AX@8k˱ K4(Fh3( K(Fh3x8 8@p ( $ -OF-FF FBԀ2hShS% xCO9س _س_ހ__𥀳`_𣁥L F@_𫀳O𞀳O ā!سOρOiS' B@ˁ?0O:س OM(O𑀳O OOÁOѲh)xIh0FO  SQBF!FsSFqF(ѳh+D8O@O3iB"xS10 _*2Fi++h  h  EKj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF7#k+E8F' RFYF(耸cl+? ' RFF(83HFF |D [\#0R B,?qEM[FSEF8x3 xBkB8F B (ѺE~0Fzcl+C 3 l0 +?L 3l"B\ blcC\ ZFعFYEh 2 F(\F w(и?y ¸Oq1Or2?f $@E( 6  =F(EJ2lX#3 ZFN+0( >F%& &&pGpG pG z| pGpG pGpG8#MF`+x %`8Oq(FU~( 0&7FM+xD 0(%`0&Fhx[@(/! Fz8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!H{HH;0&3 (  pG pGO-$MPpHWLr ` ) I)Ad@P0`0@P@PT0030#W00S 0?X[*:# 0 0 0  0XW0 ! 0$Ѝ  0X$:6S T00U$0%%>!EÂ!2c),"L@T8\?HP5#B0$!/#1W@pPp `L  0P@0y$Ѝ\(O@`d@P87 h6 @-PQM@(p,` U00 V Sp0`cЍpw`Sp 0E`U-00Ѝ r000 rp`00FG-M0p`@0W PV P%X P.Y PmZ PNx P4 P JWf  J JV+  J JX  Jt JY5Z! L xJ< sJЍXYZ-  bJ ]J  TJ OJЍ FJ AJZVX  PЍG4 4 4 4 4 X4 X4 4 04 3 3 3 3 P3 X3 G-PQ⼔M00R p000`0 Წ@P @0S nS a0CSsNU2  0oSm .XPN Ѝ%XPZ V000U000XP[Z V070U070PXPZ V000U000WPZV000U000WPZU000V000zWPZO V080U080i0@q@WPZ: WP WP WP`ZL V080U080?WPo WP WPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000l?WP T8WP 3 1 1 1 81 (1 0 |0 @0 00 / 0 / X/ / t. t. A-P`M_NP 0@H@>SJM+; D 6"` `0!P P3P0 p* 0p [p@ [p@  p@@@d[ [[[ P[P`Ѝ[00@pŸO-1MM @PD 0< "( p C.F D`(pY;@D8 (@0Sn pȱp đ`  ᰱ00$ %0!`t0p@ !0 0SP 0S Rx[001ݍЍq[0S 0K0S R PZp 0h8D<4! @P 0 00Z  0[ 0h,R gH1ݍЍpT- - , @, H, 4, 0@-M 0P Pp ~@p@ P) d Ѝ00 0 Ѝ0@Ѝ0A-@@0s- zPP0P 0p` `?`0`0ZppX`p Z``0`0Z 00mep@-@PCM2 /LP4 @@pPB ` @Z000t2 6 C>@F0F 00 P4D@@_Q0S VS00 SCލpx@@0SoZ@0P\0\ @0  P@1:Z?00@}Z00cT( \( p@-MQM@P4SY TE /:LPB QP0s* bUPQa P0`pH @ @0Rqp? H p8 ۍЍp-0si/%@@*00p +GZ@P0 @0 E P@1:Z?00 p 04Z0#S @Z@Y@,p@ Y00Hchkc,kb|} j(b& & @-rP`O-$p(W,P0-S`@/U'Y1 ? nSZ0 0hSP :[#J P?5#I x@t4 2px 2BzhPY@rUZ0[%J @-DM@ P- j jBp m>BR* p=Q p>m>BR JP P rp~P Q X SP  pp0S00S drdpE~lSP Q<cSP { $r$p*}YSP QqpMSP Q:Jp@0sSL qpp 0`0 ?d000P0?T00H0?L00/X0\ 00 0$ Rʀ@Q"2"2B S"2"2@0 2 0S,"00x2}$0S"@xr@00l@2/0 S  *($\0<Q0 0=R$ $ @%0c Lh0000N .: 6S ^00\$0/,>! 0E  0E $ $Â!2c 0R,,"΃0,!/#1    (  ͌ ( $ 00SP0 0T 'Mb0@P0^@2/0 S *P0 0<R$0c h0000 M ,:6S \00^$0/.>! 0E ! 0E 0%!E!2c 8P \?H/)L 1!̀/0,0S$00#0S >  0 $  .1A0H L h0E 0C00000S P0 0  V BQ 0_  C00 00S \0 0#+;  +; f= =M S= =O0vo O-Mp`,QK@00QW00 V) 0< PD   ?0P o 0PP@,v> 01?1000?0 0>  0?0:`8 : .K0[!2+0000 000P :0p0PX 0TPK dPI,`P}0Sz Rwʸ RtQq00C 0S!10# "0S ES}> 10!0Q0P IlJа@00   0Q 0Rv@ Qt0 H 00p0 B \P$% 0  0 /@R[S S  p@p X Z| 0Sx0Yt0 Rp0 Rwt  RR(8嫺 㪺J0>C0p0t0p@`PRx0S Ppt0 08@/ 0%)$B@C "!!b0C0!Ϡ [0U͠ @`<!0S 8<=! B^ >  0#uqp8 p@0pᔽhO#00N0S8@ p2p @p R'<0,"2#@T 0N0 Q  s!P NT00N0S ͠ @<!N00@pNT00NT00T P00Q Q P 0JP C2Q000P Ѝ0 00S   P oR`8 ꀚp vO-BMM@pLX 0 0EP:w>PP $ EPr00>I0P0 C `KP@@0 PPA8p 30P0  0PP38p p"@P$ \zРD 0 dQ`k`V` pP Ⱥ r| a0VGP @PP0 PpS MmQ |Pki-L 00BލЍP/U ` P p@L0SS  8PBލЍ 80H 00PP7p?  8K P00 08h!0 0 0KD 00 08P`K0   ׸P00!K 00 08PP{K 00 08PPoK\ 00 08PdP D vQ Q  s \ , $ P -M 0  87PЍ -M 0  "7PЍ >-M  0  7PЍ ?-M00 0 =PЍ$ --e( 0P    0/ 006x6p@-P 8U@pK,,0 ? P  5/p$6 p@-P7U@pJ,,0 ? P  5/p5d @-@@P 0003/p5L @-@P 0003/05 p@-PU?o@20S 0 003/p4 p@-P`)UV00P00@Sp$ 0P5/pl4x p@-PEU?o@20S 0 003/p4D p@-P`@PpJ((0  @p@/3 p@-P@P p 0 003/pp3 -@- M  hp@(0$003/ Ѝ@ Ѝ/3 @-hp@0003/2\ O-$M`Pؤ@ 0 0@0Sp$ЍJ0 (P@@4/$Ѝ,2 O-$M`Pؤ@ 0 0`0Sp$ЍI0 (P@@4/$Ѝ1p !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// ///////////////// ` | h D 4   | h T @ ,   8 D $0(- C^ 0C$Q :$0S 537$$05 0;A, 0 0#  $0 0@-@$ MP05A05#05!0%0%)P$00$0Ѝ0$0Q  S,0 5,37$050$0/S 5<37 $050 0$0/0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-0@DMPT؆p 000 \0   C N \0 \%3j?F$0. H,0 @S 5#37 ,05Q0,0m,0 S 57,05 50,0S R0#0C R00CT,@DЍ%3j8G$0P$p 0\T@d 0S1 `@@0 SS( S R 0C#@ Y0 00 P, Q0Ç0,  0, 0 PX@0S80S ,0 S 5>37,050,0 @Q , 0R0537, 5 05 , RS #0C 0S 0C 0S 0C`V  FV")VU*0FSQONMLKJIHGFEDCBA?><;:98765bV1 ?R/0S, 0 b32 B012 00@l 0 00Q,  P0Ç0,  0, 0Q @RfV ?R0@SQ  b@S9 B88  C# 0c1#00FV 0, Q05 705 5,5, 00 RQ05= 3 7 ,50,P}@f %:u0@$0@@@0TS`VP=0FfR?o20S00:FFRoQP Q P=V, Q05`705,5,Q,0 P,00,0Q  2@ Rj 0Sg [@@  0P[ @  ?RQ0@SN b9 B88Y00@F 00Y-M0 0 Ѝp@-MP`@0 0 4/ЍpG-PRM[  `Tp{PCa@/8P @1< 0p00p. Ѝ80S&  0< 0 p00pF0S0< 000@ pp|F0Sx tF0S X 0 @< dF00`F00x 9   ( (@- @MЍ$dO-EM MpX@`PFp+'3 LK0P@&T 0 @K@0PTx 0  Q`H 2 2VEލ Ѝ F00F000 @-`@M pPP% /J RP$  rR$   0@ P@  rR  Ph 0 @Ѝ0 Ѝ@0rS E 0  ( A-`@#᧲p 0P/S /JP @0p S 0 S , Dp@-IMM@`PP ճp 0: S X0 0wp IލЍpsEO00@IލЍpkE004 p@-IMM@`PP ᪳p 0: S X0 0Lp IލЍpHEO00@IލЍp@E004 -M 0  0PЍ 0P 8 Q  8 //p@-@P P`P  DPP u 8P  p@y'JPPp-404-0 M  0 ЍЍ/yP --M  Ѝ Ѝ// -- M)KP8 00  0 ЍЍ/y0-@- M@JP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ Ppp @P$ PX P@ @ 0 PX J3 ,Ѝ000:Q!0P00,Ѝxxp@-(MP` @C$ (Ѝp0 0 $wp@-@`PJpp p@<@- @  $M0 Ѝv0 0 yvp@-@`PYJpp p@k<@- @  $M0 Ѝ0vC-PP@,M@/ ` p`FV`R V `@0@ [T J,Ѝ00 0:200,Ѝup@-(MP` @# (Ѝp0 0 tp@-@`PIpp p@<@- @  $M0 Ѝht0 0 tp@-@`PIpp p@w<@- @  $M0 Ѝs P $ Q80 8@-M80@08 Ѝ880/LL0000 0<M 80880Ѝ/xs(LP/p@-@0@00S 000 X t PP " `00W?z,L00p@=P,CrT( O-PPMt3 0 0 @DD `Mp@ P P00U tpp0 0CY 1ATT00  RF LD@D T\:[ 2 0000~`K H V00 W7 1ATT 0`Fs 0Ry H 0 0 B0SH H0Ѝ V0  0  H 0 0pHX<0S3 0 Hw 0 B@ 0 B`F  BHtZ 0 B  BH 0 yz uH 0 l0S B 0c 0 ^b00q 0 00@np@-@PJHppp@,0@- @  @m0RS00 /0 0 mp@-@`PHpp p@<@- @  $M0 Ѝ@mO-P!M k 1D`00 S,0H?@@QZp L 10$+10[?Pup , PPDEQ|`0>p2 @[0S8 0? P PP@[u  ,0 0 L00GC1  00 0P,0@Ѝ l(0 00~k@-@P =P80@0800 000 jT-M0 Ѝ-M0 ЍO-PiMOȡ@̑ر Qp`P P?`K͌V PT?K͌U P?F͌(Z P>F͌(Y P>C͌ 1S PD>JB͌81S P=̌[ |P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@P@P@P@P@P@(@P@PP@(P@Ppx@PqP'( @Q78 x00C40S000C,0h0PD 00Hp(0LP@ (0a P[ ,0` 0` 0[ k V2 p @T   @T,0[ 00 p @daXh@0 0p@pRP' W 0 V `0 1S@ ,00 0 A1S D 0|0 0<piߍ00V,,P࠳0A Q X,@<00@ P$8 Z&  B  @R=     pW  PpoW0,PZ  p,匰$ [ !p0@ @pP X 0@0 @RP8<0\(04 0(0R"DHpLP@1H00PXPPL$P0P0 001P0,0P00T0JX0`P `<@@(p08`0P0J0DXKD0T0p`,  @  V f`p[0@0 PU0 PU0V,  @ Pܠ就ZP 0@PHP U ` [p0 @X @X0 0SX , \ @@ , XH0 p0尡_D0|H 0 ;p` p  0W  0Hp `  0V p 0G` P  0U `H P  0Z I P  0Y JЁJ P  0X Kq Pp  0W L^ P  0[ M,00@P0(p08`<@,  B U+@@0, P  , 0T0H 1ʙ D@  |:p+P0(p08`<@0@4  P ! , @PB BZ [ Tb0p㸀`, 0(P0 08@ < DX\V f!`pX3@ 0 P U  @PU 0V,  @ P封[P0 @PP U `0Xp8@(P0@<DX\Y2Z(j,0pPC`@ U*4 @,0@1  ,Y0 0H 1 DP  |2:p}pP`@@0 0 0R> $0SF 0P,00U 0e1$0PS7 0H @ @  Z  @ Z , @ $0Q1B/P`PZP/ Z   `P 0,0 SS,0 P 0`0C 00 `, U# 0 0 B 0!0`S:  0 P 0 0 @ T @T0,00 0 @0,!,0R0@0 @1P``P$P Z  P`$` 0SC 04 ,01 X 0h1 0S3 0 L0 P @ 0T0p00 @WT0 ,00 P @T 0Q1V@` @0P T  0`,0 S\,0 @00C00, Y# 0 0 B0!0@SG  0T 0 0 PU PU0,000 P0|,0Q0PPa-@ p @`pe0P: W  0 `@ 5 0 0R080000SO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 {0S  1s0S N S@-M@ @ 04@P$( ,Ѝ\P@-M@ @ 04@P$( ,cЍOT0P0/ D @  R #@ R 00?H/O00 00HOA-@P' PU0`S,p1H0 0D C  Q(  ^^0 00pNtP h H ?30 R - D#@ DR<0@ 0D//PN0O-PL4M  0pS4ЍPD0L |c0! 0 7|@Pa 0`D0ZP`@0PZ0 T~P V@|`@`6P! ?3 R #@ R< Dp H0L |" 00( 266`P0S R,@PR @P0 6 R0`S4ЍT `@000  0"`Pu @|`M00 00^\Kp@-@P 0PS =PNpp0 00J0P0% H -? \| 0DR0 0 0R S0@ 00\R  /J00 00J 0 0 /O-,M|R@x2P0`0Vx `":\\ XrX L"LŸ DD 8"吢 唒圂0 00$0 00000 00$0T0  C10l01 0m010p0npp 0@z0匲 0吲0唲0圲0$TX\`lmn  1Q0$0 0 0 0 o,Ѝ|00 0000h000`0\0X0X0T0P0L0H0D0 @000IT,0<D( C-pP✂M@ PP t2j+;0@@ #B*@ @0&`@2 0C @@A3PU C pP pK 0p R\ @B0 @@@%P9 0 @@@{%P. p*  p& p0 @h%P  #h000S :3S yЍP $VB2T@ TPЍh0S0?2pPb F|T A-Z`ppP UB2S@ T$000 R A谦 A 嫦,DTp[l1 0@-MP@,0 CS*0?@]@及C#00:0;k<{1f?jC_01o01o?JC>Q0+1;2 *C>C R 1 R 0S8Ѝ0Q |0 0 0VA0El Q Ѝ0 ><^v'###|<>*!fClL$0l 00 S/BlO-M⸴p4 k P @+(@T($ 0CS0ST3@P04!&!&!'!8' :0HfjnOArvςz֫׻؋ٛk{K[+; A0@ p <8%`($P4x,~@#!#!d""e"㏪I#-㏊H@#`"jDh# JN#*L @:@ R 0S(0800S \ЍQ $2 0 0{@2'lpJ @@ \  0(PU(00Ѝ>J<^v8#:0'# #H#p--`_|opryz{@|h}z+,-.`afghijklmnopqrstuvwxyz{|}A Ы lLl0l 0A-'nP p  @ 0^(PU 0(`<O-M`6 6006006000Jҽp−00SVF  p 2p PP_ p?P4S S SV0SpPr 0@p   $ `00 4S 0 0 40 s0 0bR$ 4S4 0P%00Ѝp PP 4P4 $0$ s 00bR 4000P ?21 R R0  ;0 $Q B q 0 ; 0pP/4 S S040S% 4 000r0  cR$`S ,4051E `+ prd0  ; 0w p PP4P0uP0PcRT T4Sz0y$0P s 00bR4S 000V0S_pP 0@  ` $A `00 4S 2 0 yS 2051E ` p p 0$ "P0 s0 0bR40 ;0pA P= pi 40 s0 0bR4 4$R2P0$0$ 0Cr?o  aR2$$1E00#?c p p 0pU 4 00 TP0uP0PcR TTe40 s0 0bR41E00#?c0`00$AR r  `R$ $ Q 0 0 0 4 00 40 s0 0bR 440`00T0! P00&$Pp<T(D<(4( 0  ;  0@āC/O-@PTDM4P0+ 8 `$Qi w :Q|#R3Z 300S g 8 pM0@ 20S0:3S X00P00U 0*`00<004T,0 000p@-@P8ppp@,0@- @  @0A-P$OP @pT $T`0 @@TPp00<V>U$P@P@P@X@-@|-P @v-P g$P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"\ D O-P0M(fS`pvpJP tP0ʍ p 0rr "F"Rp 3S(0$00 0,PK XT,P O 0XS\%$ PT 02P<50 4504S0300SR p0SO 4SI 4S 0d/、 @V㌑T2p" =PT 00@p2Z LQU  P  P }P ھ׾oY=t3@x2 P\ 00@x2X>3@|2  Po 00@|2gЍH5S4S 4S0?o20 hD $@$ <% p 0$0(0eX c,P Y \,P Z U,Pp2?;~0p220PX0 0rr TE"Rp1XF  5,P]Z<3@x2Z  +,Px2?;~0x2V  !,Px278x2Y ,P<3@|2Z  ,P|2?;~0|2V} ,P|278|2t1S0- 4S)xL%R&nZVO  +PJx2.#@|"78x2WY~ZA />3@B|2LZV+  +P&x278x2>3@|24p2Z0@p2VZ[ ?C>3@|2*P  ڽ>3@|2P >3@|28. | ` < 0 00`'T00- $ T X l p d pX tL x@ |0gN'<0d804  P X0 0//&TO- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-匑\ Q |pPl0@`P QV00` 㢻P2 _ /0M CR0200pP00 |P 〻0P ;  Bⰰ +!;`帰 就帱0 B`ຽPൽ@0 <00!ڻ %ԏ P A-@P!Pp Pp@p `EPE`0 |2U @0 o 2@ p@-\`P@T 0S1 RT0S@@⑼0Sʌp@膞G-l@`pS0 ST0S"Q0S 0ST0 0A-` M@@ֺP+ _ /0@M CS@j0 @ 0K~"   2 0QU ! P*# ]@Wۍ$|"D8 X - LM  R  ʂ0   Ѝl!TX0 Q0H00S :\@- #l/!T0 0p@-P0S :@#RA# #p `H0:P #c#p# B0:#!BA## TT0 P-0M 00S ʃ0  ; ЍT804  P T0 0//hT<p@-PὭ|``p@0@ I.0SP0P0:3S 8 L40 00 :#pTO- Mℳp3 x0t p0 *`\3BP)WZ Vp p P0V 0z0p   0Q   lR  00"1 R# @0S S9 SW0C S x2051E `py ~ @0T `  Ѝ R l 0 P  Ѝcp P0 ` Ѝ0 r 1 `R R0  S8F @0s ` S 00q lR Q  Ѝ00p  Ao0r  `R  l0E00#?c0 Ѝ0X0 T00_ス8  tT@40D<` G-@P$c$3`pZ 80$ RG V ʌ3S23SmX " R 8 0 @0S G 0W B20RP  pGP"V 0pG P E"W  P!@ G`QO-M00P0SH3 `3S,[*Y> @00! 0@ @00@ TP0 { p @` |P @0S  0 Ᏸ`PPEЍ` D P 00 C40/Ѝ @0 | P0  0 /L400 000S :P }/TL0 H0 0S :-P /T400 000S :P _/@TL0 H0 0S :-P /T400 000S :P A/TH@- @@\ ʌP 0 @`T0 0@-0@T J 3$S B0pQ 76@,P @hT804 000S :P /tTX PT 00 R0S *P@04//,T0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw AB0tQ 5A,T,0@- @  @T000 000S :P ,/T00O-` MX$ p P 0 Kp @DP  0 P?p@ 0 J@ Ḯ Ѝ@pTP  P /0 00T@-p@Ap@-jP g3S @P4P0@⊮3Sp@聐@-@ J 0s3 S00 0媭P 2 $R 0X0S H03 20X #$0403A-`PX JSU"X p3 @R S$ S'X 0lAQ0, X0p ,0\ 1B0010L10|10 A0 XP3PSSpP4PSpp3Upp@-@P X0P:"C0T0nXppG- Ԁ\.P@p  `ᆮP LTL VW PT WV  H000S8 0k0 0 PO-( \ @p=P`7PPP0 C CC06P( P@@V ,P P0` @ CP0 @ C\0! 0`0SZ03@800$`d0@-?S0Pp   0 P0X( @`b& p@`^  0000,A-@PQP% _pW0!  0S0,000 R   R   R  P "4`T `TX *P Q Sp QW02Tp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S b03@0SpX@ '(@ 8Q0@0ppp@-@PXa`R X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S L000080S@078@0pSp,LP Q@0?30R@080//,0@- @  @R/0 0 0Rt/0 0 p@-PS @ `@?\pp,0@- @  @RP X @0*7"8@0 8 R #@( @ //0 0 P@/0 000 00p@-@Px`P` X0:20T1S@0?;@0j8000080S@078@0bp`L0 000 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/L0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/LRp@-P@00S ^ p@m p@0 0 0p 0 0 @p@-@`P#pp p@<0@- 0@ M Ѝ- M Ѝ<@- @  $M0 ЍO-`, D | 0P0q00rp  B PY 0  0CI0 SP 1 ЍTYS00CS``STZ0JS` ZPZ0 P0CZ4(0 00@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP! + 1СD0 , 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C @(0 00X ?o 2 R0S P 01 //Hqq-(^,0R0^Q!R@!1 O-MA0@0S3, @ P `p0S! S#A 00 `0C``xP  (0R0 (000C0T0 02/p 0P@S(  Ѝ0tpPpo(0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@% (0@SpP0@-0^ 0 @ 0 Q@RhnO- M@`P VTppD0S  00C(000@0 B T0@ 0S `%,0 R@p @ⴀD R`Dp `|{p Ѝ@0 S RQ Ѝ,ѢP ,0ʢ0P `00V  ppG , B(p!B, A0 T`  `  0Dp4P , 00@Hp`4 0Tp `0Du@U   PB  0SQ 0 0$ PC 00\R =@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0U1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP d( 0PD Q P/$ $\/ P/̹TA-@Pa`Pt10 0 QT$ D 0R U EZpI 010 0 QT$ D 0R U EHp7 0p  0D  Q SC$ 0R U E0p 0*$@ P0@|0B0TP @T 80@Tp`t( TA-xP`t0@Pp0:؃pP`~800`VJ꼷T(P, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@ 0T `ApB 0S%0^! 0S0X J!y@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 Q0@ B( `p0,0,0CA@1` T0S( X @- 0B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QMRDp0[}$PPx ሰ P,q ԟP@0d W4) H0X?@S < ``@ `F0+; 008+;B H0|0$T`7 P \ l0 @8*BCЍ㠟P4. ܞP( :"R! 0 RH0SI 0p V0 0 @@  ʨOЍ 53 1/P+A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,BPP D00cD0C 0R p$`!b00P@0RЍPЍ|T@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @ꨯ00@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ0TH@- @  0M0 KЍ,TP-00 Q08SM$ 03Ѝ丬TP8 /-M 0  0N NLN ЍO-QP 0@000DF 00 0S[ (@]@000h0S80@0805 0(0 R08h>P, 0@(0, 0!0s0 PT; 0 #@I  t@T,0Q0@t@T80(00S> 0 Rt (00S(0,x 0Td L L HR8  , !$  Q$  P(  r Q ,R(  , 0!$ 4  R 80T@D0|c00 ~p L0[HP1 0804 0,0000C,04 0@T0TB 00S0=p S0G0R8040,000㓔)0#@D0CTڸP0@0/o"0L0S0 R 0TPPo00 P ` 0 @20S@ `+! R  S R 0 PV AO pW  B R@ RC 0 3p0 0 0P0 RW @]  P 0p 0` R  Rj  p9,00S1@ Q0C0) @0T 0 0  R- 8  `$),0 @T 0 P p B< R D]D0H  LL < l L\AO pW80 `Y 0P U0E0@00 R 0 R PP8!A TR  T  $R F0 0 0 0 p  0 00F @000$R  , 7@ _ 0 q@000!RP _ue 8000W{ 0h`  00( 0S(00000 0S(00 R0 000:3s L  L R 0K\&,0 R8 0`0 6# X0:h2Y, @6@V0P 0 0 8`4 0`,  p v'  @Gp 1`11qW 00S@0 R 0`0 6# X0:h280T @ 03@0S 4, 0Q0A 0 00C0`@%ꌔ 6@P?0S` p 1@1 1RPTQ :P RRQ 0  o 0 #,0 R 00S0 0@!3pG0`A@p`P 00#?3 1@DT1qGP p@?0@000L00@ 0@4 00@00X X0uP 00L0 TS 0 R (080  800 ,<2 0 Qp`dЍ (0 0 000S1, 0@000h0S(08 4 00} R d1SadЍH80 80@080B.P00C\ 0 ^ʢ 0 0@00Cw$80 l0S: u0, 0, QA@` 8`! ,\'@XP p@T(L0|BdB: 98L0/p/8.- $` p@XP P0@, QJ   8p@,@ APWp@PT ```PTp P0 @`, AV@ TqL@DPP " X @   \`Q  ABQcP P8 BQR p @ p  4@$<0D R$ pp$ P p , [!, !`m @@`[e P0 p WP`  0 Q$ p04@P R; dP8  5P d1S , 7@ }F  0@0 p  @0F @000P, 8@ W0 i@0 00PJ8r(0 0,0 0000S 0 PC@0U0 8000P4b pQ_ S4S 4Sy W00Q?H5S< ` 9, @ 0  `8@p 00p0 `+00P  0@` 0 B00 0P P0 0p0 P <0U 0S0W0S{4S0SY 0 00 4;, `@@0` 0UH5SPN p0SK 4S 4S W00Q0S7 L5S:  -;, `@ ~0  `@ 00pq0 `00P   a0@` 0 B00 Uv00Q@ 0`000 {@000P  T P$ , ,=@ .0   _@000P" , =0 00 E R! U =, @@0 01S U >, @`@0 0PL5S 0 0RU p>, @@0 0L0  @000o, >@ 0 `C0` @000tW V 0 U@`? 0 0LP6Pj @00p U ]ʕfH5Sp@TL 00`P@@U= DDPP `0=@p`0` 0HaUtH% R W R,    `0, @@0` 0HEU0  s@000lP `0 PtJ4#p@-@P`M`. 0P0 R    80x  t000 000P 0  Ѝp80 @0 @'b000c``DЍptT(0 00sG-0MȐ@PP  ",TX $ \A` JPlppP 0ЍH80 T0@000cp;`P`+``D0Ѝ0Ѝs(O-PP ! 7 1D00S0H``?c`S., p !@G'T :#| hp @W 0 R( ?3 S 0S1S0 S : r(0 00q 0R 0R0 0#0  RQ\ R RQ 0P // /@-@P@Tp@-PP 0 0S " UP Pp@`] P 00 @PUpS @ Ppp!` A! R/0A-`p,S@P P0@S pRQ A0@ ", "Q//A-pQ`P   @T  @T `PW @-@@@0S (0P0C(0O'O-Mx:xzx*0p(P܂ pP H*40\` S  @s@!dRX@jHQ00) 8 @Y @B@0@T ROoB@TP `NNQR0)\ 4  |  bR\ T)` R&D) R! CP'I@0 8R S[80S  G( 0P00B(0X@0C0 8R CPf S ^\ d( 00Q D800 <08,0RJ0H 0@0( (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(L70 RЍ47 0, _(,04 SBGg@` & ,04 S5(&0CP ,00xP0S (0P0C(01p&@ m `&0 0@,@ R 50(600 80RpfF`@000N (P0 80@P0,@Sf 40 CRbڬ%% pp% * t5@04p,`Y )| `nR`F`V,00P0S  2( 0P00B(0X``!R 0[^[ $ $0 0C,@00000C S[ pH400@4 0,0104#0{d4`000P 0 ^% (@(#P@ ,@j4 Rw 0U, q  P+ x# l# ,@(@?QW], 0 #\ (7 ,@  P 90,@( R @  P  @ $@lP " c 200  0 l80 S \ 'H2 0( ,B@0S  m( 0P00B(0( 00P0 ! - 40,`V7ڬA@! 10,`4 V0`F|!,`0 xP0S 6( 0P00B(00@&A@0S  #( 0P00B(0 0@\'pnL&X&%t%X%$$$X$#####,""""" !0  (h `  Tt\,4O-ds M`3p\C@4 P ᳩ804080,c`,0P Zn38@3`0T'#0CS 802PL袟 G0@DS,00S0 0l0S R "0 0r 208@0P0T0hP XRP4 @P 0, 0CS P 20 0N P1084 0, Ѝ04S00h0S40~0T104  @ P0P1<1,`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, l0  8@0SRC0PE@DP8@K 00SL008PcLhT(@- 8 40,0L- M Ѝ1!0O- @ M *BT8 `!O L!0 pR( X+ 0S#,PK U`0   R    PU0 PU0P0U0 S @T ЍpW,0 qP`00 P0 [SV 0W0_T (0 00 08QD0S0l%R h%R /!R!RtP/P//l]L 0 000 0P/\LO- M|upP+ p5 80s. D SP%̠qP 8%Q@1(%!S` 50 P\`崶 40 00P 40 0400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SV_~V= Q SVWV5 Q SV@, Q SV# Q SV Q SVWV Q@S  ![=0Y2 0 C S :Rpt p2! 00R"0R8=0"UA00002 1OLOPU* 0S 100S H0Y 0H00,  Z000 0 0 00RYPU Ѝ0 0 !R 0ʀl20 0 !R 0ʀl2 %R t5S 0ʀl2Sy Sw Su Ss Sq So S^l\LD0T( p1P0Wd PRP% L QK\I4 00ʃlœ\ 1:t“ @-'^# tƒ'΃r 'tƒr /A\ !B\ r^tƒ    /VDT 1P0C 00` P=ʀ: l2'΀S00r200 /@P%0000CS 00000000000000000/\UTp@-P@M@(\\" rf Ptf vf0 P P 00 {000 0Ѝp$TTLPd-X\\ rtv /XST<1 P   @0 0~00  HPr 00 R0S0 0?P4/ZWЍ H\r 00 R0S@0刀0ּpP4/pW?x!!Q" @-@M R ! R "R pP^  0 0@aЍ /,0( 0-M0 0Ѝ|<L0@- @@ M 0 @9Ѝ@<$ 0M 00 0Ѝ;p@-0@R P\RQ ^R3 @%c ,R'Rq{ L @RQa0 L !a}0 p  % ?{ R`VD 0 FR;h!@P`   ^0@! cR{E0\R:R '  px @i%L {i{b;O-M  iPP 0%  0  S  g ` @s\,S0Td 0@ @  0 S$  QS%S  +0BGSSQPNMLjiIHGFEDCBA@3>=<:s876543210/.-,+*)('&%$#"! 8 0 Sc' 00PЍiR%@0 0 `fv`  00S1.R0S*R 0 Sg@0 S[0@0%0dR% @00@  d 0 S20 @0r 0  0 0J0 St00@ s0000  00000 0.0 S0[0@%  0 @  %# 0 Sr[@0 % @0  00%+ %#F0 0@kP0 0 @ r 00  C C0000< @0D@00T0 S\R Z I00 S#0$,  f/  000S0\S 0 S00 C0 8 p@-P@M0@`0S PS#  0 00Pt 0 Q0$RT0 0 H D0 x0Ѝp]0t2L|H A-M0@HSD!00@0p0S= `0  1N;AƒKa1#bP0 P  8 g=M%02#cQP 0 pW$P@PW 0fSPЍЍ 0 Ѝp1LA-M0@HSD!00@0p0S= `}0 6 k<7@ƒCa0#b1 ! 3>C120BQg0P pW$P@PT 0nSTPЍЍ0"Ѝ0LO-M0@S!0 0  0000S, Phqb*cE 0 pƏ⊡ - ?DB%.b CĠ #W =W =YpP[ 0000pPQ  XoW i  RRl` ~PP U ,00 dW  d0SU $@G(0 "K%ᚂ!b  P嚃!2c 0P 0 02#c020P0 pX00$0PB0P,=p@H@Y 0S`@Ⲁ Ud `p`Ld Y00\Ѝ2~$p4(0 ,(k@C3>C lᐡb  ! 120B P0Q p@00K$p℡ (0 {(-8 ?T p -000 Tk@@0A@?SX>T0 p0A0Ds=Q=S9|7I_hm}^0S -00X.00  X@ E0l@! D0 Cr 2;0X'T OP͍ R'R ͍T0   R'R'Rp@p@I@`VzP` 00040zP, 00000V0R 1X!RL 0BS11ऀI PB=&@DQ1VTxvutqqomlkjihgfedcb^][ZYXWVUTSRQPOMLKJIHGFEDCBA@>=<;:987654321/.-,+*)('&%$#"t1S 0C11ऀ, R 3@ RX*P  0|p 40P040OU7 =@!1ऀ0100L1S 0C-11PSU #,Q!*P  4 P@6AT @D=AA0@a DrQA DR3@D1@ڕ#0S ?R ;RH p0S %S0 0@a0Ds RA0DS13 DOS !01000@Sl00l0 0St00t0QU PE=@Q1P OU?=-!1P@ Q @10Ds R-1!ORTP=@1p=1 !T!R   B!!0 @RS^  ?R ;R QeR p0SP %S0 00     00C2"0OQh0͍}SS  0S}S}S@p@r1S 0C1XX  S R!#@,Q*P  0s{p 40040@N, 40,qߍ! 1K200PQU PEQ1- @@OU=-0@0@P1Q %-1 1OS00@yP 400@,T 2 yP 400,X ](XPPÐ@oᨂPX ³@|yvQA@pQA#QU PE!TQ1- @OoBT 2 PyPT 400,S000 0 0. 0 n00@t&00&@D0Q0VT1/.-'*(&%$#"! w dR<*"@00N!@DOo0B00@000- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/ᐹA-pQM@P 0S! XB GxP %`V! - v00* V U{ ``ЍQpPU00c ``U  0 0 R Ux uU`oP0S U, ` hDYp 0S R s0r (0 000SU00P Z  p0(0P Z  p00P&U< 00 t L $ ~  | 0R@-M  H0S@ > Ѝ0A-pP$P U) @T`V 0PS |@P0DV  ḱP ᰱoA-PR pQ 00 @`R P0 C C0CP P (&~0 ES  kwP  0 000Q 0  R0 R  P U Eq0V Q ^`̇QP 0S  0 S o W0C  s0_S0S  0 S  RQV0C s0SPUE P 0$XGPG " X$@ : 02 0nP< sPJ fPW P00R00V0S   qQ :%vP N@!vPJ9vPL2$ PP Jw$PFw zvP$!W  P P ?V00S    0SP V PG-@aM!P`p 0hx P 000S> PЍ `P P 0  p R 0S 0PP  PP 0 00PN Ѝ 0  P DP+Px P *| `PP\T 8P 4?PYPqP  0H0L0MP U 0 T 0,LP' 00#1 000p0$0sW $00s PP ,3P 0S  .S  ROS8 =@P#PP @qp@t 0n P D>TD00S P P50 1 0S t 020  00 0000n00TS0 0PP(0Hg P< p@HP0W0` W  Ps  (\W  ReX+%P^WP p@W 0 P0F/0P0SLH BqO$q  $0PeHq \Ѝ0G| RE G/Rrponmlkjihgfedcba`_^]\[ZYXWVSRyONMLKiIgGFEo}ypW@ Wx%,0p  @ p00@ @0@S ]p@t`.00 000 000f0 MP$,0   Pp`pPp`p 0( d`P0f P >P] Pp`        0( /?W /t 0 S00P# p04008PP 00L^( ,  T000pLS48PWppPp`; 0 0s0]Pp@t{p@t@ P0n PB 0 S00P84PRTP -P0 0 0 iP 5Pp@t0 0Ps 0  P0oP0 |H'p \Ѝ0 p jw\0 anp< [h$ \$ p.]48PW$c b Lb x` ` ` ` 8` l_ \_ ^ $P0 00 //D 0@-M@0 KP\ 1N;AhLBH gMMl1#b 0 0#% @B4d0!PЍ0  P0`0>//l 0@-M@l0 CP% k<7@hLBCNCl0#b 2 "0#AB@C1dUPЍ0 1P00&>//@-M@40 -8 ?=<;:9876543210/.-,+*)('&%$#"!  " U a  K!00 (ЍpP P # U0  0: 0U53!00 P ~Pt D# U0 0 0"dP 0SC !00 cP00200U 0 KP 0Sh !00 cP00|20U 0 a  /PM  cP00i,20U 0Z 0"P 0S !00 cP00SU 0 " P   rcP00Zʈ10U 0 !="?7D",JP  ZcP00,U 0 " LcP0000U 0"?7L"P :0S !00 2cP00ʔ00U 0"?7L"P  0S e!00 GV PV V `U U T TT S S DS |R 0R PR cP00$00U 0"?7L"P 0S 6!00 cP00ʈ00U 0S 0"iP 0S !00 cP00600 0a U  MP\  cP00$ʔ300U 0 ;P 0S !00 cP004300U 0 "P 0S !00 cP0020U 0"?7L"P w0SI !00 ocP00p20U 0"?7D"P  \cP00e(20U 0U"?7L"P J0SQ !00 BcP0010U 0"?7D"P  /cP00|100U 0 [ P 0S} d!00 cP00# 100U 0 m P 0S L!00 cP0000U 0"?7L"~P 0SB 2!00 cP00`00uU 0 fP)  Q xQ P P O $O N HN DO N 4N L hL L L PL K cP00400U 0"?7D">P 0S !00 cP00ʘ00U 0y"?7L"$P 0Sn !00 cP00?00U 0/"?7D" P<  xcP00D10U 0"?7D"P  ecP00Lʌ10U 00" P T0S "00 LcP0010U 00"c P ;0S "00 3cP00^L20*0 0Ra U  P  cP00p30U 0"?7L"P  0S Q!00 cP00 30U 0"?7L"P 0S  7!00 cP00#ʨ20U 0"?7L"iP 0S !00 cP00D20U 0"?7D"OP  cP0010U 00" =P 0S "00 cP00ʜ10U 00" $P 0S "00 cP00<100U 0!    P z0S !00 rcP0000U 0"?7D"P `0S !00 XcP00 p000U 0d P F0S !00 >J `J I xJ $J H ,I (H dG G F LF E E E cP00000U 0"?7L"P 0S" `!00 cP00ʔU 0 "T P  cP0000U 00"8 P 0S 5"00 cP00810U 0y"?7L"gP 0S !00 cP00ʜ10U 00" NP 0St "00 AP 0S !00 20 a U "00 x30p30h30U 0?G"&"00 430,30TU 0?O""00 s20U 0?G"4"00 e20%0Uj!00 X20[20rU 0?G""00 GX20P20U 0?O")!00 620U 0?G"iu"00 (10Z10jU 0?O"d!00 10t10U 0?O"S!00 p10h10`10`U 0?O"?!00 ,10$10U 0?G"3.!00 00$U 0?G"l "00 00]00U 0?O"!00 00x00E |E `E D D PD C D C lC DD DC C C B C |B B C 4B A B A hB dA `A hA H@ @ @ ? ? ? ? ? ? \? P? > > P> h> t> U 0?O"f"00 x00WU 0?G"!00 t0000r00Z00U 0?O"!00 Z10t0U!00 J810U 0?O""00 "00 9"00 " " A u: PI S @ $"00 "00 !00 !00 !00 "00 "00 !00 "00 "00 "00 !00 !00 "00 P  H 0?G"uP !H H 0 ?O"0S!00 p" v" "00 e"00 `"00 ["00 V"00 Q"00 L"00 G"00 B"00 ="00 8"00 3I lI "?7L"|1 00|X1 00s41 @@0 fa1 00]0 @@X0 P0 800G-DT! @< t< < < l= (< = ; : ; ; ; 9 H; : |: : : 9 l9 9 : 88 <8 08 8 8 89 (9 9 p7 87 8 7 0 |00`40 00&X0 004!00 0 000 00x0 0000 P00 1 p00D1 @@0 x1 @@0 '1 001 0001 0002 @@`0 }L2 00*p2 002 00xG2 00o@2 00f53 @@00 Ym43 P00PJX3 p00G|3 00>3 0053 00,#3 00#!00  -Q*Ϡ?B0CS6S/ @RR#  S Q0 +C 0` 010+SQn {ȠȠ 00+C w{0 +S0+C3S S 0A.B0 B33200P / /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! V @D8 |,0400Gu,0 4 00(@  (8/P8,0S0Q 400 @-P00>  4O R 0 S. o+7N<$PI@'Np LA0P R $ R  R S /0?0{p=?0U[ 0PEt@T7p0pp@>?00SB 0??000CS?0S 0@7sN?0 QP?0 C0(0 S@p0(0`( ;?O2Y5?0U 0PEt@Tw0pS =0%T0PEt@TU C0 ` 0,0 SP0\$ @Dʈ7~+D?q@D0D 0B $0Sp0  0p7?@06'8w<#0#Y 020JK?HL0.0DSB?0j @p  |2060q @DS30P0;T0X0CG?0 C 3q@D07~D@N s P l0{1r0ರ^l[0PEt@[UR!B"0$ 8 S 0l0S>0X p0P0tXp0  |P 20 :@j p200@p 0O?0( (pd020E?l 0T[l0PEt@[fU0 C00Su 0 0000 ~$1岐T*Ul $Uh PEt@1岐^ 7sQ0D @C7{D7~D@NqKI?L0e$0SW$   0d@6?p0 (rm0p+@P7~@DM 0@Dⲷ'q"@p    L    d  0F?l00`P 000/ S  jP00S   0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0@000`PP^1@0SS/Q  < 02!0C 0  S"$0M< @0 QG Q0c  B Rp#p2W S Q6 00S/SY @0 < 0@0S2!< 0l0^pPT G R R 0c ^  R S R 00S  0Spl0Sp0p0C0pp"x 000 0p??0x p0 0 0 30 Ѝl0Spl0```.yHĢP 0S $0S 0S P?,A4 BR/A/Q /@o/A-EPXPv@ 0(+`3/PPs 8pWF ( 0(3/pP00@a  0 Q    +P04 S:oSS0C0P0T00C0T0p0W0Cp1 (0 8#8pPp00Cp0@0 0 Q    +P04 S*p00Cpp$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|MP  80 @ 0 C 0xT0SC0p@X0s\pW0-p  p0 |Ѝ0`\`V30sBJP:P0u;J XS1ZP05 0Xs00R 0xPS0RSCP RT@!T0!01 00P200 0! P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00S020(0@0$00($0,0@?o 200040C0 0000p@ 0SP3:^N $ %30!`P3P'( %!<: 80C1 ( RP@00F#3 0Sx $Q Br $ARVJ  ` V  \ F C 0 Z(  V F*x $R AR  BR ^: 0 Q  R`, %Q  RZ  ! LAS4 @@  010(0! 0, 0( $0X  O-p04M0C000 CPU?PU@PUA0PUAPR@oPP 0C R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`؟ 0P0\QpY 0@SQ QKW0 S  RE R  R( (pQBWR BQP"S6Qt0S R: 0S S > 02#03/0@S0P P0W W0S0(0 Ѝ0Sp>00000 S *S0SWq00Q R60@SP20 W0Sq S00U0 00#400 03 0  0#400  0 O0S0c0?o20 Ѝ0 0S&+B(l0S0 B8@ B0 #22c0# 0l0S q000 R0e9S 60 0t0 0  R ,00S0Q01$ QP0 R1 2 00 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  Q ! 0P B R PE [ P ! X*H 0 ,0 SR B000 0 0 0 0 0 S0 S 00R01 q00 3 R}0ES IS; [S3 gS3 #0S0Ck0Wi  2RC0SS@ S  00 # #8 00#"0  0 ,  Q R I   R'   0P P0S0  0 P,0SQ4: R 00, R  R [  $ R  9$ 0P P0S0  0 P,0SQ: R00 B000 B000,0S+  Rg00 0 B000,0g  S  0Qf R00 00#40w0q00N0SZt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SWe :W㴖H 6SX \0l S B8 0} l0\000SFK\ R8 C0k l0\000S90 Zt0(l 8`R B  ^C 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S$t0 SW S Sl 8`0 S W 0S0 B000 ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs04!ƅ0 0!1001  &6`Rt0l 0C` t0l z\0S B80 l0\0-00S=r#  #800#"0 00_ltX\h 0+00i*W6F &RA \ R80l0 C0@0,0 50 0 005 B0 00L0D!C0C  *t0S*l0\06\0l S B8 07 l0\000S201\ R80l0 C<:86420A-`pPSq@PG Q00V0SH81 0P1 : (0sQ Q P00 00000 |0 `ap" 0S$t l00\ R6S S L0D C0 C᩽060P5#0SppHGp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO-M`pH0S@DL 08Q1S00PP 0 0S $0Sx wpVoV`F0HSx0FSRt WrZpFYo᫲[iV @(& `4/@Pn  J@0`A4 ,P*   L @  ` B (6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0ЍOxv `fh00$0X(0 xЍ",0  000!t`T8h-M 0 @ЍA-P=PUPn`0@0 0 Q    & 0(3/@PR &@zǼ 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 ᝼, @@ ᘼL DD ᓼ&!Ꮌ0 0C&006 0&;> 0$0;/@ O-Q$M R0   0S!q"$!`Pß@P p`0+0*) `@$z0`&@!y0v0 qp0Pt0A1:SuPPQ "9SuPQ(6SuPQp'P5S>3uPs01+@$ "@QP`0.,Ÿ  "rQ"$ Ÿ! ! q R!   "  "rQ"$  ++ { R+! @$ $rQ"$ S4\@`Q@DPQT`&Qv`a"$&P%uPa PQ"d& Q,| &, "r a Q,d& QP%uPQ&T%,| a Q%d& "r Q&T%,| !%$"C0S 0!^q"$!$Ѝ LÁ!`AV1c/@pt D x L C-PRp cmN P  0!\00#@B .P @N1R C 0 @$'4 @-@P |p S]Np`@` 0!đQ00#B  X 00@- S]N^00# @L   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C>@@ P $B0R pR 0`RpR`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0 R`0 0@0@0C 00 Q q00H 'ᑒi7n/0R#@-qHp@#/Ǡ @ V  CJQ-{ O0pG֒\0 P4 @ B^S 2ʵσv p X`^ 0`!`P4[ ఐ`G&f B&S`p 0   ]pWPQ=000?10 K`P02  `;I`;Tt !GXTT;0 X0\s0~060v000 `k%[`P`+ZGp 0`K< 0K⳾0 F 0 p@R 0 q0CR Y> 0 BV0 00000C05 `FR  = 0@N @0 0T00 0SQ R 800S@BC0 R 00Q<ЍP  =p`w\ / !02NX1@[ @೰6:#6\Y I 0 pA-P@`QT0R`PE+~P p0T S#|T` 000U0 S@S |jT00 T-`0R V1|T0000` S +-T000 0`0T00 0``0O-M@T00R!+Z+8ʀP c W ~㸐|㸀iQ6s0 `IP000P#406`0cXfx0Z㼊PḀeY6Ps0`PE000`#406P0cXx0AUVq`U0uPPPP0`#406Pc0CQ6T T0P[Q p@`DQoob`V Qf0W Q@z㷀+}hpY6`Hs0000#406`0cW3sp VfPE0Tv`wppp`0p#406`c 0CUVP6AP0[Ѝp尀 phYp6`s0`H000#406`0cWsw0 Vf[ PEpTf0v````0p#406`c 0CUVP6 P0jP0e觮  P`6e@pE SC0t@0P@@@0PP#406@c0Vdv@Q@645P0V/0P2 `fP, ATq6`f0P0pAT6qv`fpP0bv`wp>ʀO-M6f̳S㼖 0 #`P  # A @b9 Ts0@ Bp000@p#4060c^~00἖&R @ P$ p฀n9 Zs0 N0 00#4 060cXx0X qxp@DphWt@>挥s0Hp000p#4060cTCt0A BR@C@ԗAԅApಐpiX>s0I000#4060cWsw0 0@༖^ hA B@n Tr 9s0=@Np000@p#4060cR#r0&0R἖e b ^9 s0@P B0``00@#4PP06c Qq0&0Ѝ0἖<0἖8LBP D \0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4j>0C&&0$A-@ s0`P Q!r  pp "$  a AS2s 6  u0U0U$0Q  00  0 ௴000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@, R} 0p&]P+ (+ 0 p ! RBAQ j  &!R:P3 "[w6 S7p3 s0000 #406 c 0CPp 66 }/G.0 0R0 0xS0  0LS4j>X0C&&, Ѝ O  \ P+R +R ,RE R  Q ,` &]R3 "[jP ЍOPj 0r\ R3 "[&0 Zp:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0 Ό⼦  Z*r   "$ 缦 j JPp \ ἦ * '  P3 "[A r :s0cq#0r   :p@-!TQF `fF`fPFPV !6@op\AFQ@FD !,  # җ!҅  (4\p@-@P`yy1r1FP t3i4FP @T @I000@pVp"@ p@-M @PoЍ3@oЍ@-P '@-M @PoЍ@oЍ@-P @-MpP@ `P `Ѝ k!@p /@ЍP(@U `0p@-S P@ `0 C!0@)!T @pѲ 0 p@-P Ų0p@-S P@ `0 Cu0@!T @p謲 0 p@-P 蠲@- MP !p 0S p@0@C!` V ` Ѝ胲00 Ѝ} Ѝ@- MP p 0S p@0@C(` V ` Ѝ_00 ЍY ЍA-Mp@P `P  @p }? 0S P 0 C @ T@ Ѝ.`Ѝ)``Ѝ#P[?U` Ѝp@-@P2 t3i4FPPpp@-@P& l?o2FP pT00p@-@@e@-@@|@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@5@-@@E@-@@Z@-@}@o@-@w@@-@q@@-@k@@-@e@@-@_@@-@Y@@-@S@p@-PM@ g>t3GP p0P 0pp@-`P:@ aaFP pIP U 8pA-P#@s g>t3GP p=`P  P `z>@-@R b0@g p@-@PO p@p@-P@  p@p@-P@  p@p@-@P p@p@-@P p@p@-@P| p@p@-@P p@p@-P@  p@p@-P@  p@p@-P@  p@p@-P@  p@}p@-@P  p@rp@-@P  p@gp@-P@  p@\p@-@P  p@Qp@-@P|  p@Fp@-@Pq  p@;p@-P@Z  p@0p@-P@O  p@%p@-P@D  p@p@-@PE  p@p@-P@.  p@p@-P@#  p@p@-@P$  p@p@-@P  p@p@-@P8 l?o2FP pf00p@-@@w @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@@.@-@@G@-@@W@-@@l@-@|@@-@v@@-@p@@-@j@@-@d@@-@^@@-@X@@-@R@p@-PL@ g>t3GP p0P 0pp@-`P9@ aaFP p[P U JpA-P"@ g>t3GP p;`P  P `<@-@Q t0@y @-@b@0@-@ @@-@! @@-@,@@-@(@@-@@@-@@@-@ @@-@ @@-@ @0@-@ @0@-@ @@-@ @~0@-@ @t@-@ @k@-@ @b0@-@ @X@-@ @O@-@ @F0@-@w @<@-@z @3@-@q @*0@-@[ @ 0@-@Q @@-@T @ @-@R 90@p@-@Po p@p@-P@*  p@p@-P@+  p@p@-@P4 p@p@-@P. p@p@-@P p@p@-@P p@p@-P@  p@p@-P@  p@p@-P@  p@p@-@P  p@}p@-P@  p@rp@-P@  p@gp@-@P  p@\p@-@P  p@Qp@-@P  p@Fp@-P@  p@;p@-P@z  p@0p@-@P{  p@%p@-P@d  p@p@-@Pe  p@p@-P@N  p@p@-@PO  p@p@-@PD  p@p@-P@-  p@p@-@0 P p:n:p@PP0S p70A-P`p 8@P P` `pp}P`  1: `&:#:\x<@-$@@v P 0R @-P Q Χo//L@ 0S p@-@L`P`PpVP p@ "\P ឧ0o 0 @-3tq 4@-P Q @艧@ a<0< 0 ( b$0$ 0 $q ܌q @- 8@P W0 0 0 A-pP 8@P! E0 0 0 EP7`P  @` P0 ,0, 0< ةc@| p Hċ-A-M pW $P 0P::@P7`P  0P.: ЍAЍ/ЍAЍ/ E0 0X ࡩ0o ꤃@-@P @  m0 0t n p@-@P t0 0R0 P70P Q  p@ppHp@-@P \0 0R Pc70P Q  p@pP/0 0R /P/80 0R0/P///l`0P ho@-^P  QQ /P/0 0R/@-@P X0 0R  60P Q 00h4P/,0 0RP///A-PPM ?o 2P0S Ѝ0S0 p 0 p6`P 0 S  R @  $9`P -8  00A-@PM 0 0R ЍQP 0 Ϝ 0p6`P 0S ` P 8`P 7000( +$0$ 0 U<j d0P D- ?o2 ^0S 0 S'/P/@0 0R /@-P otXP p ?o 2\0S0SP Q o$Qgf O/P 40 0RP VSf O/$0A-SM`"P@U Ѝ0 P=P 5pP 0 0 0/P S Y7Ѝ0 P3P  |0 //p@-PQ& @R 0Q: Pp6 P `0\ \0 L0H H0 804 40 wp褃lg PdLg 0,g p@-@Q PPpQp 0p@-SP` @ 0S @Pp<P P >p@p@-P<@Pp/P P >zP  p@t 0p@-SP` @ 0S f@Pp<^P P /TP >OP  p@I0S- A-@ᰀPp`p`&S 9P 0S <S >SkPdP 0S[P/LPTH@-(@LP$SP  @8d $@-@gP@d@-4@P  4P 0 C 6@ A-PQ`@  Ӛ O 0Ls0S0<\10S- !S00-S(0F?o2-\0S 0SS -S0 -S0>S 0  0Ls0SP3 /SV p(p 0 S S0` ` S S /S >S S 0 S S0FU0 R)oP0/S4 0$00>S7 S> 0S 0Cs0S` /`/OR3 0As0SQ ` 0 S S0 S. )S 0 S S&`FV0S pW0$00>S`0    0 0 0 ྥ S =S`B`0"Su0Sr  0"R "R ReC  >R`0P` |,|P\ @-Q R$P <PG &P@aT lT gT, qTuPoP tP;P"tP @mT pToPsP;P';P<tP;P>@pT@;TS0S/Q /@- FnoO-IMP@@ p$a ` R, 0P R$ 0 p3/P 0 ` 00S  00 >SSS T34PyyyA-`RMaPPp2 0S/ @0U  UT 0 B/P 0CU/PU  U0 0 B/Q 0C#@ T@! ᛥ;@04D .00ፘ 0 R* 0 0sup@  RV xPrPۍm?00i00S0ep `p cpLPv@-`-M⛈P1@PO ,5p`F pF 0pE eS> 0 ` 00.p*  Ѝ0 `00p    0 p000E,3)3@#3@- @l2@@-4dP 0 0 u,W tsO-IMP  @Tk `p Y 9/0 p'PR @TZ 0 R 2/0dE P003/Y@ 9/T cT T @T@@ 0SL 0 3/P Y 9/c@T+ 0 R 2/0c( P Y 9/Z3 0 03/Iߍ E0 0  ;0 0  0 0C/ 0 0C/p l0l 0C/٢X BT0T 0C/ТLU 0r(q(U rqU qpT qpT qpT qtpp@-P@PP'  /P $0SP 0 nP PP nPP 8 P pp pP0/O-MM(p@ T 000 000S+`P$  T%0 `)P4  0@ 4/@P`P@003/0 @PMߍT0 00P $ 0R000 Mߍ R00 0 0K/Q nm 0/0/@-@@P 00#0 0 P 0S S R/P/ R0/  @-@ 0 0p@-(M@P |  N2h``dP (ЍpD  >2FP q(Ѝpmmm@- @51P@- @@ $p@-MP@` ` 0Ps* 000 ЍpΣ0"Sp@-M@`ģP Pqp  000 Ѝp谣0"S 00 S 0 P :\03#/S 0 P \0///A-P``#ហ@P (!/pP \ ᅠ@P }0ϠW@(0$ $0 T \j@N `j 00 S 0 P :\03#/S 0 P \0///-M 0  Ѝ0@-M@P0  @0yЍ0@-@P ,0 00RH /P/0 00R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / P $0 00R //P $0 00R //P/`0 00R / 0   \ /!s00/S :P/`0 00R / 0 ɓ \ /!s00/ S :(P/h0 00R / ! R0* /0- ^04 P/h0 00R / ! R0* /0- ^04 8P/D0 00R / 0  R /P/h0 00R / ! R0* /0- ^04 dP/`0 00R / 0   \ /!s00/S :P/`0 00R / 0 ɓ \ /!s00/ S :tP/h0 00R / ! R0* /0- ^04 P/D0 00R / 0  R /P/X0 00R / 0  S /!s00/ S :,P/X0 00R / 0 S /!s00/S :P/X0 00R / 0 0 S /1/R /TP/X0 00R / 0 0 S /1/R /P/D0 00R / 0 R/ /|P/X0 00R / 0 0 S /1/R /$P/X0 00R / 0  S /!s00/ S :P/X0 00R / 0 S /!s00/S :LP/X0 00R / 0 0 S /1/R /P/D0 00R / 0 R/ /t P H0-0/o0"^ R  R/P/L\ /  JQ\/P/P\ / Q/S/Q\/\0Pp@-MS ` F Ѝp$0@S P0-S 0S0xS !P T %P yЍp/P P@]Ao/A-PP Z,P`p @+@P-@@+@P p40,p0P4080<0lꐣ  @-Q@a 4d@-$@@H ̜DL⪚⧚@-@@O-4@T ,p@Dp@Ѥ@T `P煑Q ሚPZ PPZ P0z 0 8[> L[ @-R 0P< P 4Q ,  D c@0@ 0 , (0( 0  h> ZZD> [Zp@-M@4 00R;SP,0 S R' 1`V8 P` 0 0LP 40, 0C40P0 D`ЍpS a0 0D ਜЍp8,$4,ЍpR p l0l 0D X qT0T 0D @ a<0< 0D ~X= lZY< YDY< XZ Y< HZXA-@`,p8+PP W 0 !ᾝ,P0`+,P0`G-@MP `P +00pЍ!0 P (0S0 0 P (0S$pW0 0 0P 0S  pP  P X p0 P +( K$0$ 0\ |W : HXV 0 0 @-`: VVp@-@P p0`0V*PP L H0 0 N0@S<0  0pp| 0 0 @-鸛9 XWU0p@-S \  Q @P+P&p {0 0 9 UdUp@-0S h`@P`,PpP p@@ 0 0 t8L8 VT40@-S , 0C40P @@ <0< 0B/[( $0$ 0B/R$8 8VpT8 ULTp@-@PP0S ,  Q<0  0p@BO-p`@40SK P@ rP 3P 00 0SQ 匑 # 00R&P P [G P P P 0  03/P PP 0 S aO 00C 0S 0PS Ph@T P0P 0J/บ< 808 0R/௚0SDxQQ5 SQt5 SQ@-@@ 0,S<SS)*hA-@P-& 0 0R!p4P 40S P,0aP0#  8,0040U:8 408  0P 4  Q@-P80080/dp@-P@ 80080p@ p@-@P 80 0R@ pP 4@ pp@-@P \0 0R@ p`P 00S@#: p@꘾p@-P@  @ pA-PP 0 0R4pp `w 40S @40S ,0@k Pf n`` A-@P 0`0VpPQ 0S P @T @ <0< 0R/๙@9 @T1 OMA-`P /o0P0"Q@@T 00R p  U@P @T  @ 0 0R/똼0 NMO-@PM h3P 0R @Ѝ4 00R80` pP @P@ ЍВ 8 J ŘpP0 B 004QY 4 R] , 牡 0Q  ፖ P 0YId  B B!ᛂ,0 p 04 P<0 4 0<0  dp,WC<WEW+'Y&  ᜡ0 Jp  qpP i 0,S<SS5 w(kPg@, <0pP 04 <0x ᣘYp ,&<&! 9,0p |0| 0.஘d U`0` 0]/घL H0H 0.лxԑp- dJIH- KI$- \IpIG-@S ` VP p P ( 000 G' 0 0c/^0, J|H0P L- ?o2 ^0S 00 S/\@-PP M @1 0R Ѝ`@ 80  Ѝ@  0P 4 Rp@ Q(*,S0 B!ᒁ400C40<00<0h Hd0d 0m/P JL0L 0m/8 I404 0m/* HG* (IFl* HF P/4?o 2 R0S/00 S/x0P D- ?o2 ^0S 0 S/4P/0 000R/ܴP/0 000R/ᰴ P H0-0/o00"^ R  R|/ᄴPG-F `0pXGX@P* 404 S @ S@ 9000!,0 000,00$ 00,0, P@ P : 404 S @ @S@@ }<0< 0s/4( $0$ 0s/+' G-@\ `Pp<\;  \  \\ LQ P X񏐑]K9*=\0S X ^ X<S O P"0 <Rj R  BRX0t<S_ 0`S@U Y100@000`U Yd1000@#30`U Y$1000@#20`U# Y0000@10<S@ O 0BS=R{ <R Rv Q3q <Rn Rkf@T UP0P 0\ V< 808 0\ ML$ \# # " " ! |?$?! R?A-`PL#@P dU0 0 0 <#pP  ზp P@8PQp@-`` @P$#`P  kP#@P $W0`0 Pp@tQPp@-  R`PP`#@P =0`0 Pp @-@P P0 0R00SP 000LЩP/0 0R /lP/0 0R/D0P `o@-^P  ^^Q /Pp@- 0 0R P`U V "@P  ߕpV @pD @0@ 0| t, (0( 0| k련p (<;L ;x;0P D- ?o2 ^0S 0 S;/̧P/@-D@T ?o 2^0SQ]opA-M$PU@`P !0 P 0S3Ѝ 0 P P""pP 0 0 0P5 0S2  {P+ U.  "@P8 D0p0 P@G PzpP 0  0R0"S |0| 0 ғe#Ѝ`#!@Pp@0"SR#H6( 99/P/< ?o 2\0S /0SP/,p@-4@4P@P 00p|0S gd44@-@<<kT (@@@@ @ta{{@-@P (0 0R P/0 0R/У0P D- ?o2 ^0S 0 S)/ᤣ0S /$0p@-S@ h P0 `P p8 0 P 0 0 $326 D7A-PP !P`p @!@P"@@ !@P p<``D`c0,p0P4080<0l@-@f@c @-R 0P< P 4Q ,  <0B8 80 ྒ(0G$ $0 ඒ6L \6p6, <6PG-9 pP0`W=W@ 404 SS0 ;000P,0 10,0$ 10P  P :  404 S P  PSP@ <0< 0( _( $0$ 0( V 24 54p@-M@#S6RP,  R S" 1CaV3 P` 0 0P 400C40`ЍpR e0 0< "Ѝp!!ЍpS L dH0H 0< 4 u000 0<  x43 33` @0h3A-@`,p PP W 0 !D,P0`z!,P0`00p@-P4Q8 @Q K4 ,040<0Q0<0pPp &0 0P එ4 2<2@- MpW& @P` "P000 Ѝx 0 `P (0S T @0 @P  Ѝ$ B 0  0` ~P,T X2\1 Z0 0 @-o 0$1p@-@P p0`0V. PP L H0 0 0@S<0  0pp,$p@-`@MP40S9 HP@Ѝp P @P 00 0S/0 03/P :P 00C 0S @ 0@S [P\Ѝp@<@( $0$ 0 *)) , /40S 0C40/ 0 0 @-Ԑ /.0p@-S \  Q @PGPBp Z0 0 ഐ뼙, -4.p@-@P t0`0VP&0S R<0  0p@$ ] 0  0 4 T--utA-PP 0 0R4gpP 40S @,0a, 40a@T:8 408 p萘@-P80080p@-@P 80 0R@ pP0@pԗp@-@P 80 0R@ pP4@p脗p@-@P \0 0R@ p`P00S@#:p@4p@-P@@pp@-P@80080p@|p@-P@w8@t@@pp@-@P 0 0R`Pd40S ,0AT [p@p@ R0 0F/ȏ0| \'*A-@P 0P 0R Pp`78040S !,0X #,0QP<00<0, PPD @0@ 0J/, (0( 0J/눕 *)d *l)p@-@P H0 0R@ p`P@phSA-pWP@ `P  A00 0 0N/>T )\(A-@P1 0R`P4P%80,0!qW&  P  1P ,0P < 0@400<0AAD @0@ 0W/, (0( 0W/hP (X', $4'0P D- ?o2 ^0S 0 S/4p@-P6@P P 0 03/P P @;pR5@p0S /p@-P@`%P $0S p p@d p@-P@P  PP $pPPPp@-@P 0@011/A- M@8! P P"1S2 C Ѝp`PfP p` P10 m @80B4 40 C$0A 0 ; & %% %@-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0  4%$G-@R(MP00Q P 0 ` p Pl `ᨮ0T?o20S00(Ѝp`0 $0 0000000 0 00Q0/0 0000000 0 00P0/ 0-2/    S-0 2/     Sp@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  V P0V00(Ѝp@ R 0S V00"PQ0 @0/@-@p00T000 @-@+T @-@$T000 000S/@-2d000 000S/@-"$000 000S/@-000 000S/@-褢000 000S/@-d000 000S/@-$000 000S/@-Ҏ000 000S/@-Ž褡000 000S/@-㲎d000 000S/@-㢎$0@-0 ?^+ʼ0 @0N"0@S  \ C$,x0P?0? 0bR0^  00^ \# 0@_ؠ$h_0 0 0/$ 0 00/ğ$ 0  000#/ᜟ$0S@-@1/00/T0T0p@-@ P`0S /PpLp D/@--@-p000 000S/@-贞Ao//p0@-@ MP  vHP Ѝ00; 0  p@-@M  wDrP pЍ$0; 0 ŋ0P \p0@-P M@ T T T ލ 0 Ѝ0 H@D Ѝ00: 0  p@-@ ^B @,08 0 4l p@-@PP [$@Dp07 0 qT%$ |p@-@PP (Pp07 0 ^% Xp@-@PP $Pp07 0 K$ 4@-@PM  +,Y>,0 m DЍ0; 0 +<$8 @-@P ( 07 0 (# @-@P $ 07 0 $# R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@x P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P_~8U5U5E03#0@3#C#!@11@  /  `Xp@-PQ@y : S P Sd0 V Sb0?0 !-0r-w0-0 R0[ 7RJ @Rx00 0r -  w -   R< R7 Rx 0  r-w- R. R( R0 R  x 00pRs  ! Rs0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- @09< <0 : S}A0a0-0~\U O-P4A@:  pPA "PA  ZpP% 00` 0@T' 5P0=S AP` AT BX ! 0D0>@ @0 @ g00蘔  C-PMTT"PP2LB 0D@$PTPf PppX`\0  CXlP&pk  p` $`m n   p[ p0 0S8P ǿ  08 0 0 P ! @00Ds \a0DSW0DA0DS"70DWUX: QP S \ eP"000TB W. 0 p 0U00S 0pS 0F0 Ѝ0S U @0` 07 0R00  Ѝ 㙉 㙙 p噉I㙙A p0? 0 d XR 0AA B PR W `@Wp pn 0M0 00Ѝ5갍$2O-PMp 0GW"S00` 0t@2P-TPe +T@`0> ǿ  0k 0 c P ! @00Ds \a0DSW0DA0DS"70DWUX: QP S \ P"000TB W. 0 p 0U00S 0pS 0F0 Ѝ0S U @0` 0j 0R00  Ѝ 㙉 㙙 p噉I㙙A p0? 0 "d XR 0AA B PR W `@Wp pn d 0M0 00Ѝ5|$2O-M`P8@@zP @T@ᬋ@0< <0 |堋-)cHXc p !1 A-@P0!MP0<80\ a 0 ` 4 4   P>44p pP2 PD0 p B p [PP!@T Cn`4 P8TޅPyP& @T@0S   < p0 0 <8 30!ݍ\00T P0P 0 z|!0(,bH# `"| d"O-@$FM`4 M Q0琴t0d40㘤 T V [ ZX (d 0H00;PP0S 0H PW 0 P(00cP d$-P(P$XW ,P(O,McP $EW ,A b X#P3 0 d4 30Fލ Ѝ, 0P30 yPyPh / P@ @W  C0Yj Yt "0  N7t p mc0TT cY8"y424 0{TO"z2 0{VF!{1 0{[=!_1 0{3Pl +!0$0S〡 / ~p! 0 P  6H1D!0  @ 6 1!0  @ 6  @  l' `H|^<ttXx <T (  о l @p  | ` @ @-PL!pPH1M @00007 ` {T T& }/00@ 0 0 0 302ЍU0000 @B@P00P0?s00U00PL H0H 0( z|P|P&tZHZd 4 @-@P @, ~(0( 0< z@ |O-MMP㴲!"  2,$00|404(0 ,0S 0Sp 0Sy $0S` @@`P4@0P    ip+ P8p2x`00380@P! | ~P}l|00S! h|0=S0`S"`V`X`V `ሀ?fPU|0#S 8PU0 (800C80>|0 @x000004=P/| @P x 4 +P 0 hR T$ i@$ h XX$<$SH  4p x @ T  P$(0S800C80 0<0PPp` 80  m pm0W0P@5P5pXP{ pPھ5 40xC  0PU(0Py0S S Pm j Pm c$Pm \ vP< R10Y"2 0 |4 30ݍЍ0@i{ T 0` 0 ;@ <*(080$<0 S  ;P 80S (0MK0  #3 H 0y(#,3, 0H x 0SL#P3P H 0x{h#l3l 0H x,0Si#3 H 0x_0 <    `Pዟ Pᇟ PR-z0S i$c,0<[LXS8p$C-` "p2TM PPp@0t0L00A VJ WS X\ t!,@ Ͽ |0x0P 00 C0 PLQ PA,@K@}g@0 @ !0 0 L0 306TЍ 0 P 0BxV 0 P 07xW 0 P 0,xX |0| P 0!xP彆@ PP$PHL(O 8p t D X <l-M]ЍO-Ph"`d2\M @P p0焠刐0T00J US V\ Xe 4" w p0 2P 0  C0 pPc0Q ,  fEP 0S@ 0 @SH!01 0 T0 30C\Ѝ!i1 \ 0wU j0 \ 0wV k0 \ 0~wX l0 \ 0sw3t0  @P@ \#PNHhh M  T (` L-MCЍO-M $4 0 02000qX [ 0S Go0 0-0wP kPd 1 S S   #@ # S\  000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Un0S 0S 0  00_op`R0+S4 -SF sPPUpwV WPR3 Pp S 0QUp @U40S\ QO 0 M000+S_opR0S @S0 :PP "_opR0S @S!0 &PP`  _op`RU< ! 1 0 2 30:ߍ|sPPpPp p~ S! @FJ F d 0 d 0(vt p0p d 0v[T 1P0P d 0vK"PKH P 0 B  P @T@T 0 pPP 塃0Ѝ @ᛃP0Ѝ| x0x 0tV\ ]X0X 0tW< ^808 0t`$  $̣ h-$M0l L` !Π@ 0 (0 0 0 30$Ѝ \AH$A-$Ml0L ` !ΠA H0 (0 0 0 30$Ѝ @H@O-p PP`~  BKu@0   00Bq PaBQWBABQ7B R0 S< 0A0CSF 0 #S2--00 D0S0R0S? R0 *@D TT@0 T:0} 0 t0p D 000 0 t@0TD0[0S [?0:d0`` `0 s0D0C@ @0 s vP ,4  \( 0O- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# t R ? Q*:  T:  @-PL@ MH0`@p=400 0ڎ@3 Ѝ4<(@-@PM  0 0 T0 H  @Ѝ$03 0 7sX @-@P(M" $0 0 0 0 0 ^<P d0 $0 $(, (Ѝ( B$0$ 0 s0D ,p@-`P0M@P& T/ U8 ,0 0(0 (0 $000P <P00 04(8, $< 00Ѝp 0 0 rTt p0p 0 rUT P0P 0 rt 0 T <(  L0"02 O-P0TM`0L00v Vj 80  00 0 0 ! PPO @p 0 p@P< 0+S+0S((P,0(0 $0 00P0 $T,$,0S/ 0 0 L0 30*TЍ0  9P ;P/Ut00h Yd0d 0D rL XH0H 0D r~J8H7 0 p!1 O-IM0p010 fWW lPPN x@` N0 `?@P; 0+S+0S(P  0   P   *0S%@/ 0 0 1 30Iߍ P nP%/s00< 808 0T q6Hllh5 t0/"2 0@-@P0\MP0T00 U @9 <2_.p@00@ +JM 0  231 +456789:;< =>?  ! "#$ %&' ()* +,-. 0/0+ ; Ep d0 0 T0 30\Ѝ0!PPv004, ,0 pj4HL p2t0 x!1 @-@P0FM Mp0d40. `+!PPd@!;+ P r@r R@(d \0 0 d4 30Fލ Ѝ0 N,0, 0 p1H01 h@@-P pP0dM `00\00 @ގ X P0 0 \0 30 dЍ0 h,0, 0( cp0HX04 t80M 00 0Ѝ/$@-M8@ 4@`_0 Ѝ,<0P1Spp// 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 o.@/H@ . G-p!@1M ࠐ0 U040$ejP&0E W07pPUo0 ;u0+ @P   mU0 U qPqTP q@q@  rx p0 0 4 30܍ 0}iQ'pxP|` .H -- M 0 Ѝ@-P pP0dM `00\00 @ 2X P0 0 \0 30 dЍ0 ,0, 0$ PoX,H , `x8 80 O-@Q0M0008 80S +Hd@@P  @0\80dl: >b@`'9:E`@  `&-L@` 'h@ l "H`4O <!  -fapP,(5_͌b! Dptp& 7|!x 9l '8*. p"pp' p`@$;`,P%` (  `&}`am8 )  " gq-9* $@!@@$ @fa01.' +)$Mb!.p &7 dA(,  0" P%͌9n `* ! o`P%(, *_ᜀ!4$` Pl(P .8  "**!+P.$_p'+**뿠`ꯠ p' p'$`篠pp@ p- 7@$ " *(O0 +ꯠ"뿠, ) `)0` *"`/4)뿠 *( 韠/`,, ( ( *( `菠 p'af! p'  杉 p'`(`& `&珠`&p! pio` `"``&p'` $p͌P%P%nP% P) P0 P% 00(P &,`@$l@$ "P`@$ "oO . ` "P, ;>F @@P%@ (@ P-.a.P P%M b! P %P! ,P%,dA쟠 * P͌ P P௠" nP] p$!( p'l+ p.+$ p'  eQ $@ ,p!-@$p +@$p, @$p'`뿠O@(@@@ @(pM'p%.p'.b!$, ,p ' p, p ,pϠ( P,pP dA],p,,pϠp ",ppn} $ $   eQ͌ "( " "/  . "@ gq  " @ " "@% @$l/     @.- .. @'@$`,A@$P@$P@$P,P%b!O@@`&@p@$PM`& P`&P` `& P P(`n ,],,`,`"`&dAϠ  ( `(` (.͌ )eQ`) $0 "0菠@0 *!  "!0 "ml!⏠ %  "fa04`= , /H,)$P@+韠 +@ +@ (믠 % ,c1,$PaA쿠   (`͌%4P!!_PPP`P P& `. .lQ$   0&0` 0# 0#Ϡ0 a00@0&@ ,`,=O @nA, $&` ͌ c1P&4P` P ,`Pl PP& ` !!``͌`nPP@P `].` .`.l @ 0@͌p'@0p' `p'0@00@@eQ@ 0&$`M0#la  (p0p0#pp p } dA  4͌?))()gppP (P( p( p]菠 4pl `(eq`& `&  Po,``PP@P*@ ]*@@ @n@$ `*+M ( (ePoP菠 $ P 佋P*  p,(,p' P%  P%  p' (! b*LdA`$`<`00͌`4`0`) `&k0_00`=.`.(`. `$ `& l `(`&`& P+柂`P%@@P0`( c1P`& P`&p,Mo``, `n`pp0#͌0#dA `&0.= .lP @$@$c1 @,M,n0#,P͌0#dA0.= .l$ @$@$c1 `&@(P,M,n P0#͌0#dAP0.= .l @$ @$c1 0@,M,nP0#͌`&0#4dA0 .= .ol` @$ @$Dp @-`XTHc1L@ 0#0#\`80m  P`   Ct00 0 30ЍT0P P0 j80SL400 00 zjCH|| { T@-@P +;0   *DC< 808 0 [j #EgܺvT2|{ (إA-PPp`7 W+ 100.!؁0% "0 0%0?S@@h ck0hV@Hp` 0V@@p`F AJkH D0D 0 j, (0( 0 j`z p8z !1 p@-PP0M@0 00@ TI  0QX+ ;MdiDithTh&$  0~? S a`4` 0~? S  ~U E "0 0R1<30 0 0 0 30Ѝpx t0t 0( iTX T0T 0( i H|py x  x D 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)A@P00F, ,0 UiH$x 48w (G-p!M@1M ࠐ0 (U050,e]P&0F W08APUo0 ;u0+ C@P   TU0 U T@kPMR0 00//@-MP `@ pbpPU0D>S 0!3100 0aЍ>SH 0!3100a00a00T/-p@-Ma@P@U0 ` `  Px0x 08 R;0Ѝp@Ѝ/0 a0( $ x4|ܹxZ|A-@PpP`V =UB 8X ERR14/.-,+*)('&%$#" VP&2!0` `0p00+Xp -X& =X00+0E0VPpppV-0`0p=+00+000@00(0]$ $0 &_00zdO zp@-PP@^  0RuSpWSPX0CSE4 *pP0R Q PSPQPQ  0   I0 0+S -Sp0 b0 0 ^M pxHxO-LM0xSp _8@(`  NL 0 0` @ `@T8 P00p00003 0 a0GS\ RI$00+W@ 0-SZ0=W00 0`@ X B R j b\S  "=W  R"   P:0@$PE` V >` R$ " 0务@P   s Y# @ T:$P$`@ p4 `0S$0" @务@DP@ @T 0XX 0 0 0pW ,Wsp`TS `! Z0`$P_ $ _ R$ "0 `务`FP` `   !` =W +0GY?o20S# Z$P_ `$_0S$0"" ` Ⴁ`FP` `V 0X`0 00X00F `Z$P_ `_0Ss$0"" ` Ⴁ`FP` ` 0T 000  HR;I?I00 HR 0P01 P1 00S.p P 0:1 00S:0 Ѝs\0 00S@%\@ Ѝt p0p  0ZXyL H0H  0Z0k`4~= hth}p= bD D0 Ya>0P R@e: eO-P4M@P\p WHX0S; `00 S 6/000 00!S5+0 0 00!WqW0m Yk X00U7:GS> G1@000`"  0 P(0@`0t85`0$0XM 0SA0`lW A,0 DU`W00V0S ,@P(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!!#: 0~`V4Ѝ3+00 00!i3/0 00!bt30$0H\/Ld0L``00|2pST0,@` P !`TP 0V ^ ,@Pw ^[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D P@`S8 5HT1>O0*0` 0 0T &.60S 0 0 @0P(0\10X00`d(08!9414 @ 0uX@t0P`d(0 L  R)@< 8BB`L>5C-0eM$`P 500S xE p@#S!Q0 pP$ 0S %P @ 0SQ0SЍt ` p @0S pG4 0  0Sx t倄倔p 0fS0fS 000S3R0S 4$ 0000@SV 0oS 0oS0nS 000S3R0S # 000 pP 000S3R0S p# 000 [P 000S3R0S # 000 FP( 000S3R0S5 " 000 0#S 2 0@ R@@BP00Ѝ0 S S\ P 000S3R0S " 0@00q  P  P2 000S3R0S) ! 0 00T 000S3R0S ! 000EP \>@0S0 @  P =QrB  0P00 P=Q 0 0@0 šSB  0P0 0Pā <==pP~~~:<~x:d:}}0 9|D9|l 89t|@-,@@P 00{p@-PP \KKP Z@Tp I0 0 N 7H7O-`(@8M PP0000800 UVXT 4p/Fp005 [W  NU H(<8 0 0 30 Ѝ`s?0l0` 㰨p Y A  嫼UX ?0 0 0000S'  A0 $0峼p PO<000S[ O00巼@O@Z 0< O00 ዼPZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #S I BqQ #S H BqQ #S G BqQ #S5 L BqQ #SP M BqQ #SF N BqQ #S< O BqQ #S5 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  P 0 `000  00 F  RS0,Z +0S N 00pNpX 0 `[ N00@N@_0  G  @z  `# 00 D ㎻,#   30000"   2000000s2_"0 aLq@@,0 pC+ (@(ml P +Pk0Sk[x+ M feN00b 8Ne  /_e 0(@ 00= N0`00x0`0 0SCq ` H x0040 'N0SY001[ o0S0 O  `00C0@  ٺ  [O FkC hHHĥ2tp1 x110'D0/x/- M0ˠ0 Ѝp@-@```Q P Pp8pF0pP pPqqG-pP`= A@0S&A@Q0)쀟\@@\ M P p0 R * tp0 lp0 ,0<( (0 >KlqXq4q0q(-0 0-p@-p`pP`P@T T0T0 R@@pP00L@4pp$@A-`Pp@P@߽0S |@@,? R"@`ѽ@#LٺP00M0@徽?oox?@-髺 00 nC-`4MPG@P 0S|0V ! UpЍ  L0P;  =R6 0Q*G B&R&>$#"M = -RpY WꘀqꈀvKSБpȝ0X{FH ༝ 0+8S+nn**H*QLh-*))O-BMM5Pu0 %p05 0 0 0 $  G C+0 ဝP 40 49P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 30 B\ 0P 0S p30\ 0P 0S p`30X3PET`0L + 8P\ y@P 0S =PP[[ FP200xS0xS0Se "\2 0 4 30BލЍlR@P\ DPq 0S @200#SF \ 5P 0S 2R0P\ 'PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S oH10\ 0P 0S o10 ! 10P 0 $y0000 00002)FP)Tdl HLlk xk S -RE S0 U@ ᱠ0]S^$0p Sw ti - 0Xm  0X/Sge @_2U/00 0 /XU0@  0U ᾠQ]Q \Q  @S QU@  Q% @@ $0^ @ ! p[Q  @L1{H!H0 F0S,1|(!(0 F P0 @0`p pC0U0   Z  0 sP/ZY  /:Q /QY 000 0 ꌏ  @0NP@-@ P H 0 Q 4Q?o2cxdp@-@lPCP XCP T00pT 00pH 0 p(O-Mp!0@  "  @p` P 10230Y ߍPT 0 !pI  P: [ ;` 0 0P P) @@ 0  p@ 0 P0P S P G">0  "C0 p@H -RHlO-Mp!0@  "  ḵp` P 10230Y ߍPT 0 ᙵpI  P: [ ;` 0 0P dP) @@ 0  ჵp@ 0 hP0P S P F">0  "C0 cp@G -RHXO-Mp!0@  "  0p` P 10230Y ߍPT 0 pI  P: [ ;` 0 0P P) @@ 0  p@ 0 P0P S P F">0  "C0 ۴p@G -RHDX0X 0p@-`@P cPpPpPWP ꜁X0X 0p@-`@P PpPpP=P 4X0X 0p@-`@P 9PpPpP#P ̀0 00 媳d-H- M0 S0 0 0 0 00 00\100 M\  0S068 00 0 0 30KH Ѝ/v,H-H- M0 S0 0 0 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/<HH~ -- M0 0*--M  --M  A-PPp`p Q @Q PD@L0 0000Aj$0 0 C~ x0P R   0//"0'07 O-@P0p0 p    UPF1`Iq0@0p0\p⾒2#8"0  !@@t@p005T0AW5 V2H@00sp!0 0 40 30<Ѝ 810p!  %?PX00X0!h0 0 A=8}H<"(VVUt\0UTTxtTTTc8TTS4 SStSp HSH S R R R lR| ` L (   ` dPPvOl  p@-@P> 0S0 50@0T9  T04 0R/Q T: T% 0 \/RT0C"/QT 0C: B0PU0P!Th00pX@@PP B04@@0/S$@@@@@O(O OPA-MP`w5P0PC D!0Cp0 0 0   ! 0b0C S0;.-,+0)('0%,pTC0 0y0S@` 0S 0SBC0"S D6#@0Ѝ T1r0:1C00Ѝs &@-@P6 0S/ 5@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0A  T B3@T@!@@4@0/S @P<,-DM0  000fp 800S DЍp@-`P(p' P@ 1Bp V U phUX p` vspVᠯ@H0. Q?o?o 0@-@c^?c(0C^# ^ P@`c5$pC&5'&`c 05D0c 11P!  "0P;: /@-  005D 0-0+CP0SD 0@0KE0 0/0E@- Q06 Ϡ ! 0P Q/o/o A-@@bT?b( B"T& T `Ppb6B6&pb376U8 b1210S!00#!/!.1 R 0;: /0@- 003D  0+C 0/ A0C@- Q J@ @-p A J@ @-p PP `Ǯ@-A00p@-@PP  p@貮01 0 ?l ?0/R//R/?0S/R/P/R/p@-MPP`V @T x00@Ѝp :   ep@`$ =NN 00 R ⪯8N,@-A00 0S@8M51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BPPX `2 @9PPY  @A-`8 41Mp,0P00S9 @200S ^@#@3@,,C000RP0  x0 0 2 30ߍ@P PP Pl(P0$08iH ixhO-PC 0C,0P(  E Ϡl b0,0 W0 00 000ZW 0  O0 S0pP( 0 0 0GWp0 0<P(0P(PW%Sa7 , l,+,0 Wv>C 0C0P(P 00 0!0W0G P(,0 ,0$I"I/A!b!b0C 0P( , 0 Br0 S>P(P)Wp , 50 P(W 0 0 0W =0 P( WdWp 0 ;0P 0 p0 S 00W((Pj0 0P(_c0 , 0SP( 0%!E0?d"c,02#,0 02 0 0 000 0, ,  ,00C0P(J 00 000 n1, , m W,00C0P( 00 0d, c0 \P(\(P000tW~ 0` 0 000 0DP(2 m  RR 0s$ @p 0 @00v 0`` K0`b 0$I"I/A!b !b C0 0 B K P@US ZSQ, @ (2P 0B(0 R0Y  R0O P,[ %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 X!  !1  B00,0DSd0,0&0 40(00N~0 S(0| ̜ |@̜L@ `YooO`F_O  OG @DV@ 0 40N~ Q@ `(0P 0(P0 0g , H| >(PP @ ACLCq| \^JS S  00S3P0S| z H/o("PzXhsX(TQQ] ppp@*CQ(!0 B ,##PpA (' P%!E"ad2c;S,0<2#:MP P(P @ @C>0P( $(0  @ 0 @R ,h2P 0B(00@~0S{ 00@w0S 0@p r,0p0 0 0P , P(01(000C.$0V 30a\Mc^ @P$` @P$`c   0P , P(0q0(000C.$00 0-# p  0P% , P $ (0(00c$00M0 00ЍS$1A-0Q M@HPP PM Q%d1 P01$T G@@ Pp ʵ. R! v` P|U  Ѝ0 P0  PgfF ` La `[U+;T 0 ЍX  0 01;0060 |tD5@-0M@ %0P 00Ѝ@-0M@60P t00Ѝ@-P@p@-PX!pT10M `@00,007 U?    P00Q Q Q : 0 0 0 ,0 30&0Ѝp ,H! ,H ,HT0:P P0 n8U80;4 40 d8\QHP@ d  <p@-@PP U 0DPp P @pD07@ @0 A8U(08$ $0 78 p G-pP`' X/ Y @L,VP0PES  R D PEe!0V R  SS0@0D@ D0H@ @0 7X(0I$ $0 7 ` R@- 0BAs @ Q0C@R 8@O-PP┡ Mp U WC H5@PI g6PI  5p`M +0101S Y]6 Ѝ0i50P@P5P- 0 0P +50 0 8=00 8l0Dh h0 |7490080C4 40 l76Mp DDX @-RQM @PЍTT }9@#Ѝu9 00G-`-p!p1@ MP0M050G ?PR _pJ @\C^ X0p00 t0 O00 TV8qύ@0ˠ (, {@P , P |0 0 5 30ݍЍX0DT T0 6 900@900|KHdK`J< 00- $  M  Ѝ{I$--M  Ѝ Ѝ/ -- M0 08 ЍЍ/O-@PℒMp ` X X00?W.),00P @ P 00 P ! !  9X\3?OP7 ,VP W[ [p[XPVppP1W` A `f0`0 `<pPO P004!01 00Q. ЍC0 P P00?. ЍȰĀ0 0 0+6W` 0 !6`x0?t t0 6tpP[ pP `I<0x hh @-@ M-(0S2 +0 (0 pp1/qpP`0)  0 0 PUoR <0PUo- ЍPPT` 0S  0CPo-700P`-@-P Mo-(0S: >+0 "(0 pp1/qp@`0/  0 0 @ToR <0@To-1`V ЍP@T` 0S  0C@o7T00t-700m-p@-PPE 0eBS5 @Tp E2 Rp00P0 P 0S PcP0 00( 00 0 S,P 4P 8P p@荦L0MH H0 !50Sp(0K$ $0 5H |D Lp@-P<@M80@`ڧ(000VЍp@ЧB(0@- M4@40@Pŧ$000V Ѝ0@輧TB(p@-4@40@PᲧ$0W@᫧pB(A-@PaM`[ 1 P0p00S   0 XR@0@  SN `@<( \80C0`HS40 S0V^,*`N^(^& N0 Qs0\   "V ^ #R.S @` 0A a 0Cb@0@ЍD0F@ @0 g4 "^ #R`Al 4  R  *4 8/" 0X\S 040:8 R РS /wgxBA-Pp`26P@P@0@D尀 U  z t?p@-P`@660 A-pP8`@P1 T&  q0 SSS7 S300v S(t#f[*7|'|0 3h7d'd0 3P70000E00$00 00#R00 00P;R cPf`rdP Q1    R0 00 SdP \`6 0100 R =R$ R 0 0 60000   0070Bs0 00Bs0 20p00BS0100C0f00BS0100C0V0?V` 000 S00000M-V00C ^Vw00>00 l 00Bs0$ 0W0Cs0 0 ( R R 00# 40000 R P 00B70B s00 X0000 L 8$ 0W0Cs0;R 40000, 00C1 0FnS onmlkjihbnZTPJvi`ZTMH\F;%o#00o%0F?o2300m&0F?o24 00f=`Foob%d f 00]!S 1010P0 B0 0O00L 0 0M 0 0H 0 0C\ 0 0> 0 03000 0 01 0 0, 0 0' 0 0" 0 0 0 0cPcdP{B0<00PT00> L x@ < أ  O-PR M`pE VN @[ 0  0H\ #+SC  0 [ ;P1 XD00300T 00 !0 0/1300 Ѝp }l0l /01VP L0L /01XH00X   t0  00  fA-@ R`PPo /.#C=1"#BbQqU? 0S$ RV 10 R RQ 2/!1U 0000( 1/P p $@E 0081003/P !p0  $@pV00 p00 R (000P3/P! Up  R  SVp   0S=ヿP00U |(xh@A-@ R`P Po / "H0#BbQqU? 0S$ RV 10 R RQ 2/!1U 0 000( 1/P p $@00810 03/P !p0  $@V00 p00 R (Y00 0P3/P! Up   R  SVp   0SP 00U 84$G-@P Pd$`P $rp^t F 00 Rc</.#C="#2caqV; Y pL-PY` $00100S p  \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(㴽P`0003/P 0| p 0000S=XP00~00@`G-@P P#`P $rp ^t F 00 Rc</ "H#2caqV; Y p,PY` $00100S p \1003/P00H 0 $0(100S100S& p3/  000``0S 000S( 3/000(P`0003/P 0| p 000$0S㼽P 0$0~00tl<8 SR: G-P0p`00S 3/0Y @IOP W T0 0 0 0 Y @IOP D TT0 0 H H0 0p`P   /   h <T SR; G-P0p`00S 3/00 Y @IP  T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /   H 4 A-@P Q P`\Pp?@P P`V 00"S 000@O-PPM M Q@ \ /\H  P.00 c"P;/\p @ @1 D\0 _ `P /RR.\'  B Rj/0 FP0B/0E   PpU 0: S 9S0/\0Sl@/\` FQ .PQ[ 0t/SW00L Up# P&Q "  RD .*/\ \p[ 0/ލ Ѝp` @ @ @/ [? 0 /    ・P @V/00 @/>00 @/00 @/?00 @/00/00p@- PHaM`=  !4QP00T P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  ]/ 0 @x$ p@-@P`P3 V( 0Pp:P@ P0R P:U P0@Sp P P@Rp:UR:Rp@0< <0 ,(0$ $0 ,Ќ  00/|p@-@PP" U+ PE0R R:Q|Q00Q0S"P0@|R  :RRpT P0P 0 ,U4 000 0 ,pċ  O-M MP t( 0 pd800D40g 0Sp 0SW t4!S S XPP `P  NpP 00S `D R"'  ೼0 00 Pg 0t0P0s` P `@V 0 S( [T :SZ \S S S 0T:H@DP V@p+ <P P`0 S[1Z@#QQ -P\6@0`0S0@VXD0A0 0p&6 0 D4 30aݍ Ѝ:SZ @@DV  00 0S m003@ ⩹pP9 @8\5@00S0 @5p0(`040,$000= Pw 0:RL P0Rt4@<0 0 E0$ 0 3 30O ߍP0GP  P0 B 00R 4$0@D 0zSmNB~|{ayxwvus1jh|c_^\ ZEU0 P 0C 0/PE 0SF0 0C0000 000S0  JZ l9P0P 0P0C0S0000D SK*h0r? ,0R$ ,0p Jp4(P8B @Q zzt0T @p0+ZFp@ @P @T0C0@0@  0SP 0 p0 0@0 @0 0CP/0T@0(0(0S0I =. #RR 0T000C0 p0 =. #RR p0T000C0 S{P P00050@D }1T@!@r?,0@0 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Z} @ 00C0Sr000@T@0^S XRl    0, 0     < :  00 0@0, 0CP000&}   ,   S|@ @pxp& ZʱZ|  }<68&80 !Y 6&0 !Pz iP @0mP0P p 0T B 00 RP 0 P0C0S@R$0S0  @ p40SP80SW|  P80 B R0d$0S{  @4p 0ESW P 0 P@0C0Sg$0S0 _ @p0 ES PSW R4pp/  P@ B R$0 S : @+0D 0@0C0S$0ZW @ PP 0@0C0Sl  $0 Si +D  P@AQ$0 S @NTK 0Tm P@AQ^$0 S @ XQ[ P@AQ$0S 0@40K0?$0r?,0ZDp0p00T0P0SZ 00 00C@0@00<000bSD$00100,0H00T: Q P =p0CKr ,!0  `p P p p =>3PS (0P@DS$00$00S:P [$pWO (0S0 00 0 P000e0H` `` |x` ĔȔ_ \[ t\dP J 0P 0P 0C0 SP ,^Z00$00 40 $0ZC B@(0 0 )$ =.$ @p 0#A(`-Qs ]Q @d Q= 0(0;00<0000000900000 000:0090 000:0000z09000s0   O  0 PI PE  +P=  P8000;000;0H00D PfIT00p0C0S 0(P@$ S @`P0$ Qv @ PWFTQ dQ<WWpAQ@(0,(0PW$ RT iT nT00p0C0S 0(P@$ SK @PD"AQ>p@AQ$ Q@0* NQ-p@AQ$ Q@0h (T@@P$ Q@p )T00C0S 0@$ Q C [*Z2 Z00,0@pT 0<0=0@, 2 l00 5 00S @0SS 00 0 WZP 0 P@0C0S|$0S0  @Z0S B(0|P"S b(0rP"S `0P,@p0 00@ 4p\P$0Z 0 P@Vp@p =. #RRf  @T B   @ 008 @0=>03SS1 0@T0C0000@000% 0S&P @W pA 00 000PI$0SF 0@ P?$0S< 0@@pQ P'$0S$ ,0 a_0T0P0S0p0C0S 0@$ R   P80 B R0$0S  @4pᣭ PZ 0X  B 000=>H0Kr `0fp? P p ᏭPZ0@DpP 0S% p(0`0P,@!00p0C0S 0(P@x$ Qg00 ,@ k00 jP [ 0@004( P]U ܪt@ 80 @P80P( `4 <( ` V   v@P  PP$0080@$0 BC  (4r 0 ʫp> P.[P@DB 0S+T `[d P $0S @ p@D00P0T0SpJ0000_p0SP Z ` 0@00WK[P@D`$0 0 00C<}TH }A-@P`p^0 P00- $  M  Ѝ$A-@Q(R`PY v 200S5 30P1S010n L00v`0P! pW@0PJ .PPZ 0 }0 0 C `C000J0q Q  Q*RQ0 <008 @    B`0+0` 0 P00P0s0 P ;0#B0 B0 `x^F ${p@-@P L~Pp0@-P$L M`T 0S pW 0 7/@P  Ѝ8084 40 0p@ ЍypE z0M 00 0ЍP$0A-P$LM`pT 0S $X  0 8/@P Ѝ< p808 0 0$@ ЍD \y,y0M0 00Ѝh$0A-P$LM`pT 0S (X  0 8/@P Ѝ< y808 0, N0(v@ ЍC xHx0M0 00Ѝ$0A-P$LM`pT 0S 4X  0 8/@P Ѝ< 808 0D 04=@ ЍB xdw0M0 00Ѝ$O-M@`Dp@PZ] UK 0TS$Z0 0S- [* 0 ;/0S5 $\U 0S H[ 0 ;/@PЍ 0 0 0H J0 0h 0@Ѝ0$\d [`0` 0 0D }@0@ \ 0`A Twu0A vu@ vPv@ v$v(@- @MvЍ$0@-P$L M`T 0S 8pW 0 7/@P Ѝ< 808 0 R08pz@ Ѝ? uXt0M 00 0Ѝ$G-Pp`@t@t0@p@ ᓪU  ቾ@0 ] ဩ$ ‪yT$b80O-$M`H0 k 0P 0400 0ʿq@Pp00! B b07<  @ BU^PE @ 04BL3@0S i MTRTVMTSQPONMLDCBA@?>=<;:987654310/-,+*)('&%$#!  h^0DS13b0 d  P 00Ds0S 0S0 S  \00T3`00 01@000@0@PUc*$Ѝ@\ M00 ڧ P- R@ ^^? 0 `0  ҧP 0J ZS0 - 0J ZS)X1 0000 $Ѝ 0S0 10000) F0' 00CFs0S`0`C F F F F F F F0\  @`\s\0\a\b\t\n\v\f\r QA-@p`P yP=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 At  A-P@p`P .T T!0DI1(0D,TS0 Ar_T $0T"@%0 !1 į O-p'7WM PP 0瀁0T10h7儡0,01<0 ?oY20S_Zg Yo y @0P 0 b`0P(0 [080{ 900` P0 $0T6  P$p0`0@TP" V T0 1 #P0?0So PzP P6&0 @TP 0倁PEEQ U@1 @! L" P┥pP Р  00S  U L0 G0CPQ  X5* 00  R  45' 0(0  R 00 00 00 "00@\0000 Ĕ T( P(@T$ 0 p9/P00( 8X$44 0 T1 30 Wߍ<0S`<`N(00(咦 0S@ 0S0 $ [T (0PDp0C@ 0@ 0V 0- p004O @ `5`p000``\`VL `` V*0@L30|:490 ? 0, 2@0 D0R$ "@[PpY`* @ R00S0Dp<00 SR00<0`|(z xt إPp]0 S2 " 0 4p`1!0 Z1!0 Y@ꠑ )L 0 ᰥp Q 0S 0S& 'H Dp00_P+ 8{ 1!0 R~p200/ 0>0 0 q 000z 0 d0p80<HdmP7 m6 l6 tpi,3 hh2 hh2 hg1 gg1 `ggx1 ,g@- M@ (t@0@ 80 0P@ 0 30 ЍH@- M@,  (00X@ @ 80 0P@ 0 30 ЍTxH$p@-@QM`P0 6 0 `PЍp0@-@RMP0 " 0( PzЍ0-M0   jЍ-M $[Ѝ-M ($LЍ@- M@@  02D 80 0P@ 0 30 ЍhHz@- M@( 0xx  @ D <0 0P@ 0 30 Ѝ ǿ  0 0  P ! @00Ds \a0DSW0DA0DS"70DWUX: QP S \ %P"000TB W. 0 p 0U00S 0pS 0F0 Ѝ0S U @0` 0  0R00  Ѝ 㙉 㙙 p噉I㙙A p0? 0 d XR 0AA B PR W `@Wp pn, 0M0 00Ѝ5개$2@-LMpP` @000CP LЍ`0 ULЍC-P!M1M `0p00<0:! @PX t1 0S ,P(3  ~  |{P* n6s0@R P $PPP) 0 0 < 30*ލЍ u>i?F㨀R 0 P P0nS? P0S  t@q5 P2 P0 P(}(e6' P H@p@-``@Pzp  @Pp Pz Pp@-@P @(0F$ $0 @& =@-M@ ^{p 0: S  yp  JЍ 00ЍO-P-$@p,M @el300P0`S?o2`k$100 Pe0P$0@P 0 U  0 *W 0@IPP@ 0\ zpPE P@ 0S` PU{0 H X*P0`   U1` T 0 A[ UqPPt X`#: 10 001[ 0` @0 0WP @ 0 S 0S[ @yY8 0@D@0@ @p$0Z,Ѝ0 c00 0$00S$0d`0͗P  000 y ypp{  L0H H0  `  @4 9p@-P " @T @T0 0pp@-@PP U  p@ D0:@ @0 U(0;$ $0 09  4989 9O-`P MPp# W+ 0Y 0 eV1 1* @ 7/P 0 T VK:0 0S0 ЍD0n@ @0 X W(0o$ $0 N \8 `8d8 88O-PDMP@4R X[ TU# 40000Pw XV 40S_ U00`04 0E0 000 `8/P PPZg*0d 0 0p`  pQ`(p0 p$ ` p V 8/PU `Z0$ (pW*`p `P@F 8/P00[ 4 00[@F @@ p0 `V: @ PU0 0[:K  8/ P 04  K P%Qp`00S 408pp 0[0 P ` 0<  R B   ` `\ F  \ #RJ b,P0 08/0 P  P PQ`p08/ P`V P W0 S R U E BU   30 Y  SY1: b,P0 Q0S 0Q0A 0C 0000V0P  0p @40SU |DЍ04 0` @44VU pU G  0 Z 0 pp SZ00 `R`^p0P @@p UQ` 8/ PPp @0T5  1 `105 *p P8/ P`T: `0 S PPRU U E BU   3 SO B U U PE P30 @ Y 90 @PBU 8/ PP  U0 pE a) 8/ P `p PU  0  B U U E  3 LS  S* R \L0L0 C 0Q0 A 00 B \L0 00<8 0pS 0 k`00p`[U0J`d` pD S`V0. w0  0X x0  0 "0 0 40Sp #l0l  0  @ 00< TM. .`. d.8. <..p@-@ PU 00S  RQ Qpr0P 0  P  pH0H 000S@-@(Py0(@Jy蘈p@-PPM`% @T@T T0 Q 0QP ``?0`P 0 RЍp0i 0 >* 8,p@-M@Pa`0S$00700 00  _vP( p$ PQ# 0 00CR U 0 S R 0S$0Ѝp%00 `$0P0P 000S@-@(x0(@x4A-p`@PP0 00S (xP   (x0S sP   0S `(sx0S`ą0@-@PMP # P  0Pjp@ @Ѝ00 SP(0<$ $0 i 8 )``1@- (M0R0$00< 0SQR@ 0SRA!0 0 $0 305(Ѝ@P0@ C  (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@6BH 0PX@- D  R4    xH@4'@-@ @@iA-`PpP@p U! T 0 F0PU 000\ LL0?H H0 U00@, ,0  h& @&000S x0m.!D900 /P0  \0\ 0 /&8''& 0 0A-Qp$_K aNCHO@Q0?H8c` P@R\0 0P 0 pqp@@T p!  P &&%(&p@-PD@@ w0S,000P p@ w %%$1A-0@Qp`P`FR  v R%100 UNUd!0` p000 <0 v?UU'U9? 00A0A100 0pP0p0P 0\  B0B10< l0Yh h0 T` v| l%$0%\$$4$$#P$" "0#@1A-0@PppG@ `< p@aH XD0D 0 [, W(0( 0 Q  pp@-PP@' T Pp `P 0S S _P p@_p\ xX0X 0( @ w<0< 0( 0p@/  p@-@PP U  p@`L gH0H 0< U, h(0( 0< @  0@-PP M@ T# ^P Ѝ0`P 0Sp0 0aP L0L 0L T0 ,0, 0L TT ( <p@-PP@! T* 4 `F0S pp^P O`P f^P a^P p@[^X T0T 0\ xT8 404 0\ m L   DG-PP@7 T@  R R  `V V  0` 0 00 `V00!`V | 040FS62-)%!  I0 0l T%p堐p 0l  R R 0  ` 00 00 0000 0`  @-/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0;< <0 (0:$ $0 } @ C-@!P1pP M`0030P TX A< WPY `YU o0S d!\1 0 3 30Nߍ(#@A R R  R ,P0 Z R   ~ p0Sp I% 0 00 0 Tl0h h0  D  S 1DPHO,@ 04 8O-IM,M`X$@PPJ L4 pI 0$000 0S S  $I3$ 0 0 30Iݍ,Ѝ RJ- Ⲱ RW#    J=00h_ Ip# ỿ{0 J- 0S 0S? S# UV J=000px J=00Zg O< WP 0Sy 0SI0S  0S0s S0S J=UV0  03?"R #< zJ=P0h0 I<0I I0 I I I C0 P ZJ- 0S-J= 0 @S( S DJ͍0 ?1* 0 0000H0,0RP @(& 00S_LP P P J=00Z0  wVPiJ͍]P` NHMн h( O-`x$@t4M Q@p0DH 00010P0CS+H5('&%$#"! DQWX000S R  R RYf|#t3 0 0 30ЍTH30030H 0 D@pЍO{QWX00VT]WX) 0? s0" ੆pPJTH0S0S " ?s0qDPTVT00 4"0 ႆ PX: ;P 0Sj!0 lT@@O 00!0 ]piT 1i #Ypp 0XXPT1 0pY@D 0   9T00? YQP쐟0p蠟P0 ppW@D 0f   T00? D P|TypdX  IHHdHlD` LG-`!p1FM 0010% P@p 3P  RW P Wv`ov` 0@Sp0 0 0 1 302Fߍ0 0000?1t 0 0 0P Y: /r RX 0S P 0 R]DHCA-@ 0P`p0 | 0P jp@-MP`P@@P@T 0S  R0S @HPPЍpAP PЍpp@-@P ppPPp0@ 0 X p0. SAA0Cq .S .R Q P -S /S /Q P _S 0 S@-FRB0\R 0R: @PTT 0S`[ DDpW` UZ ^" DPD`V` S`" @@@0T\\ /  R 0 0 0R0C?o20SL`V0^ R 0\ 0R 001 S0 S 0R U ^( D@D0T 0U ^^U ^ D`DPVS` D@D0TS 0R0Sd!0@-$M""0  AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP 0PE@0S0S 0S  Ѝ0$0n 0 v( \@-PPM@p` T Q Q Ѝ0SS ЍS 0 0JPPpW0S S |  0p00S SH0 P 00ꀬ Ap@-PP`@ V T! 0pᄟPpx t0t 0 VX T0T 0 T8 404 0 8 d d8  O-MP |@-@ P t0  @0A-PQ@p W% `P  0000000  ;L H0H 0X W, (0( 0X d 8 ldO-`8"MP02 D0 @p00000 0kP0S A@@@\ ST P-  OP @!x1 0 0 30UЍ0 SRB {P> 0 3@P30* 00S PMX0 SR UP 0  @P 0 00S Y@P @@ L@P Ꙝ02Hx1DO--St. M0h>0020F 0P ؐx@☀0" $ `* ,  I D H   Z9 0S0S ` 00-= 0 2 30Qߍ0S0SP;0S^01@3> `8-4=4  ` 0 ` 0`V 0 Q ,0 ^ 0S 0F?oP20Q00S0S  00p [ Dl0@|P`p`p ``  Cc 0c0P[ 0S  0?S 0 c 00기 ` 0 RSS0 0 0`P8;`0p0(0 `$@ pW g972 G52 0W00S   S  R  R Q ^   ^) \Q/o" S] R^0S' 0 PtQq )0 @ 0Si QRe 0pS %0P,0 勛P , 00 B ` 0PpW ,00X ,8 I Ly\P1x00x0 x 5{ `p P@`P P0U 00P"{T0P{O-PLMd Ym رPQ0 @P C   `P00GPI 0pp R R R0 T@60P p R ((0( P00 V pWpW 00  HpW0S 00SV$@LЍTT hP0P 0 BY4 i000 0 7tl` t4 `G-XM`@[P pPP@0 E0    @ 0VP 40S0- XЍ NP gz%  09P Vz8<8 -P 4PPU 0 PO-"M2PPb 0#S' V0P# N0P  @ 0S S S  >T  @P xP 0S00xP $I$ (0I$ IP 0(PUPU) 00   FP 0(00{ P0P 04 0 0 30ڍ<Ѝ 0(Pp l0l 0 /ZkP L0L 0 $a\HxX( P@ LA-P(M@p`P D  { +P @PP w$0S0(ЍO-`-Ql(phX MP4M(0T8,0000&<<000 (0S 0S W &C<0 `:0 0SP0  03/P 0&,`&<808 0 SS0080R0S  RD(՗uPUI [ 0F E4,$0@$0   C 0S@P0  0 3/P @ 000TP-T`*TVz80Si UR &<800Sl&<800SD ew!`P E0/o"SQ]EoᩒR,0S ID0YP@0@@C@<0D\< \^8 @0 C00P4 0P00,00,0&S> @$4, 0 0 30ݍ4ЍS00&<800Sh &<800Sj  E'UR!`x [H]40@[,PH Zs <0pH pZCNP껟h`Ip  xZ2 0 00e lP $@@r /r @0S S000 P0S wZUK <0LE0S/ PS00}Uz UUU, !U U6D v!`P!E0oᩒS  R E/o"',20 00S w$S00PD (0R $<0.ARC@@_D0z/%x^0@SOt00S000/|!x1x 0 (0SFX!T1T 0 0S=4!010 0W4!1 0*D0xzO4 00R`P0  03/P Y 0R0 0 `0D Hh 44   X , DX} 0<0.RC@.&<80@`T (0 `@%,x0  0<(5$%0 5s ,0S` g]RP ZRWRzO4 0 0Q`P0 ! ` P EuP $y4 0R T4 4S Q 4S 4040|QP|4040S 0R $R R $R 0`fsO-SM`$0P4 00D10tpP tP P$0Yp 0   C8000SX Z 00,00Q @T 0 .T0@T RuS d! S*0 u DD@Q00 00000000 P*0=S Q0S Ss St 0S 0 P0s0S Q00vv%  P 000 P @@PY 0  Puu@8"02 0 D1 30}Sߍ @S @Rd! S1*.T 0 PPʵ*<* 9j=2+X |z j| J3**?J0VA$Kr~A$16zA$0*4*({4~!"r%kz!"1j5r!"7j5 Jva&)C*0V7 8N,̅0  0! B 0%a0(@0#@,0 L7@ @$௏@|O!dE #.2* ㇇Dta& ,80Jlʎ$ !0 FO8 0.00#,0H IFc5p 8` *pa& 6@@!GDKHꬃ@ @  .x)HOLn # @*, $x \Hǎ @: @$"@F .dE! , 㘽O   * $yJj  .$ !!㴹D  ,bE ,FOlŎ@@ . !@C @@L@ @,@` @$ @Q^BK !  `. ધ 㶩Nn $ , ]/MlƎ  .! SD@ @,@ @$ @㡨MK ! . ȫӧNn  $ , BlƎ  .(! ֧7L j@,@ @$ @դOK ! . ZDn $ , JlƎ  .!  O @,@ @$*H @٢oF K !  . n$ * BOj  , qHlΊ @. @$ `@"FJ *., Ojn ,! D㾤J  $* Dj `@. @$ @`O J !,p KlȄ* .8`B  $*$Nj@, !@DM@ @.@$ @@ dH*. 9 M !,( ۦN lΎ$ *Aꪌ @. @$@eLdH ,!D)O   " *Db-  . Jl˂@ @@$9@ LO@@p !I[EF@ 00@0#0@, /H Jc= , }Ob+ . HȂ !OF<@00 0#0,Oc=   " Jjb+ ,DȂ !SO`00 0#0c=@5:K0   " 4b+L B ,0Ȃ 0 P0## +N ` H` 0UDP  DTЍ@-@P  0 'C D00, ,0 #EgܺvT2g \A-PPp`5 W) 0!Ӂ00@@h00"V>0: 0hV@Hp` 0S@@:p`F AH D0D 0 J, (0( 0 @f Pf ( ! 1 p@-`P0M@0 00' T0 P  !7R8 bx b(   0 0 0 30X Ѝp@` \0\ 0 T@ <0< 0 )` H8f e e LŸO-D @2 M<"0 P00p  `. 0\ @ 0 XS@@|[0 C" T. .0N|0[.\'^V*00[P0@^*0^0 8< 4^*0 8<ꊌ H  - MaP ЍDD!@- 0(M S $ A \/o"S R9/o"S R L 0 0 $0 30)(Ѝ@P @ B  (  0$\ S $ L R \0  R ( $Q C ) H pb $b A-P!1`P rMp00109 UA @^X0pA00tAR0OR00TAV 2?O 0mP5  0 wpP& 0@nP 0 0 1 30 rߍ0<| |0 Ud0=` `0 P n00P 00꽋 H4 o` Иp` 00- $  M  Ѝ` $ -- M0 0x ЍЍ/--M  Ѝ Ѝ/p@- M`y@P @x0`0P0000 @X@0@8T  Ѝp \ X1! @-`0M000Op P@  + LOp CN@ 0 0 0 30*Ѝ5NPpW @@T PU 0SP@?T00@600  H 0p@-P0@ 0p0*n(0P'n(P,P#n 0\0PP 0P 00,,&pP 00p`}H 0@-@ 0 0q 0  0 0  0 0 00@-P M @0m 00P 0 @?o02c Ѝ02 00 0p@-@P 0U0 0pp@-@Pm0PPm(0Pm(P,PpO-P0Pj `Pc @000 S S0 S S hpPR 00 pXpp8 $@P q0p00S S S@ 0A S  A 1 @P 0S 0000lP 0 lP @@yh`@  @-p0 AM@M 0`$0 40 0 APP0S @ 80 0 4 30AލЍ.ꥃ Hh 0,@- M@ p  PpA`PP 0S <0000 Ѝ00S.S 0S Ѝ24p@-Pt AM `0 0 $ @P 4 ,0 0 4 30AލpWh H$ p@-P@`Q  @Q :ePV 00pV00p@-@ M`pHPU 0PU  0\W 00 Ѝ_00P 0`kW00 Ѝvp@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PCV00Ѝp vx0x00@-M0 P 0QU:<Ѝ00@ ,0@P0Ѝ04 upuQ(00     | 4|0|00@-M0 P 0mQU:@Ѝ04@ 00@P@0Ѝ0` `t@tO-M%M8 稄 |$ `!0,05@@R@@0T@0n`5dPc 0 0p0/40 0  `h@D@D<0  Pd, ?oR20S 80`1 PYh0Sptp00U40?P0 _g`Y000)Sa LT0P P ^ )0S >eP cP0 #3 0 |4 30ݍЍ< 0 g0S ,0SV80`1   f  g#2 0 |4 30 ݍЍOFD 40p$?0PrR(fU" H "P`` \LTX`@hf@F`DV7xT Რ R/Or t@4 Z Hf pJ J f T0 L1@ p 0JJ00 .A) Tʘ@F`D0 lVP`TX\`@.\0  ]Z<0 U 0 O1d`0 `ppG pG lfT0 d`90@ p 0KK00 .([Jep JfE Ht sp-ps`rhr Trq qqqqqXp@ppoo0@- M@ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@ T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPonnn\nmnmm nmmmnmHm$m@mmlDm0@- MPi O@P Ѝ0 0( 0P Ѝ0pf$0M 0 00Ѝꄾ lO-lM8@p  P_씟 PH0 0 ` 0 0 `1$,SḤẴ0  T44 04 @  0 e`1S   ;`1S0 0 0 P0 0 P P0 0 P0 0 P0 0 P0 0 yPy0 0 nPg`1SIT,0Lb` d00 d 0 d 0 d`1S% d0 P 0 P@0 P0 P"000 lЍ M  "Vc  VdlЍ 1lЍ0 D0 0 ~0  k0 X|0 Ed 02L0 4 dkk`jdjhhhhhlhLh,h hMp@-@ML `P 0 Q@0P0<00 0. 0T @D }G000T H0 0 <0 30 @Ѝp@Ѝ/T.0 2~ Hgx O-MP`@PP  p 0 Q ЍSr RSPP 0-S  0+S  0x# P   00C2"0d  .S 0 @ Tᘀ@@ ✀(P  S #3 @ P 0RQ  S  # 3!# 0T#+<'(0+8 +((0'<0'4 0(< p 0(4 000Rp 0T  @ P  S #3 @ P 0RQ  S  # 3!# 0T y 0T @ \  S #3 @ \ 0RP  S # 3 # 0T L0 0 N 0N 0 0 0 00J 00 0  ;3 O-@Q dM0 R  @2/R>03?1|gO" \ ^mnb`AS N T _.((H<S0c&sf~e~rHpl W E P -b AE#D((H'ᒾ  L>c@L<@<0d0c@02gࢲ"X ;ky} u}q}ZX 0H Y J XL ,0@000(0L04 $0\0H p 0P0`0<00T00D0BZ 2`Y .`X *`dЍ @A  \ @R@0@g x  0 0dЍ@0Y0 0X l(al`L`dBPB@B@-@P$ 0D .R\0@*S0T .S@@TH D0D 0( nQA.@S@@`$ __p@- MP`P`@\ _0w# x'w000 000 ;7z $  `Pc Ѝp l0_A-@pM0 p`00 0SP Vu 00Ѝ ?P|0 0000 = 0o"P50S0U0?o20#S0 0L `^A-@pM0 p`00 0SP Vu 00Ѝ P|0 0000  0/"P0S0U0?o20#S0 0L ]p@-@Pr00C0S S u P 0` Ppa`u0 0C0SpSr P 0 /a0@-M@  000400 !R !PnЍ0p@-  0S0@Q0 R   =0H04S Ppl@Q0R Q    R .Q  hHA- @@P`p0p0 A h 0 0X괪 C-P0 M`p0p@ H0  D@ <8 @Ѝ 9ꌪ hxC-Pp0 M`p0hp@ (0  9@ Ѝ 9 h0 00/d h0 00/D h 0M 000Ѝ hXA-pP0 M@P`0*p 0 pЍ h0M 000Ѝꈨ hxC-Pp0 M`p0p@ (0  @ Ѝ A9X hC-Px0 M`p0p@ 40  0 @Ѝ 9Ч h<@- @  $M0 ЍH hH0H 0p@-@0pP p@S8p h8- , M $ 4  Ѝꠦ hD R) p@-P`@V KP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0 Mp@Sp` 0T 0C0 ЍL0H 0080p 07/0 0 ꈥ \]]O-Mp`@PPMWC*00V>:Y ` <1 80 ppp `0 P P-0  0P%Z p `0 P0V`F0V0S0 0 BЍh0 pP b0`00000Ѝ`(NT]H]HM\ \\LO-M 0|?@ 0,0=L 0H 00=000$0 vPG 0S@ P=P 04 H 0 M7P000 0Hk=0P=<0 y@PU *, ?0 00t>0;/ 0`(PExHk=0`PD`ZP "0>d 0P W` 0P P0 0`"PyYY~ 0IS  B?fZi4fhCO\~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ,Pr R 0S .S 0S 0S00S.S-d9 @0- RD) 89d @0! PE 0D$0 SaD0C8^800440PJx@0p000$0 0C(0S0`0 @s<Y` @Dp 0 P(0ST0 P 0 0`P8000#808, 000.0 r  .00Q! A ]P0 0D$0Z: 0@H+B 0?R0S \'7  0 0 30  ݍЍ0Y =00S>-7 0@\-6 0@V=00P040H00!P@0 00B0P00x& @p6000#80X=P 04 H 0 P4@4P4 @0@PD;2 507!Pd000040 C0wPY 0H@ 0RJ0Z0Szh%%d5d 0T p=00Sm4 @0d  D;50P`0  P+40 CP0`@P"H40P`@C< 8p 0P`.P|0 P 0 P`P(=00S$4d  0X00X0 0D30! ZP=P0 0@C: `PE V ʔsVp# P@20 ;P0TE0 02P00d0@D0VV!$P2d 0 r! PEp`$P0 ?@P 0 D0PYX+ !$*P$=00@C<204Bd 0@ 00;`0  Pe0 Pd  00D(0  PT30d  0  PEpDW \Q@P0d 000  P/ 0DK0S3Y !P! D{D PUi `p`0W@G1 0ES "x H XVV@W4RPRTS$SE~DR OOh?p>=>>x=<\::;;::\:9p908l8=00S2P@2 `@DK <0d 0 `P p 0 PGP: @2DK pLQd P p0 V 0  P@2DK Z0d  C0  Po20d  D; 1010  P]40 Cp0rPT$ PD :@B Q P` Pp2p"0 $@ 0ZD;: T! P3$0 @C20+Yh =00SBd 0@ 00`P0  P 0 d 0  ~P 0@DK$0T*|S$` pPTDK 0d 000  `P +@0W 10"3# 00;@0000;@020!200;@000300;@0S100;@010 0;@=0;@! +P 0D$0SStp@`T Pd0 U`  R @ Y$ "0d  Y! P@T0 +A0W 10"3% 00;A0000;A020 0;A====C; +@0W 10"3% 00;@0000;@020!200;@000 0= +@=-;@>@ C +A0Wt&1 00=-0;A>A C0==C;u40 C0BP$ 0DK$0SvPp\) `(PP 0V  R @0 Y$ 0d  0  mP@T0=00!V5U5E?C0 S!VPP`1 0@* *JDK1p#00Y,!=Pk=00S -`8 0@^40 C0P 0Dk$0PCUQMڸ@p@UC1 W2 '0d  ^ 0  P=00S -D9 0@#40P`@C< 8p 0P`Pn 0 Pf 0 P`{P] 0 PU 0DK$00CS @ :0p40 Cp0^P@@ 0 P8 `jDK`Pd0D[ 0d  0  P"PR0D[ 0d  0  P=0P :0` 70;d 0`P@ DK 0  nPH=@0  S!]P=00S  0d  0;0 ! IPPU pD2 $ 0RP@`` D )=H0 0$ Y@ *, |<| 0 p00<07/=I0U 0DH? $0S@P 0 P@P&(0d  0=0L ! Px=00S/@/ @@p=2 0D / `p0 PY$0  @PQg ]0 P@DK PE0 P> @0 DK P40 P0P, h0 D; 0P!40 CP0p6PD/@A/@4@( 0X0 0D>0 `P0 sP=00@CV5U5E!?C0 SP0 _P=00Sa-? 0@=00S0SK==00S< Od 0@ 00 `P0  /P0 pd  00Dz 0  P 0 d l 0  P0PD[S3kD"!$3P--? 0@&=00S. p0d  D;?0= P`0  Pg40<@C8 0 P`wPY<0 PQ 0 P`fPHH=00Sf=0@ 0H[0 #᝷T` *, ?0 p00>07/=P0@D `d @0 H[0H>0 ! P$0DY2*~`@p0p PYD V 0  hP `0d  @ 0  ZP`F@P$ 0YP !IPw@P40 C@0PP 0 5P PDK- 0@-H- 4 =00P@ l=,  00t<P 05/>@|=00S=0,0@ $<00=00S- 0d  D;0? ! PEk40 C0~P` 0D[$0SC* *J1#00 S|X !PJ=0@ 0H[0 "ᦶT` *, ; 0 p00:07/ 0- P@DH[P@D[=0@ 0H[0 !ံT` *, $;d 0 p00L:07/ 0- P@DH[P@D[ !oP-9 0@(P 0 PD[$0U:-9 0@-9 0@-9 0@y=)0@ x90x-l9 0@k-X9 0@e-D9 0@_49d  0` ! %PU `X P0d 00l 0  PTDK!P P 0DK Pb!P40@LhPC 0`DK@p0 Pn0 @pPf 0DK$0S!PYP Y`PVV wpP@᮵0 P?0TE0 0P600d0@D0VV !P'-P  %@PTT vpP`z0 P 0VE0 0zP00f0`F0TTX!lP<&E868 0T )-6 0@=0P 0H0 ?U@;*(6,  005P 05/-e+` 0p D{ P-P`5d P0 {0 P P 0 GP0 P+0 D PP=H{0` IPPV *, 40 00h409/p =0`FH{ p`0 P` 0 PX + 0 D PPK=H{0` PPAV *, 30 00|309/p =0`FH{ p`0P!0 0 PI+ 0 D PP =H{0` PPV *, 20 00209/=0 `Fp` `H{ 0PD 0 RP@ +DK 0 @EP=Hk0P @PU *, 10 p00107/ p=0`PEPPHk`0 P0 PDP<0  PJ!P`6 7744555a4&22'2(33 100`080D0,00@0////00D0/..-$.(- -+P,|+\+,+,***L*0)))P)4( ((T(8''''\`$@$%x$d$x<$T$$#d #"""""d"T"H#L"!d!xD!0!H!     =0P 0H0  xU@t*0,  00 1P 05/f !pP=@!0 0@CP10-\1 0@=p!0 0@C10!PPqpP@ `PVVp qpP@, 0 3P0TE 0 0*P00d0@D0VVQL!PJh!PrpL@ 0@D$0X:62"0 7$0"@C2 00$0"@C2 0)-2 0@20!PmspQ- 3 0@ 4spP@Ų 0 PT0TE 0 0PK00d0@D0VVڬ!P<!P5sp=#0 0@C30=$0@ 40$0@C$40,!PDtpIL4L$0 j$0`$@Cd4 0=t$0@ 40+I  W0W! ##40  +I W   +I WW" !"  +I WW  #  +I WR!  +I WW! "  +I W 00;I!=PPUD{ p@- MRA T  ,@0 4@(@@0 0404040040 ЍM@-  04 0 01Ѝ03/e A-PS`-p@ W@0 V :0?s00@PU 'P׿P(00TPD0?T0S,0l( (0 PP G-pPWp:0 W/ : W/ : ` 0 PPϿ W*(00@0S  XT0 $"  P@QA-M{p$0P@S` 0(01$0,0v(`Vj0Sf(0S$P1,  0(0, V.400W'PV, 0,0\Q U/  , / , 4TP(0T0(0 SP$PQ0(00,0Ѝ0F ,P(,  (`, Q!:0,0 ?0, s0Q:$( ,00(0 SP$PU 0"00(00QA-M|`$0P@Sp 0(01$0,0w(pWk0Sg(0S$P1,  0(0, W/<0<00'*PU, 0,0\P U/r ! , /r !,(0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P(,  (p, Q!:0 ,0?s010, Q:!( ,00(0 SP$PU 0"m00h(00A-pP@P`y Un T~ V@D2"!00,2 < !Ì?Pqp PV@D2"!P00< (2!Ì?<: 0  T00 48<0T! T 0 00#2< P0"!T 0 =@ 0@  0=  ^*@^00@|0x x0 Ļ`0\ \0 ົH0D D0 ౻| ` 8 ph LO-PcMPp` U Q@< 2 @䲟 `002 ̂0000 02 0@=Q^ sP_ [ 񏐓,4U WT0 @ Q[G@Y4ЍU W= 0 @  Y 7:P0U W*@ U W0 @  Y 7:P8!Z414 0T Ѝ[ ) @[Q 0@ QU W R 0 T 0Y 0 T 0MQQ 00@=Q!\  l ` H < @$ xT D,$0P0  0/ Y \pP 0/(/ ///@-M`@pPdT@TL0 < P@K밼JX T4A-pP|Q@`PR TG 00S@00XS< 0ST.C+SQ1- !q` ` p 0000  0C` Q70V0Cs 00000   0 C R7 0 0C20L0?H H0 !40>0 00 XX t4  A-Pp@XU`* T08 @W``W 0*PE.p^p P0070 2000 S037#Q00 ^00( g$0$  0ҹ x0M 000Ѝ/U |$0M 0o/ 00ЍxU |///a@-DM` @p0 0 < 2 &0 RP/ 0 0C0< ,0 0 <0 30DЍeHU T O-H MHH0< z - @zJS% B`R3>hP>"2d'2#g# C ኡj CB*ZJWRT/X p 0 SP7[0S  P 0D00 00000S @B0?R0S2  Ѝp  0 MhP X  0W ]P@ 0D SPW p H 0 GPTX 00e, ,0  ЍT ` A-`pP0S- @T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@к( 0 $0p@- M@P00 80P k$`PFo0 (0 0 8 30ލpdP H|P 0-@-@R M00  HPP * Ѝ@Ѝ/ Q* Ѝ@Ѝ/dPRp@- `@(PtPWP0 ?p@(Ee00pPRp@- `@PRP5P0 ?p@(#C00pp@-@Q `P2PP0 ?p@\(#00pp@-P@L(P  p@ p@p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q QT00A D32˹00pP T0DS@pP p@-PP @P  T 000YiP IP NP4<@ooP <00(S ~ 2010\nP 0Z PtЍ00XS <0X X000Z<00 0S @ tЍ:QPgRPDP R R4g +^ A ^* ~^P%b^1BP^  Pi ^    ` t  nP 0 SO B ? p@ 04j K < B\ @,$ ( ` Z`0  QQK`FJSZ[h0SV|Z Eq@Pb @qP] 0 ` 0xq0Sv Pn J @ W L 0?G0jS*k&0B: H?V  L ??GRH0s0  p @oooo?oPP!    !ֶ \TqP@ p@P T Q\00`C00A`R AQ6`s (  $ wBP^  P ^ P.< ` DR+P  @b `. V(P jP8P ``^ U P L^ZkeP P?4PKPeH7LLj  @ 0 $Q0H0^"00 pW9 @YCpWKQ @<@  0@ X  X<<0@ X*0 00<0Xl 0 00PE p < 0P @d1 @R  <0 @    @ C# AP ~R 0 S$0 @B01` Z<0 080p@< p0p@ W\ p$@ @ <0p@0@@ T$@ pHXNKpW@d<@smP |o@P @oP0 @vn0[@@ oP@40S Y Q @bn`n^n \nZnFoPP}4PKoPPsP m VVL C0?G /G[ 0W0j[0S ૴ {:S03V:gJ J 0 Qk6 C AH{{ *{0?G0 SWv{H0R 00 `: ૴jZ@4nnm mmOK+$( ꃫ9 p PVL J J 0 Q{g ` ( 0V:0:g `  0 $\ 0 p 0\0< 0@0h D $j0@ SZ CCG IH0S\0S{ ^ ^ NNJ ^MPtP  p`PP^` `PV LqG5@L{G {'Z{PPGP5VLP^  [ A5??  5L$0L AH $0G{{ *{0Se??GQp  @o pNWp@ 0 Sp3 0` Z1 <00 K@P ૴J ૴S\ 04@$ @ P@ TPR 5l@mD H0D 0 bSx20AaZ!1 <0 `05&L [ p@@ R RT R  P Ӑ.<00C<0ke P<00<0b4@R@o04S0S0ST V@lll ll 0S  0?G; * 0S5\  gP %46$ $PpL V$(@4R0y S QH0 H ' @ p 5?55?P9T VH0忋SKL R0SG?G 0jS  Q R*k&0B:H @ H H040L R0S0?G0kS0S0SzmPY mPqL 0@S0?G0< kS:7SVll l llhs 0S L 0?G0jSS+H0S Q) G H  p@ @/  P. `PVp 0P P   $$P V0 P ppd C`0` 0 L EH0H 0 ٰ4 D000 0 а눨 ld @ D0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0000-w-x色 00脲000S wS -S rS 0S /xS /  @-P@20 0W 0 P P//0S/ S S/0S/0S/@-@80@0T S R RT/ ?p@-P@Pp@op ?p@-@PP _p0p 0 யܣ  ?@-@P P P`DQTQQ/Q/QPp@-@@ P00pر 0 p p@-=P 0 @C` Ʊ PZ忱0Sp蹱P>P`pp@-@PM` P0E S aЍp 圱 PZ啱0S 0Z 0 W<ء @p@-@PpP Q 0S PP>0S>p@ A-@Pp X P@PEX `@^P`( $0$ 0 ` HLO- M` V$ p@KV P@40P RV F!0B0`F `! Ѝ0 Ѝ0I>`0\   @010/C. * @    @RA-P(M`p |@ 0 @0@0 PP00\ P@ 0 (Ѝ(  0?G0 5CS  A/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0L@ @0 OT(0M$ $0 ET D` O-PM`pv 0FV"S00 0] Pᬩ@P-UO +UP0+ 㼪pT"; @P00Es Qa0ESW0EA0ES70EVTPSQ $@0U: V* y yA ` 0T00S0 S` 0J0 ЍS T P0 0 0R00  Ѝr `0?| |0 อ00XS 00AA0C PSVr `Pr ` 0M0 00ЍT$ $QO-PMp 0GW"S`@P-T0P{ +T@`S 0T W  p St?0  05 0  /  @Pp P 6 Q P  S  R- !" P 00Bs ^a0BSW0BA0BS(70BS%| Y[  Q P  S  R!" @"009"00 0S \0F0 ЍS@ ` ?0  0Ĩ0b 0 0 0R00  Ѝ0T0e XR" 0AA B PR W  pX ppTP0?L L0 ๬. `@p DW>pp> $0M0 00Ѝ! $ r  Q0?0S @-X-- Mu ЍЍ/G-PP`O VW ;00PE !R !U5  bG 0SPPU pWU@@`jPp X2 00Q 00 @CpGp o00C f0 @0 08T0BP P0 (V80C4 40  ꤯l D A-P`L@L@H0 @p k=U  aQ A p@-@Pᱣ00C0S S u P 0` Pp=`u@-@P ㏣ 0`00@ʣ06 0 ༫ē - M?  Ѝp@-PP@ T 0 DA 0pD0M@ @0 T(0N$ $0 @  A-`P@p% W. 0S 0SP`/ 0FS0 0 0 0 R G``0Q00T 6P0P 0 SW4 b000 0 H4 8  O-p#P3OM @Pd0 h`0410`10 V V 00P/00 Z.` P 30 00 [ .Q  Q\.Q O :!!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O  0 P00J `` 0 0C S::  0 ` #:[ 0,$P(0000Ȟ$$1 !0 `@$P00 0 0 41 30)Oߍ Z_00姬004 <P@Wx Bt0t ( 0f9 T.R  :]P uVh HT  \(  (XO-`PPM X00 X0 Pߍ0( 08P 3 p0000 0 љP @000 "j0P> S0S S#Z 0S @0J0T:@D0S \@D _ @` ` V@DN R F9 0 00 S S0 S S Dy`P0   CoP@ P  Yh*@[V 1@0 00 S S S@ S Y2* @ H@P4 00 ``ḝ R @Dപ0S, Ca᫪  V " ឝ  T @D *(B8I P # p U ^0 @ 0W 008(#8I P p8^ p\ꈩ<D ļtt1@-`P0LM@0D00G LpP0S- @.0 P( U( qp0 0> 0 PLP m8 0 0 0 D0 30LЍ)LPtpp  @ O8T@ <0< 0L ۨU\ H#<# T ,A-PPM@7 q`p@T) X pp00  0KP 8 0 Ѝpp T@8T ЍKP @, (0( 0\ "| \O-M M [P P*0: pxe0瀕0D50t50 0S  0 R0 !2S2 0*0: 0 D5 30ݍ Ѝ`:0(0(,60P,0  0 @P?s0X`[S#_ ,7|5  00hpP0 (03/P p[: !232040z FP0H`X`uP,U 0  P [|ŝ@p< `E-8 @ DL 0T0XP 0 C0!`P!0 (03/P @ Zm 0` S$0` R $@x TH:,00 0@0,0<Q 0d0PD 0X Q B/o" RP h ZO[PP <`BpP0 0 00Pp ! R soQ \ V\pp0PX (70(0/W  <0SP0 B@Gq 0 B^Pb B SPSP@Tp`0S 0  0X@@ @PC0@P0CX@S:@p `@q6D0PX C0 0CS:c04 R 0S 0 S9 0B'RSV@qPnH 0P%7E0 SR40 80 =@P=0  $0@S8&Y 00`S.8 ` X` P!0 S S S /05P0 0S0S <0S0PP0X@T*T0D 0R*P  <0X@0DP<0$4 0l ౦ 0SD#3 l 0०: 0H0m4 0 0@P0 ? $0@SL0, @00R?*,P䮚P PXP姚0 CR00 S]@0 0,0@00,0.8:PdHpፚ0XP CR00@Ss@PX@(03/P XL0(@ 0L0B50P @0, 0,0,5c0  0% x6Y p ΍ 0 00A81s>I,/ 0X0PA :4P 0 9@P90 - $0 S<0S0,P@0,0@T @,DP$(0H %xh6 0L @0,1Q *,@0P,04P ,0(@@C 0L040P  @0, Q@00,0p ` H h$ p| LT} h| A-@PMPD 0 S`05 S Ѝ0p 0w3PP> ֧P9 80 0P娵P  0 0P4ΧU 00S S 0p4ἧ8 404 0 X4 0 Hz    3O-PP0BMM@040 0 00S0. S` p @0vG#"0 5P @T*Xd$  P 0 <",2 0 4 30BލЍ 0     ! V52@PR ;`PM 8 0 0@dPJ` 000 00000 0]0@C4T@ 0p pIP) 00S 0  0pW/  @. D 0  0 0 ੤f 4 0 4 0  00S Sy wP H 0w ܿdG-M`0pỦ@P0P0 V 0   0 p&PἦЍ 0 PP 0 0N v ȌA-M`pPᆦ@P , 0P (   0@ጦЍ, 00ЍA-@P M`Pp@Q UV'0S9 0S0S9 P`84180 ! P <Pp0NP 00 ЍU U, / 0 0 Ѝ0S  0 00S000s S 04 @P`8 404 0ǣ0 x t ܻO-DMPP d$0h X400<00 (10P ,t@`p30 `@P DP ,0 0P0ç RR RR$ 0 0 Q Q R R d 00 P Hs P@p`@Q Q Q S*P P 0Q@ (PC2 @P 0`@ 0$R0 ?0IPB Z0  6 PE Q 1 R  PEF U!:  PEpB0 Sh CF @`0  PE3 q [p5`&@U* @`]2[2 0  0H!41 0 <0 30DDЍ .P8 P2 0 0 0)0 B` @ `00'2%2  0 2 0000פ00 `@`@N\ H`t0 p@-MP@`q 80 00ɠ YЍp8 0 @-M@[ (9$  Ѝ0@- M@PH , 9  00 Ѝ00 00@- M@PU p@P@@ D ) X 9 P Ѝ0qPU 00 80C-@PaMP`D UL !0    ` p 0S"  0 C RV0 0 C.S3W 0@ Ѝ R0 XR  9S @ 0m 0 ݡU0n 0 ӡS @ pG W0  RU 4 8<03?04 Dm m ȴO-`#PQ3,M @00$00# V P P3 ǣ/ 0 D#<3 0 $0 30,Ѝ#3 0 $0 30,ЍOL肟Ir䒟p 0< sVo T TH 0h@P:T J@ TB x"0P P` `@0OP 1 Z, @ `V pW` c @$pT氐0Sl T0D S0 s Sb 0@:TP (pP :V8Z' 0S 0$ SᰐPqJ1p0< Th TVU 0 0H ~0S 0H 0ܠ$p@@.T`@$pTPʭMT( H |Xk 0k hi xi P @-P!@P 1,M `00$00 V(  p0 0 0  0P"* ᰏ 0 0 $0 30,Ѝp0hl l0 VT0iP P0 wꡢ 0 LH H0 (h h |O-lMp$0Q4 @00d00$ W P P4 {/ 0 `$X4 0 d0 30 lЍ8$,4 0 d0 30 lЍOydHS`P0 &W T T 0P 0 B 40$0 C0h@ 1R LTTP   0q0S P q u ZP 0PS q9 u00 Z0S PZ1U00040Pb@ 0T00` V>*UT:00Z D"K0 0PY/@T 0U00S 0SuP0040b@ 0`u PU 0 S *  0CR00:᥎<0 S8: 0 3HQIDaD1P`0 uT2 T 0S% ! 1  0 eHZ Z Z@P( ?R0 K P Pw: 0 0B00@PS| U:0@0mK H | HHf d c D4O-@PMȥp P 500SL Ӗ([Z U U U 5 0 Ѝ0` R  ?0[' + P%P 0;/qp 00P @ P @.00  0 0 0ҖЍp p\0P  * R + L UY  0ppGP 00 0 SM  0 00;/qp 00`P^ <`V;0 y0P ;/qp`0 p 00 0`VßR <0`VßpX0P[ Rh0 0cX0`[MS  00Q[ <`800C`V0Z*" PL`0`f? ` ;/qpA 00  P @ P -00 0Z 00 %\P*0 S': `F v AJ 0C0<P`T 0S  0C`ß<1G8!80 A`V0 Z 0CJ` J`P @0P >-0000 00ԕ0 0 ŝ0ƕd0` `0 ෝ0 0 崕 ti^ ,\] ܤ$] O-P$M@PH` U0\0p#p 0 000 0I0@0H`Y 00S `  O, PP ᝞00[O X 000@PF  WRR 0 B0S0 Q  R00S B 0 Sq `R00 SR  T*D00 S P^ TP`p^I  C 0H`@3 QY/ P+ 0S " P   00S S0S S4 S9 S? PP 0R00S0 0 T $Ѝ`dP`V0S 0@T0p ^" Q ` V EW WS SSH0hD D0 ੜ0Q㧔 ,dX Рp@-@PP` U 00 FGp 00p06| |0 Ud07` `0 u0 @p蘞0TS00dXX LP0X $-M0 3/Ѝ/0@-@P MP U( 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0D0@ @0 &U(0$ $0 PW 0V 0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 0 U, (0( 0 ۛV PU 8p@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0 ஛, (0( 0 छ(U <U Hp@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0$ w, (0( 0$ mLT `$T l80@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L H0H 00 7U, (0( 00 ,LS ` S 40@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L %H0H 0@ U, &(0( 0@ HR \R 00@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L EH0H 0P ൚U, F(0( 0P ચDQ XQ D|,0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L YH0H 0\ tU, e(0( 0\ i@P ~TP (0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ0 0 03/ Ѝ0L aH0H 0l 3U, (0( 0l ( l`> tp@-@PP U p@,X T0T 0V/ߕU8 404 0V/ԕp@= 4l= ԅ@-M@&P0.S00ЍG@-M@wp  B0?R0S Ѝ(0$ $0 ࡕ0CЍ8X> P R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / h0 0 / p/0/ 40/0/O-M0Qy 䓟Ű@% !EP , ,L  0Sp P Xk@.  Rd @Rg X_@SAQ0SI <  cSB!  S   XK#S`Pp@@ P pG W`W0P@W `0FS@{ Q0S R*0@BSQ<"828 0 Ѝ0X .„(00@AP R!   X@S p P\ ! C]R" X @D#cd`!2br   D"2b20Dr 210D0Ls 0;S !S" Cr ;"X0@S \S X 0@@EP P T S Sp pg 't0` 0epg '0!"@`0X,00; ?9  =O-$MhY@ Lt 0`pP`([Y= ؇P @d0Q ·P @ 0Q㓐) ÇP @ YT* PYw [\Yp .Y0D0CtXr0Q S.Qk ` P@] ᚇPh  IZN0xSK2 000 B P0XY /Qh ]QMP R00   0 ]R' PR " XYnP   R J b"r R Z zA @ R] .RP`@m@ P0D0C X1`(00$ЍZ00P   Z 4    \  PYX R0Q  S0 T 4* @DT\@YX(@ X00ɅS ` T`4* @DT\@YX 4 h7 T4 0G-pPAQ@K*0S% RB @R`0P0/ 0W9  0s00ؠ    P 0 S00@N0?X0Sx t0t 0.AS 0SP!0QPP00W@(00訹 2 ,z@zO-`V MP3P#VP30 U0p\ @ W @RH R R4 |(00 ЍW@ Ġ[? A @ GRP@R\ 40S4  0@0[A[Q[ 0 0. Y*@T*0P<0 A\ R!"ɑ 40S 4 00d0 xx- M} ЍO-S4M@ p0S0h 0S 0S0P^k @^Z \eS0X `S  B$  ( ,PU P0S @Sl   [@ؒU `PU00 S 0W*0 B>^A Z`P 00  Q Z%0T?\P0` RP YAS"`!0PU`00\ڒ(00@4ЍP`ቓ(00X0S $0Q *0F S(0S 0 `(  0AU0S " !  [W@dZ0 p w  ABQ APApFU Q   p  r  0B>S?0A0 S;`P R p0 S P`\I0,[ ?0,40@B0?Q0S !J1 0S/p0Sw 00t00s0  0R5 P`00p,@J0? Q0S`| jx0x 0S/໐V yX \W\ 8 404 Q/0৐J+ ts* lss* rrp@-P0 M `00 10000p !@p < 40 0 1 30ލp@< H A- P0M `@(q0 0 10p 0 pn0 (0 0 1 30ލ<8 H Q:/R/0S/S:00/@-\@3#* 0^ @R R R W(000S0QA^ R! Q 0Q @-A?S SAQ  0SLB#00(00N/G-p@`0TS'  V WT P@0TS P?^ 00(000QSp@-P@` P@ˊP`V  0R p/pA-APUQ?UU@A`pP W ځ1AP詑(00褑00ꠑ?00Q A@-?S SBR 0@S A腑00耑(00/-- M" ЍЍ/@-M@ p TЍR/0-S0 \ S 0^C00O-P M@P 0DT"S ` ኊP-Yb +YQ0Yc T@ @Q ;`paXP;`pXP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+ߐڐ0S \0J0 Ѝ`Q0YXP 0LA@ ^P @곐 0R00   Ѝ,0?( (0 taT@@v(# f0M0 00ЍK( $HA-`(!$1PP rMp0010+ V3 @^X0pA00tA0OJ00  TAV ϠPOP &0 @ p00 1 30rߍT0FP P0 V80G4 40 M: HH )! iF! h00- $  M  Ѝꠦ $ -- M0 0 ЍЍ/--M  Ѝ Ѝ/O-@SM _ YXe 0pS000!R !3  ᾃPP E``#Q9\*Q30A 0#1#2#4#8  P;   ю0U A 00 pQKP 0@pQ 0S  Ѝ豏0T @00Ѝ80@4 40 u꟏0 0'4 fA-@P`p"0 xP_$0M 000Ѝԣ xpp@-xPx0P00Sd0@pX`XX`@P@P P Dꜣ XP p@-P@J p@A-Pp`t@t@0h@ pU  f2<0 :]  A\̢ 1P@-@MP0S 3/000S@2Q A-P p@` F  v000 @P p@-@PPpp@!P1p@- BMa@0PD`040 E 9PU h10S ` 0L!  P4A0@ P; 1 0| 0 0 4 30/BލpɎP ǎ`P  6/P Q Q |0 0X|l0 00P 0 0 妎 `[}84 H cl

}aZM4)/>$ngG -= 0 0 30rЍ51E,0O(d(p,`d 7 0@ 0n)L4I2I00@P0D$P $P@H4((@T8l0ԣ< $,@\N>?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0$DHd(T,@VR gR 0` \` 0 Sz 0V*0 `0R C S` 0X   pXX0 S0R05` 0 `0 IISQ0C 0 B2:00P/A!b  V*0 `0R C W 0II Q B 0/C!b$: 00PV*0 `0R C S0 p`0Q 0900PV}*0 `0R Cv WwX0 N`i n0Q 0900PVV*0 `0R CO WP* *BQ0/800P b bR  bV6*0 `0R C/ S00Q 00800PJV*0 `0R C S0S{ V *0 `0R C SUeP7Q 00P  V*0 `0R C W* *BQ0P / b bR  & 0 V*0 `0R C S Q0P  & 0 V*0 `0R C S Q(0P <&  0 V*0 `0R C SUP&UP" Q0P  % 0 Vz*0 `0R Cs St 0Q 0X500PVb*0 `0R C[ S\0X*c Pc 0+; x0$ dVC*0 `0R C< W= 0S0 S0՜V,*0 `0R C% S&V*40 `0R C W0051E!2 Cd0bSӢ Rӣd B3PR  b0  V*0 `0R C S 00P 0$30V*0 `0R C S0 `0P S0020V*0 `0R C SV*`0 `0R C S40 t` 0SX @ Jqp { gqpn 0@P|1  0S! -R3 S1P! L1QH<00ϠPVl  `(,,*Q `PAP cW70 `0R C0 S10 `# Hԑ  D ,!    @    0  P ,Jk(51$H1=lGtFXC<0$.<- 0S  P   P V *0W `0QCԆP0l &`0 SG 1hV*0 `0R C S0S. 1V*0 `0R C WX0 ` <0 l`j! 70LII< @P$D?HA1cd(0T,@\%!E_d2dN`Re0eϠl 0 bSӢd Rӣd B2PR  b0  xVL*0 `0R CE WF0Q3 00PbV6*0 `0R C/ W0L#` `B`o  P: -0 AA-M@pP`400 p00@00pT p`pFЍ"00Ѝ(@- @MЍ\} $C-P\@ MX0`@p 80 P@  Ѝ} @C-@`P M\0`Pp <(0 @  Ѝ| @p@-0L| ^ࠓ P0L|@ T.^ڇT00p^p~00pp@-@0M-S` +S`P0 P& 0.00:S V00c0Ѝp;0 P <0!" :R P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <0  0 P 0.S 0 }P 0.S  m1  p@0 f0@-e)P L@,(@l^3f*Sk Sq @ B 0T@ҜS_e P#Q@P Q\< 0\QTP@# N$0,@L ^0#S S 0@0C @l^#3S0@0@;S0C^:= 00 P /0S/ 0 S/0S/0S0@//O--M014   S j H叇"/[7Kk6 H`<0a/QH#x "xH q~~N`AN0S."w ?'P P00 #1?B! 0/Z0S< # JL"p J㩀A0S/ ̃? , R  " R0 0.1>0 Z0S P * *Ba AdϠ ϬT R @SX@tT)|rLk NQ @\O(@N(  @,\H0@ $ m@q P@P!PP"gף pC@)n$A[ O@:(@`&! P,$3#`_0RS@0@ oS^T\HNQ @ \O(@N(  @, )|`rL$0@ `@H@mHQ!P%W׳ pC  @*n$A Q O@:( P %! P,$3#` 0SoS0@pE)L\HNQ @ pC$  @(T0" R P`[ Ϡ! +P@. PP` @ R  Ϡ ,ό@ ` ` ቢভ` fR$  ` & , Ό(` Y`3`# 0C Qp| , SWT08?OX 0\ cSQsH0;SeER0/H ;0S0 ;0 H0`8 t@QqHPd 80< UTM WVU V0780P@`<0Pp? 00?0S  S   80<  ;/P80< SRS@PV0C00 3 0S< Hu TT00ЍWV `VpcK80S Tz! @T!Sz[U0 SR Z 00SJF|Flmph`0 `pQ Y:Q@PTJ#M @A8剱<Ϭ P ;N0Q8 5@0\?5O0(<2@ 0>;N$0S33K051E00)y(.L@x?ᏒL`F8c@c0CV;kYC00#,Ƞ @B@- c 0]y(: 6S X00[$0/!+>0 (A O!2c0Xÿ0+" ?00 #2>[?`FW'@ PG`m1%0p:#0  ό"!/ W n13:$  p C0!".#2R> ' @01 30 #1`0U05? B4sppp00/S [U c 0x(: 6(aS X00[$0/!+>0 oÂ!`2c0Xÿ0+" ?00 #2>`T[j@tc 0$  x$: 6S T00Z$0 *>Â!2c@T0:#I0$BNo :s0c (a  ox(: 6S X00[$0 +>`!2cX0;#0(``8?O0 ` cQ0 R$I"ITY BqgqgpC(1 ? c 00`x0(: 6S X00Y$0! )>0%!EÂ!2c0)XLß8\?H)" ?00 #2>r?E$0CI"I0P0/A!b,!b S3 1I B !.50c((H<" 2c0 4S/  `00 \000U PE 0 S0 0(0 P P$0<Ѝ8\?H.+N)<2LQ @ 3 \O!EOό"!/ T(@[:.+N0 pC#". RD 7 0@0 030#!R̂"*h  “5.2L O\, 0C8PC@D10@e-0P00040tc )1 ?00w0):6S Y00X$0%(>!E!2c(\/H)L0Y("1 #2>N<`pc0q}T 0 ~@-M@00P T 00t0(0Ѝ 00p0H0O-@PtSM`P 0S7  V 02[? PLw 0PP ΌQP 0`O2%> 0!"R<0  0 S0  Q00v{}00Ѝ0 S. 0P0' V 0V"> P w 0PP ΌQP 02%> 09`0OR!"3 0V @ 0 Rh!0h& P l6Ym&N # ⊡0 EP 0V000 PS?S00SPuu0 P<00p0(0i P?S00Y`\ O-`p+FMM@PF  0 1 0:S0@/S' n:0@PP?P#5*H  0I0{0P/S .unP T0.S0S/SOI@@@P & ?I0|+PPP*F: 0 0 30Fۍߍ~P*0p 0 Z*Z:Z4Z$ Z4*Z4 KRo$*Z #Z1 "*Z$!Z$ ! *ZZ *Z$Z*Z *Z$ Z*Z Z *Z$ ZT*ZQ Z *Z$ Z$!1QP}Y*1R @  ,^\- 0C0:0@ A D 0勰S 0 0OI^H@Z ,PU{Pf0`p00S00ç0s0S] PWUSXUPTH )JD Y@Z <*  Q H m` 3N(@p $P,00`4[`Q0 < P4"<Q$1\p. `LQaPV RPPP@Y ! 0 ,0@~$H \@^ PPx{P  Q`0Q$4 Q$!?8:Z S00C08*S R R P8ZC P00s L p@x̔\& NhCE;E> 0@ 0W㉱@ 10<@W9  8vP0WP@/0Y@0\0B0 pS.0h! /O0 BSP PsP t\<U02p嘮0A  LP@X 0 R 0SZ0Q∑X }Q!爁 000  0P\ 0 # 0 C!@0y@@F ,h  Q^7 Q Q@Q@QDQQ^"R hNB 僟AhN $0 y $0@  Q J0ph@ $,P(0$0`\S 0 * 4"< Q$1 WU [[ P U0 @ p \`0\$4 \$!? K[ (0$@ T F nQ R S  0I0B0 0:0@ 0Sp`@(Fo0 R !0S P k1Q N hp x0P@UG A# 02 ?0cQ00 #Y H@W (O-@0MP<SH0@SЍ0S >Sp@0GSh7`P [ 0hS01Ӄ!0 "0xY,Ih0  000 001Y# <Y60`S0S >S@5S*S0S -S0 C Rp@0GN<)hh0 `Lhlpt YxЍ*YY -Y00I S@0IS0   S ,S;SQhAl d ;S,Sc Sjh^&- Q 019mPhjp0 pK19mo\Ϭh6PcRp9l ukt bhp& l&w& 000 @ 0N\hPw@PP w @d P 1 0 0? 10/p00P 0,S0,0|P 0Sh lub$ `(p&{,t.Ol6(w60h参@0 h0O ' @< . /O@ 0Tp)0`L4@岷@`p80  HDZ `p [  R- K   cX 5:< cR8 0#031` @0?0cY `4@0`p (<2@0<1@00 7 0@8010@<00)P 0L@ @@参L@40@pD`H P0& 0fS005:804fS0#031<`0`?0cPpcs VP 10@p1c00D`[HL@0 01 @p0\0=1@00)<2L40P8 5@80(<2@<0<1@X0 7 0@`010@d00H``P@p @D LGp @R * Z{ / c ^,  \ _ /ጱ ce  [.࠳^B Q ! !c 0 p?0 c@R`@0X<$ ( ,00#8#< cRX05:` cR\ 0#031d `0Y  lP 0 S >VY  Y.Z@pDH`LP@T0g.f>0Y 0H!S1ð1Sp0`4@ A-PQ@B 0S !1h ? @p Dh6l6 `O`P 0:S MP XpHPhnW  iP0PT`X\PNLg@_`PhP`T`P A-pP B R@PR hP``XqP1@Tg  P@VI QO 1!0pt0 ;1B 0W  }pp@ wU=D0C0C P S\@0d@D/  @DC0?P0S00#  `0X`ࣴ IG0Vh,:Qt0T0P p0;A 0 P@PlA @Lt 808 0@-@z$00@!R !q,? @-\F<l0hN 0Q S \P0v 0 \ F<h0 0Q Sp/@-v 0 (0( 0@-@7 @2 > @-p@ $0$ 0@-@"@= p@-PP  @`PPpuP`0 p@-`L@L0@P8 800C? @p,= @A-P\@`X0@pH000S4 0 @< @0@- M@PB0 @kP00p0(0 Ѝ0脷C0@- M@P+P0  CόQP T $00t0(0 Ѝ000p0긌p@-M@`P 0 P5P T 00t0(0Ѝp 00p0꠶p@-P@0@`q?p00@T ` 0P@ap,0 P@; @tp@-@PP 4 0p@0 p@ Q0 0P0 0p@-@PP0 00 p@0 @-4M*c@ Pb  c*M 0Sp`4Ѝ0@-P X\0H@P@@̌ 2P0A-Pp`0p@000S |00Q 0"*X  U 0SZ<02PUo8 @G-@pPb0jX` T]0SZ 0 P K0SZ 0R 0  S \Z^ UT0S ˜ ST0P 0  ^ 0SZ 0TUT@@@ 02 ^?<02 P?<0A-Pl`@h0`p@X000S H00P  0uP@/@6  @p@-@P`P` U 0 D0Pp000\ LpL0AH H0 qU00B, ,0 q5 (tLL0LP0P0@-S@ (000S 3/54 <|A-ǤpP@Tdpd`p`ὤ 0 3/P ^tᮤ@T4 |4 x4 x0A-0`pP7@P UP @t4p `$ 0@$3 G-P p@+ ?oT20SZ +` @Dv%:/P p@@TP`GP0`P0 qZh0 H0 qP0FL L0 q80H4 40 p̮Tth|(XA-PPp`@p$ 0pT P# 0P0` @0"0ƒ t00#S  R"R<08 80 p(2 <dDp@-@RP`  p@ 0 0 p01!0O- M0ጡ`㈑0[|1|q 0 #.p0B# 4" 4"T, P R: S P@T! [0S !P 0.3/02 S042ST0 3 # T0 3R`0`0@T@@420C4242SV `V ЍS H  03/02 S @0 @Ё .A-p0Q`!M0P @0SD1P00100W8 T?` `0xa80|a8O8T@D1@V  @@TAPϠPOP0@ 0 0 1 30ލl0Ph h0 oWP0QL L0 oqT 0 . H . l0- 0 M ЍT- $ -- M0 0 ЍЍ/0--M0 uЍЍ/0 0p@-P@XFg`00C`0Sp S u P X0` X PXygpXv`u, \0 X0`00C`0SppSr P X0X /XW, -404-0 M  X ЍЍ/+ -4 4- M00 XЍ Ѝ/\+ G-@SP`d 0S:X( (S Y" UN f0p W W2* 2pJ0P00 -PRp%q0T @0 0` p0pWP PPp,P Ik`C0 00 f o0 0SJ 0 00f0Q 0 nt0=p p0 n\0X X0 n0 0Cf IBk`dx--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PP$a$M@`) +pP< o@P9 !0P1/S*0p@0 0 0 0 00   $Ѝ|0>x x0 In 0g$Ѝzip0000@$Ѝx( Pt4<@-@P e0SC(f0; 0 nl$p@-P`@7b R T0U:T0T:p@*o;RJW@-6p@-@QPJ 00!R ! 00! 0S uP A0Q`0R0S' 0S 00C000P0S 0 U00SpcP#0cP `cP  \0WX X0 m  A80<4 40 mo 004| L RA-` P$@ R0 ,°00aRK 0  a0R00S 00@0A PA05\ &l plL<0@^㖌 1c000A X \00X00S PAA0 S< =<;:97310/.-,+)('%#" wsrq" %: spR V@8VL0V & a0 Q V  T 4ЍPPؠPPؠ0 ## 0B Q00C$RNKP00y x3 0S0V `1!'  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0 @#"00B 0B Q$R8 x 0S p V0`1 ! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B@ Q 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S pD 0V `1!dx$ 0S0V `1!W V  x 0S]0V `1!F +  x 0S p (  xz 0S px) 0S0V `1!x+ 0S0V `1! x 0S0V `1!xn 0S px 0S p 0V `1! py yp rp kp& dp ]p Vp"s R 0I0py V@ `1 | x 0S0V `1! | xm 0S #pT 0V `1!t ; x 0S40V `1!e ; xX 0S p/ T- * p# p$ p7 p#l x 0S0V `1!'P x 0S p[ x 0S0V `1!  xi 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S cpx! 0S Wp@ x 0S Ipz 0V `1!  x  0S 4pe 0V `1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@  "0 B  0B P$Rh x R 00p V@b P { p  P o p pO p P U P P P K P F P A P < P 7 P 2 P - P (0s 0 S p  0V@`1! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S pP 0V `1!p PE C P@ > P; 9 P6 4 P1 /O-oM M@PH 4'P007 T0060^ H0SQ 0T00!R !0w00d00  0S   R 0H 0䠍<00800@CI?(`00㐠400h L0\ 0@T P%T @T0`EV 0pJ0H000S0`` pTi @P0v0%100$0P 0DZSILK]D->/MI*-*79:['Pg]P    RV00sR H0S Pb?R`1R`OQ`.LQN_T %h 0@EH TL,\Dt/΍ @0@ˠ8`P `\P` `0@ 0@00:00D` p@6&00D S$T 0`EU V5 %V` 8`Fq[0FCP (%Gg[0GCPp <0S <T0儀0@0S 00 00XX F"2 0 6 307  oލ ЍTPg AbO0v0,0`PX@%10 S000 0R00D0S0p0 BRQ 00Qv%Q 0` 0Q 0$W , `FV  K, @00  R8  0 pBWSD0 0 000(@Tz0Sq 80CZl( H ؀zzy@xw  D 0P@0$0SPP0S9 4 1 040@0Sx0|  7R10P` | 0R BL 0R0S/ <0S 0P<0 x0倀S-0v0x* @ pPdT 8 A0p < 04P@00P0 4 0, *) S ! @0040PP@/  dU P040b_P0T0Yp ?,4@0 @*T 00DP S0$0 @1!00D S$@倐@4P@@@@PP{Ppp4  0  * SO !P 000S%A<0P|Pp0@w0\0p@ R R< L`KV`Vڔ 0P 0R VHY~\@Q $  d0 b_ R P  0$ K[[ ڔ 0@ R0 ($`[ `FVuVڠMP8p@(@`FV 0R@0 S00 B[@[Z( p  8K[ 0Rp0 S[K[(0.\ 0  0 S0(0 V8p `FV 0R 0 S`FV(0\/P0`  0 S0 8`FV0FCPp(08@DV0DCP cIV0ICP Z/P0 ` 0 S0 8@DV0DCPC0 0($ R Qb_dPLQ00@@0 S 8@D{V0DCP( 0$L`@VDh\00J wR#\ l@  @8JZ0Q0SJZ(0l@ ^0 0vK.V0KCP S0 8I!V0ICP(0 S0 8IV0ICP(0 d0vT ,0PS,P0 p0 SED0 0Wڬ\@8`(PpGW 0RP@0 S0FU0FCP iQ 8PEU0ECP^( L0@0C0 EGU0GCPh L 00 R+     $  d 00  R  PU$ L $ < Q0@0 Sh J?0 0 ( S= XPE00,0, 0$P0,0V t*^p:p  0`<00NS `Tv@? : SP04 pP0p07A@9 = SC 4 P= 0P0 8 @b  2 SP0 4  pP0UX P RT gw'`, @8`X [@UQ= U@ PEIKQ0 0R, pBWpW ڔ00QQW A RR:p`@ @DT 0Qp0S@DT( 0  @`0 ^X 0J2T0JCP S0 H&T0HCP(0S60(SSv(0YXe p``8`IY 0Rp0 S(0FS0FCP HSHA0Pz(k(10X0hB- C+ S S)!ھ N L CcS!2d00 @ a000AD0NQ*Jo@N0 u` S0(SP0 4  P0$0 pvS  ࠡ^SP 4 01P S`-0v0͵$0Sp S* 4 P  SP0 4  P0P04 00 4  P00 0 ,0<@?0\0`PX0@0 "x2 0 ^|00CL0 "P 0  0 S0 8`FDS0FCP(0S0(00 <0w0,00,b_pdp4\   S 4SP 4 01P 0  S3 4PJN   i S 4HS0(0R     S4  P1 0P j   S4  P1 0P@4P@:\ P0S 6ꌧ  \ L |nX mȷmt8 0 ( ̜ fh ,جȬ\( Ў ,ZPtY Yx|X,WH0S 0PS S\ 0, X0,0,0`<@@`?0(`TG@@v,@@)S0](00 p 4w0^p,0< 0a ^0,b_{4\ L| 4|L4P#@K" . @S ,g_&Q!QP!Y0K Q S 00Q00Si 0 0Є4Pdp$`0G,040SPRP0P4 00 4  P0PSD 0LPs0%1)8IQIA0Pv(S0(0Q@ Jo00 ER 0 *! 00Bh00?R0S h0Uv0,0 ,0`$P0<@,0P?X`0e$004HQHA0PP(8@DQ0DCP C8@DQ0DCPc 9SP04 pP0p0S 4 P1sS4  P0 ppP0SP44 01P SP 4P  'SP 4P   n S 4 P1S4  P0 ppP08pGGQ0GCP5 8PE=Q0ECP@ E@ @ L L`b_Ď4c. D 0S." 6 0001? 8pGQ0GCP 8PEQ0ECP $`0 0h0)p x0@ SM 100@P>S(0puPeS$gp8`(`PEUG 0R`0 S0 HP0HCP [?$P<@`P0X[G@q @K,00K0S0 00RS 8@DP0DCP5h J?000 0 ( )p(P0 P 0 P$`0 MiP0  0P +P0P00P0P0 00P0P0PP0P0 00P0 ,\ T @!p)Dt9t  0 [|00CL0tP0PSP04P0 004 L PB_8PE%P EB0P(/> pP\T 8 A0p@  0@00*:  8 0[1*:  D 0[S} 4P!,1S 4Sy 4S]P(0IP PP ] 0 0l H00ip[}] 0 0YP0PpP0.+>;  0<[| PBLP0?V0 H00Cp 0SP0 0 P0X@R SP044 P0 00%-P0PpP08PEyO EB0PP(P P0P 0S @4`*<XT@P00D SI` 6&00A S$Q0S+ 1$0@P 0@00XP\ 0 0  SP044 P0 00S4P0P1P4 $04$ P0 H00pX 0SP0 $ P0 `@-` MDP@pTR8P0 YPR Ѝ $A-@P`p 0D @0S0C C[0S  U #R   CU&b # 3S RUY *CUR"W * W@`pG@0S0@FZ`U00 E000DTY:?C0C1  0O1 0S  ` 0SQ @e@`멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0Ԍ `xeO-`-pЄ4KUDM 0Sp00 @P`U0ʳ?G @ 0 X @ YR YH 8<`P *:8 R ?CH{0CQ; +c{7! G: A{ ZZ`PEU BBF3 _JRx0$000P(00I W?o2,0BWpG G0RM30 Z70  DЍO<00C QA@a a40CG{A0$0Z0b000U0P0C00eP(0R@P PDЍIoᩒቐo0PE$0 0p00004 0<0Sv Rsʼ10[ 00Ӣ?+ [ +b +XP~@0000  Q0@DЍ   4 [ 00@P 00[00WY  0 R S~<0SD0SAʴ [4 4 0 @ DЍOaCoc?`(?yPD? OLt]\ R  RC086h0P0]  R00Z00S R0 0HJ B (Q 0S 0P0B 0P(0= (0`0P5 U ,W   `R `  0 0 Rd1 H;0""1 0 1 00!;R 0Q ` ++$ R +kJ:[ {{+S 5AH  04+C 0S021;Se 0[{ * r0  qK; P4 `a{+* p 0  J+t+Z SP0CTF  s9R  0r @ S0: {{+S 5A 1+C r 'a J0H+0 |30 c0""1!ha+ 300 Q+b P+a+z E XFZL$ R[ RZp ``PY  0PP0S0S1 Wp 0pYJ Y 0g`P= 00P8X& H Y9R  p e(`P$(0H(0`P A0P  00P0 4 0[ G 4L QU  D $ P,@ p( qpV 0@hP R- HPQP (0 SY[Q 0P,@PvZ 0SZ n P@hfU 00 G E[ 000PP @  1 G0S>0P ,W  qP (0!(0 `O;cD +0{* p@ 0 r  +s  Pq 4J<0 R0?00Su0 00\ `;0  Q `{ A *N pN@  BB*N*0 r  P@y< `  s0R 00P@0m[s$0S@  `P 0Z  0P0  P0*0P00H Y0R p-0QPP    !V 0P P  D0b0$$08$0Pg0 0C0`P 0S$04 R[ G 4W4 j[0Sk 0  g QQ00S Y Y~ R0P,@0`P 00P9UP 1P[ 4Q0:00C00+b {+ { +S 5@0P00   1 0Q Y6 Y p b -* P0 YPR Y[>0S 0  7 Q$Y0P,@y 9UPPvp9   RQ R !**R UP0 P@ iP @f 0S]P@^ R `  p 1 @0;q8p0P,@0P9U,@ [1P* 4   6A-`@PVUTp 0S *P@ Vp$S VT@p@@VpV@+S#S/\S//P@-@00@ RP@p@-@PPp0S0 0 R Up0 @!50O- MPSWPE@!a0p  P V`":0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10U    MX 0 dP  A UUxD HT;+@-P@-`@- RC/A 0\R#R! R/p@-`P@ TP 0FP R @P  T00pT P,0?( (0 S0P?;p@-@P G`ZPP  Tp0: 0 jS?:d-M ЍpFF|~pq51hpqpq1`p- M[ ЍP/> 3D-@"M @Ϡ#90c 0_Ѝ0@-@PMP  0  P Ap`Ѝ0(0;$ $0 S  G<9, p@-0@Q r P p0 S!P00pv PP    ! T @0O-M`pD@0DQ00P;5X# @0S S] @   b 0P1  P  0- T@@  0  "W @TQ 0P@020  0 W`e ЍQe @0R AX00@P00  L 0`00R-@0QMW 0000`VBoPQEp0 0 `by V 0 <T@P@00^T"000@000# @[ 0Sd0T 02ak PP @ 0"0! #000 @lx`@P 0Q/ R  B /A-`0@bSP)p`B @@AV * D0 BS   `R0 pg3701@V * CQ B   R B PPO-p -@|M0;0 0 E0 d p Pl0-P-+*)('&%$ MT000P0$0 00@ S0000S`@ #T0`Cڜ T0 @l@00@ S0\ ( EQ $00 lp0l00+S9 -S40400l000C ^0Slll00S 1C\c,X 0d, 0 A(0S S ?o280jTg@Xpp Xaڐ* 9 g01+S5[X(0S (0vSj( %0hSpHp t0$0pH $h Pp t0h0t0 pLW t0 h0t0 A<  R Q4 pCW pp Whpw"0h000004 St  <00S^40<000 0 ˷00 (0, S  J ?, D0LL@ Ph    !Qp0 @P] p0   !QhPtp E `PN R P4,0D0, C0ED PP PE0CPpPU00 S 0SPEpGK,0SaEQ)3(0SoWg[  `P   PP 0S0SI p 80P S X 0S#C W <04 S0d0 p [c0[` KpQ 0Z00S@00P0L0h 0#Z00St0H0I `\" 0P$0 \QJL[pp  !G $p Pp 0 S B\:<04 Sh  Bh $  XH0h t00@0C?oQ20S K x!)I Zɋ0S     0Sp|Ѝ 00XS PlP0P P0$01p Ql000Sd00d0R cpa d|Ѝ $ ( RiS IS NSl@8P l 0000(S0d0 0p 00nS 0p lpd0P+  ^PJT l 0g 0C ^(^l00l00(0pHpWt0$0@WD v @P {lp,000l0Pl P00W'"!,1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H  000 S  QH 0S l00S l 1CQ;l00C P 6&V瞯<( cLkdX0Cl00C Y' >.l00C0N YL\,4Q,a,p Ppu h00h0l@ZP3 l00Cl0Q Pl00l000000p d0sS(0pHpt0$0pg  4101 p W'"l1HC0 AQ:S:?C0C0  ላ  RQzGpGp4656:H \ 200 S  U80H 0d000KPt0$0pHW p201 툋 4P^>  OW 0@P0I$Pp  B\ 0S. h 0 h 0R00`P k0P$0 $0@ 1 P DPp% Pp <0t $0C B<0t p700 W0 0P0 ዴH^@UZ80{S相zI8] SM Oa0P$0y  p  d0P 0d00Sh0K0S pPp\  t00C t0  0S QOLMKt0 R# 00S S SJ p< 000 p  d"!@Q*,N000  0c2300p S 00S 00P0d0bO"000Sd0000d0 @0 pBpvPp 0h0t00Ct0!HO00p0  0d0:O"0 000000`@!0@d0 0P0I040008000c80  ITFT R0l 000p0PdA 0p Slp 0pD A<0p0<0t $ t X ,00 [d K P p <0h0Ct0 Pp{ !T T  TTQʽ (H^,t0 :( S<10:t$6t0}0`0l!5S00 8(! d  刋 H P9 J[@0P 0@00 bP :相[ p0000 P (@I @Q X@X @Ӕ(@ XcQ 0ӓ" 208 ,  J1 d000! ` `3P x3d  80(00hA1! 0 ` `` `P ^4A&; \0t0$050`lS !00d0K AWW k 0S h0p |Q0x40  0 0Ch t0!0d0,W aZ!0d0!0< 4R0PP 3Pt0 p 0Cht00d0Ppp04000P0d0I@  000p d0Sd0S`  p 000040t0P0d00Z!05 d000# [00Sp 0 WZ W0d00  3S 00d0 2Pp  h`1`f`Ph00h0!0d0<04 pSd 0S!0d00S00000t0h 0Ct0s@-}00G-` 0pQ`pp@PO PP`q0s #8z *8 "80 W# G0 BW`E   3aV F@0Rs#8ḐA)80A#Y 0U 1 PP M`P    !K@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 X  \60QR T0#03\0SuWa* G0V*0F@S3 F\   K0WN 06S ЍW*@DPD@ Q0; Q0Q l@ l@4 Q:@00XS Q0nM)ARo 婒Y" 0^0 n12000 QP0Q0l 1 c0R:|00Q )Q 08 O-M<0 *THT8@`00Sp 00Qt0P00Q  EB0SG^E@0= PQa @0 \ ES YH P 0S S SC `Pb@0@00 00Vp@ !BJT q Pe 0@S50000S Y 0 @PQb R  BPQa S@0D0CSڣ0SPW 0S] N=00TY0 p0TDX@N S0T0@ T  BB! B`P DRy`0 S0 S C U 0S S S KP@"00ЍRq  BPQ+Q~ -Q  NQ @N AY  ^!#AAPPn(@Ѝ P 0QP0Q 0S00 MS S80S 000 b@0 0J"00@By`P D` 212 Q`rQ  Q P PR  @V 0Sf Sg S @00ЍaF PePfq0 S_^J@"00ЍP@0M@EuPL K`"VpK`W `2 p 1 PE@7`?Q@!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80SU80S Q0   B @P Pwj 0`e  BR "@`P3 `2d"P1 5 <  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPU 0 BP @` pV  p0 BP0U`0@-@-P M B@> 0 B 0C2S* Q*KU AZBKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ G0"S1 1  !2R / 3RS/x 0t p00 cQP0a0cQ00A0cQ/( Q|Q`QA-B^0000`Q1 !0U a2!!p(  U2!NRA!1! 0U U0N10CSC10R 00@-@MS: P @  0Q P~@ЍA-P aM1`p0S3 U10AT !0S 000+ 3@T0  0S 0CЍ0@0D!1S<000S 0004 7 p@-@P00p R pPQ`00App@oD `ܸ80 0QApp@и l40  0#10/sP#8s R#4#2#10 0// /A-`P@100("@Up0p 0S1pP@P;pP    !F`~P081#3S412s2sS/1J //@-@P0@0O-0MZ  @SpPA PaU* F B  ?F  ^'* 0H X0C0003 00ZP@T   `d`` XZ P` @T@T 06S @ЍG-0ⴁ@pO$A- QPiV$10SMqt10P `00K 0S L1Է }0P4 p@ PU `@00SdPP# 000S 0⪷0⥷PUt 0C  pPpH0⓷iV0S 0∷ XG-`P塢0P@Tڃ0T*P$ Zp !ptE0  i )  \2!0L\0C0003R @@TpG \ -0P1 0^$23\ *G-P`@P= 0P@`@P pP @ @q0 0S 0SW 0@G`@DW$A  3!!PQ@ 0 0S03#QAA 02LS P0@0WA!@3 A-p@PAD`_ P 0`0W @ *\ l0D1W 56 501 P56 +CW `C6<5#11C<C-` MYPX@P YzY0W6X0 W 0 C.G B 50c 0 Ѝ 0P c   2# R WC>C0C012`0S0/0 R /@-phaM@P`@ ?P7PP5 ᧲pP/0 S Q8 p! 0: S1DP 0uPP!@0 000  0 0 m ЍpE00Ѝ`0E\ \0 7C\P]E00YEO00| PtdB㓳p@-@P :00C0S0 P;pP0= 0 C DB@-@P 00C0S0 @ I0 0 B$Ap@-@P`S 0rSL wS aSP D 0 pP0S! e C+Sr0 SR)# P0SPPp0S0S0S0SP0> 0 Bh@p@p@-@P9 0S? 2:P00 P! !( 0S 3/PP೼000P @ P 00 00 !!S: 0?OB 0p7P008, ,0 6B`DP 00l?@-@P 00!R !.P 0C 0; 0 BX?@-@P 0 0 S 40;0 00 A0 0 S@7>p@-@PQPK 100SD 0  [Y E000S% 0'$0 3/0:s00P:p00P @ P '00< R 8000S]80 0P>HB J0 0 A+7P 00s0 0@0 00 pC0 @0 0Hv d4t@=-Ѝ/@-A@QS S S C 0 6@@0@6@@0@d6@@0@0 0 0; B0/0P 0p/@-cC/41S C-@ -  !`0p EMD2/D d0 @"l f#0a 0VfgPx4p`T!dRAbPPa`k{8'<H0L0p&` &BZj XhCVf0T!dPa`C'RAbp@VfBTdA/ CGˍۍ 퍳pf APM_m[PQ 0DjPVpQ 09jPKQ 0/jPA Q 0%jP7Q 0jP-Q 0jP#Q 0jPPQ 0iPY`Eߍ /BOB,a;Q@-P @41S  P *P0BA-4!@ `PP/1S 0L1P@PPPU!RMPPP !Rp \V EB`_oR@B`=B``@-@P 0@l@A-@`P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V APCAPSSO-P M. Sy$AT IopF qp A`TU XX`F( [ʋ Q `(q0S 0P@  Ѝ0C$!o?P$ (xp ₰\~ Q 0x@^`S0S ?^0C pF p(V: (  A$!T$$( [ `( A^ \ :0  @P8A, R$!D(1s V( T0 >谟 0 >0 >갰 (![ 00Q($1@ (A$K 0 oPc $^32 2`2O-,M  R0 1 p3/,0 (Q0 Pt @P``^$`P 0BZ@ P@U pWW 0 `PL @R㲀( PUJ[K` `,Ѝ 0 ^nPPu/  $`nPB $ 0 `P# @R㲀/  #P^ ^5 ^ 0Q#`[F PP  VfP0 ciP@  ,Ѝ$`0  pprnP   6fP(pLW AT(Q`0@-@ 0! \ @+@00,1@00S@-@0 @?00,1R@-@1  0@?,?O-`0dSiM @ pPw<@P Uq  p ?Q 0 Rp r+s; 4 q40*LDĀ U>PB H5 7 9 ; = ? PP V  Pp^4Q W!3\@ 0Ҵ\ \@49P3j0 D‥+pW $?gP G<2N ,0(00@p K[WW' K[p@XX( 帰R[@\\,嶠R ZK ^^. PBBYY)SRQBBpw 0AS[a@ PV IRR`  ;/@PJp( qPF  1 D0!NB;ḡ !V Q>U0 aP$4Q$P| @<<%< p@ED p0 (0$,K [pepUJJ 0!iߍOPܪ=P 0= 0 ppVp=P=Q=Z0  @kA{40t?; pj7 D N<P  B5 7 9 ; = ? =Z ڂ==@Py=Pv=P0ayn=pj=p  O-@(P0P!0`5R5s`(P4QؑP, Ag (B ,0XD D S 1"1 Ogꁡ P ر N$ J; ^ؑ@-@ 13/, (Q0@-@Q .00 2< 0 O-SMf `& 0[ p0P!W G QZ Z R U UUU  <00PЍ6 p & 0 T !.@P 0$ Q10!12dPP1 0%S@0 25X  000h5040`5080X50<0P5  B00<5000 S S <00P p  20 2 `0  p 0 0aWp W|3Wx# 2[ 00 20120GqS  000 1S 06 G6@X*xwX 0 3,P0 "  A-P 1S0S1S - 1 29 2 1 29 2 1S 28 2?R.S # )H P}PH0b ”@S „9 LSPpT#0'+p/ SS4!"0X<$0X8X%0&W<(0W8Wt)0*pP<,0P8P-0.X\ k {Q<0Q80R<0R80:Q R$  k{ „SWL0STPpJZ㪠O*z0[* C 0@! B1r 0!1 0!  0(0 0S 1S RV  R[K  f'q 2 Y 0 xpR W' 0R1 S0"1!x1bt!t0 {3P9 >' 0 CIY㩐2*yI Z00 P0{{/010CS` *v00C[ {?尰!l0bh h0 53T0bP P0 ,3V500`LA H@ x`p<LO-(0pM RC @a0kP`0yP P FPOJ1ZuPp01a@0  Q1S@10CS㣰L* 0Ks0S0Cs00  VrS10C1(0 0S Ѝ @Q! R0(0 2 0p. 0     PR  0R1 S0C1ȁ p P p 02b"0 2T` Y  0Ip1P QPEUP *0EY):YQNQPEUP:$2b " 0 g2u00CY Vp崑 (00(0I1b!0 S2u00CY* 0p1PH Y Q %PP  @PAP8(00 (0%0!0!0 d%PPm 1P0CS㣠)* 0J1sP(00  %@00`0 `p崑Pq J(00(0 %(00(0@0b< <0 1\(8h,<p@-@PQQp %P 0 0%Q %P 0 0%ppO-,Pa V0Fi 1$@T `Vp0ഀ0 0 pq 10CS0*S0SS 0SK P 1b!0 y10p 0 Hx1FV㴠0pp1  0 S001Rp10CS㣰5*0Ks0S Cr   0Zq00R10C1  % R `P 1 ! 1 P $ $(0b$ $0 1pO-pP$M@Q $00 2T T )300@$Ѝ(  @h @$Ѝ̷0ȧ0 7 00 t`P_  R ]t@ Y*2P0 PA 2@D @T㴐: 0 b01ᴐ0CS00 01*S0C0    @T0p~ 0BRs0@0010CS0*SP@0 #pP 10CS0`*Sf` A$00 Ps  0S  @  `R 0S 0 $q,Y@ t@@D V $qY 0G 1|#P< A`W@DT@:0 b-04b$0 $00n #!4b$0 01 10CS0@*SPN #T0*T6DP 2@0 2$Ѝ4b$0 /T #3b#0 / #TF@ @DOoB43b#0 / # # "pPP @W1 @0t@@C 1` 1 0@10@`C1d# "@P X0*  U#  "P 0 $@T C#T~ 100v` 5#  Pi ,p100 Q^ [[ #QU`F #Q0WK `0E 1"PD UR  BV`Fr@! @B!( 010Q00P 1@Dvt@0@C1 @  `F10" W"P 10CS@:0 b /  "  B"P P8$0,p0@48ī@-@PM 0  0P Ѝ05 0 .ꈭP<O-p"P2JM @P M`0040g VW00?470S 0SNIPIT/ "P 000P"H2 0 4 30Jލ Ѝ$ >8X00 0UXS 0 I0;w0. T:+[) PK0/S  000P0: S 0000S0I S~0?00(1?$!$0 G.QPPV$ 4- bp"c00S X 0C \0 RK Y ""PK000W ᘞp wᗞP 90@olA) H( d|TT@R Q0P:Q0Q:/@-/0M 000Ѝ⻠4& P(0( 0@-@Რ $ @ & Pp@-@VPS#k*PM$  p@>0@-$M@0 @0[S 0P000 00 0 p 0S$Ѝ0$Ѝ0XP 00p 0S 0    [0ꘄ0M 000ЍN$ PO-@lMeppF P 0` $ (t0 F4<@ DnH C2 bG   p ($,08`LPPpT@ p@P , .PnlȠ P% `p'eX "gx0#@$b* c: dJ ,n P%l̠ e\p'` ```g|@$ L " ,0# ,lȠ.% P< P PPa`PPP p'PP Pgx`@$P0#.Pc:dJ " p'nZb*! ,g| `0a< l̠` 0```0P% "0#,@$ <PL vLP@P, X pPp0 p0004 d 8<`T@@``$` (`\D` +;H`P p0 $(, `048< DlЍexpand 32-byte k@-` Rp \M0 @ T 0 "P  00   -@ t T L0 0 T0 30 \Ѝ,0F( (0 =,uP H l|h1O-`0X!0M@ p 8`P]G  ? 000 0p. R+/ X )  h   0 0 < 40 0 0 30Ѝ!_@8 H 00,2p@-M0"PD0S n@P/ PUT!1 0 0 30kЍpᄞD0SYP( $ D L40+$0 L+&h!C0  \2 P ^`#((`  0    p@,  p$ T @A PU .  'PhໞP0D0%ʛ H Pp p0@- MdD@ @P0 0 0U  Ѝ0 Ѝ0` P # Q3 O-Mb@0`0|00? @2 0Ty "2 0 |0 30Ѝ*P pp2 0Wo `HP` p`F GY! D?0 0*$Z$0T_:Y8Y?Zx @@  @]T @@000X c0SSY_  ꔱw!1  X 0  *0 T:YY P1 ^0*@!z<1< X 0*<@ # 0 0+Z 0 0 |0 30'ЍO[Z ^0 X 0{*YYZ<@  +@  <@0S  H P pt\ ||C-@ M`d'`oP pW:00 0U p' Ѝ Pp@-V (@@P 0 0Upp@( Pp@-@Q``P` ? @@0 0Tpp@ߜ( $0$ 0p * PA-@p0P A`q080P0P0 00S   L| P*00 0 00 0S$1   @p P@  0  P 0 0 0q\O-؁Pp`HXQ* @x00@8x06 A@DT@V*t@ @0p@wp0 @q@q A@DT@P*t@@0 0 000 06谁HX؀E*X 0  rP@:갡JZڠ*Z  00@s Q:0 0 @) b0 06) b0 0+)l bh0h 0 )P bL0L 0)`tĔ4HpO-1,MP0C0SP0ᰐ5*1 0CS 0 0 *0S3 4 P0$0040000@p`0Y PP0ES 01 PPPYx00CV 0 @P`pUv`s*P 0u@S0SZ 000pVwp: P$@@T:|#x3x  0(t@1@A(0  0R 1 S0"s0&1!V0C 01ő 0YP0 PP P0Ӂ0C0[ p@p V@ 0Bt@S񏐤}si40Y100!00Si*00CVe YPU:0 -(01 P0P P Pc01 P PP YTP0   r0`@@pv`t@pQ[@T:4!010  0't0  R!0s00s01,Ѝ00 0  r00  r0pG P$wp7 b0 0'l h0h  0'0`@p+Z먓8d( (,C-Mp`p@P& kPP! 0!0 0r 0000 00!! 0 04000000o@PЍЍO-M@ 8p;PPb 0ء00岡S000 00 001 1ᰠ0CS`7*v0Z> ء `PF 00Q0岡000 00 001 vP. 0 0<0 00!VppK(ჶ@PЍl bh0h 0'0p00100@Php PO-dM`F0pጀH @(404 SL0080B rPUp X?*$1 0Cs011 " r  0 0(0HLP0S  a,ZG 9)00 9  0 $00 00 00F 1pP% `V 0`00Cv`dS"U HLp  G PB > :$dЍ 00封10CS>*0S00000#R `V 0(p,0 000CS@!1 S 0 0  !VQr HX㨀*xP∀ Xⲁ \ XTP3/ 0 0R0 0 0 01  0 000 궄HX 010<0qpGWp1*< wp0刀pqpG0wp0qqpఁHX㨀*0x0,0LpS] (0S  2 0 %pPA   aZF P 궄HX 010<0qpGWp*W  0 0 sP:<刀1  0C s0 11qpGWp*wpW  0 0 sW0Lp 0,0S <P  6 2dЍ 0 S10C$ s01 1 R00000 0H0o 0 P 0 0 0a 4@0p0 H Q @vaHX㨀&*x0V* C`` Fe1`010,0(p?a` 000000 ,2b( 0$"b2wp  0$^!b1 0$5qpGWpV*wpp10<0qpGWpA*wpp10<0!b|1| 0$d!b`1` 0$0  E 2 (00p00S 'P q0 $ 0$0b $$0 1i b0 0$ b0 0w$p00WPЊȊLPd$8 |ThhXdxO-M@p  PP` 0S@ 2 G$2002  @0 020!0Qa S   k`PW A`@DT@)*t0@0C 0x P8 0Rᴀ  崀X 00`10CS@*t0V 0Ѝ0b # @T Ѝ0b 0 #Q  0崀 Q P 00 ,p@-@`PP 0 00(0`0Q0(0pO-`P,MpQ `00 XX 08J  (0HX񏐕fb0HS%00@,Ѝ(0XQ 7, ⨷㤧0 ! `X 0`ሀ 101 `F0`C 1 @P HX㨀: 0 b :# 0HX㨀:x 0 b㈀ +#a1`F 0V`1 : 0 b #1p,0l@h 1R  10@10 C1 <@P ! BR : 0 b" @ "2=rυp p p 2  00@c  ^0SW 0ST 0 p@TO @" 0 bp@@ 0S  00t @P/ XG !XD X(0"YZXu  ZX! @P 10CS㣀*0Hs X ᴒ @!0 @(0" 6@1 @"v` @ H r "o(01ḑ0CS㣠y'*z0Y 각 0`H @X㨀: b>" @IyX0  X n@P 2b"0 "괒, @ 1 TP 0TS?A T0D 8280002 ഒ,0 @0 1 4@P{ 1ᴠX0CS㣀z *x0ZG弁 X0H o 0b!1b!0 !I C 0@r aXX  0Js W10 C 1y @P4 10CS㣠: 0 b!10ⴠCአ !10 X P @ @ @ 崢} |x@x|ľxwԾDwO-$M쵟p@,0 01 PI 10CS`00*V6 `s`V P @ `Ft@@ 0P 0%00 10@@ [ @Kt@$b0 ! r0@ 00$Ѝ 2 P [Qi10CS@:L4bH$H0 t0UQ 00P *P @ ` a= P 뼡0 S00 300300300 v00C T뼡0 S 0J 1P 1@Z0CS`:0b  " PQ@P Pm 10CS@j*0D@  1PP[ La0 S00  ?a 0R P0F 1Py @VT 1@D Ut@0@CPE 1= ȡa ` 1@DUt@0PE@C1- @ 10  PM 10CS@:H 0 b0  8 P1b!0   (0@[0:1 0`10`@C1 A0P 0Z!0 s00B!th(txlsԸq\p e00 00/ P 0@-P`8@(P  0 0 E DH@ DX@ D+0/xoO-p 4M(@,2P$0 ``0p  pP`@%0f#"3?0,"0 \00#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝn nA-@PP$ p$(aV!P90)  B CI0 CX0C0(0 0`0$0d0K  E B03?\0h  08R(@R )@ b+P0 C C CC)8 bA-`RP 0@P~q @g(V=: @ 1( $00 $0@`F`H?V5p"/ ?VC(@pF?p@pp@0@ 0 T   0$ < 00T$0?`V (  0$ a0 00$0?V@pF?p@pp 0$ @@< 00T$0?Vp CP 0@-Pd8@(P  0 0 E DH@ DX@ D+0/in p@-@P X00m]`\  0P  P p4i 5O-MB`0PH,P}0< P0P$(P4PP<4 ,P8P<``P P 08 0``( 0 ,44$0pM0&)(Ǡ'Ɍ(@0000&7 @90#()',+$0#+$,   0 ,). *  @0 ! 0 *0P Ϡ) . %̠ PÌ 4@ !$$P $  , @ P0( T,PP38 @0`~?<`008 0<  PP @@  0  4 0p000 !1 !p壠#$ቯ ,)* /3(<ᩃ( *1笩ဦေ 0嬾ᇑ1>*1 96,à+͌ +%7% 9 ,0# $$ɠnj (ˠČ 0#ˠČ (  , 0  ,4  00!(p0 0,p/.!.!~rp'/!!(,#̠p' )Ì   ( " p , p ,8p 8$pp0 $PR (,]< xp|`tdphPP l@\T@0LX+; k{(rK [p xb|+; B ЍhPfp@-@@P`DQU  0pRPQp biQo d0P0L0@H 0D0 0p@PR Q bOFp HA-`Rd @0@Pq$ gPVG: @0D 0 @0D # H00H0L00L0PP`F`[V?p"9 VVPpFppp PV@0D ;@0  S0D *H0L 0H00L0U`V P ;@0D a0 @0D # H0L 0H00L0VpFppp@0D P;@0  S0D *H0L 0H00L0WVpA-@P` PA38p@<U p@-@P X00k]`\  0P P pL_BA-@P` PA(p@ U v03?0/@-@ M0Ġ0  0N 00Ѝ@-<P1M00AP@;P񏐽 U L U0-*'<9630-*'\YVSPMoka^[XURO%"1/d]VzP;DPnE@5Py|{xsrqponmlkjih{xi{POedLl]\[ZYXWVUTSRQPONMLKJIHGFEm\7P 7P 7P9@ 000P$0H p H1ލ3P 3P @ @1ލ= @02S, DP=00  h i@ 0H Ϡ up h 0H  ep ;? @ @ 0H Pp HP 1ލ d \@ 000P$@ 0Z@ 0| n| l| j| h| | | | `| ^\z Zz Xz z z H㨊PC ]H㢊P= Wn Dn D@ 0h :h h h h h h h h h h &h }h 0 @ 0wa ra @ 0@ 0t@ 0  F     EDCG+*)(&%R @Р @ 0( ( 0P$ 0H  E00pH  \@ 0eH@ 0_ B <,`3$3ljG- M_P`p  MUY xB@0S @P_ WP^ L 0S8 P Vp5 20 R 0PX U`d  R @ W! @ ! V ! 00@ോ 㩌 ЍV pU0W L1P0 W@V ! 0S1 㞦0P` @V0  0S ㏦0P`00TT  00XX W0`t  @Q @0` TT 꼃 L2214  ܂ t 00d0H0 p@-F00@T 03/@Tܧ.PP ק|0@T 03/@T\*pɧH00@T 03/@T$ p | 8 @-M@@P Ѝ 0  p P00A, ,0 Ѝ.UO-@R MpУ ഁP `@80 S 0SI: I 0 Z 0 80S6  Q?0 5 0 0 Ѝ 2 Z   0  0 0 0P 00   |P00 2   ᅦP   ~P  000 0@-R M@P Q\   0 013/Ѝ0s/r?  ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p{  PU  b @TpP pPO-Mq  PpG 0 PU @P U `1`!  9[  0PU0  ЍЍA-0P @ P 0 a`F  P pV @D: z P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:Ϥ080pO-@R"|M2P 00t00[ 00S80S `X"P2 0 t0 30|Ѝ4P`0  P8| 0 1\  8 40`00 0 pW`: P8$[= * *J1'0` !  4PU 80  P@R88P`0XA@ ^ 0* *J* "@R080 :0 S p8P8I P8pὢP 8 ` 0`P p800P8+P8o00`j H D@s O-p-M$ ) 0H 9,0020L2S(0 PU 0P"4S7S5p90U 000\0h007 P0.0Rd00e0 0h@00S dw0P05 0CX 0 ?01H0 04p 0S000S1!R00:X Y 0dc/0.0c/)  00S 0 Yp!SRPU R00$ R 00N"00'7 0 2 30ߍP2S`708 R0009 4P`4∐\ 00400P40ء 0 @ p$ 0`U:: :J&` #S6P06_V[0ࠓࠃ48U00St  0\ X``VP ` p` pPP"X[v  00S8 ^(( ^ %P`00S !SRPU 00$0S00m8Qp 4Zv ``` Zo XPF 0SS 0 PP Z_Y0KX  R&c/P0 0# Y, !SRb@T 00$0S ,0S !4w$0(0S (0@TP  U P!SR@T X00$0SU?00 ZY0 0dc/004 p 8Q!SRPU 000$0S-00dc/pv@   p0S 0` E%C"0`P0S(UX`P%`VX`P2 08@ 6lRP:P00 S (0(``` PC_oVRPU 0S0SS 0 8080\S P \`0P o`!SR@T_ h00Z@ @h L`Y(0P`2 ` 8@P@,@ `Y$0S00<00S0!SRPU y00$0S)@ `@ Yu8 Hq t o ln j j A-M`@P`@p`@,0 0000(000ePЍh O-M<<ß@ T@'S`PppQxpn p( s20`0Q  P` 20@0 f 0S SZ0`|lŸ <@ЍOhT 04SD:`XB( p~>Pp  T0  RX 0(0QP0 P   PY   T`X/oTp" RP@ T 04S`X# @@@0V@ 0 W 1@U V W(: 0 0 0 30"Ѝ-@@@~`@Z X _Y`@` | T`I`~U q 00{ Hĩ 4 d 0-  “ ƒp@-P@Q c0P !  2!0 2pp@=p@-@P` VP#p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/R00 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/8!81@- 0MQ020' 0S0. /!PR*/ "RR @/ 1@t0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ < H QRO-P00P00$MS` U  @b"100000pR0ppP0@⠰P+` 0 (P  5/ P 5/ P3W00X& 0 0H AQ0Q @`JAQ!Q0Ss*R*0RJ: 0 C5 0000  5/ PE 00`X* 5/PW W 0 S 0  0S X W 00`F W0 [W00|00S0R*R:  =W 0SW  0\NWH 0\0 0`J CAQ!QT 0CS 5/ P, 5/ P` $  00 5/   P  5/ P0K    05/ P  5/ Pڈ0 0F05/ Po 5/ P5/ P 0WC?0[000S0T 5/ P`0`Zn$Ѝ   0 @w K! 0Q0 0`J CAQ!Q 0C!0Q00 0S 0 I 5/ Pn5/ Pg 5/ Pp5/ PDh 5/ PP 5/ P. H0哐$ Tc⃀ `Y*`  V@ `5/PzW W  0 T0 5/ P5/ P# 0 R0@0l< <0 (0k$ $0 |J+Hx x+$xR Q0P:Q0Q:@- 4C-S MP@  $3/t`0  w QP `I4P4S  $3/000 Ѝ00A-pd 4V:@T@T 0P0S  00 S  0@P0`0dp@ B ! @-MP` p}P)0: S"(ٛ@P ˄TPKQ+;@bAl(b`ph`C@\ 0 tdTЍE00@Ѝ $$4/p@-P$0r0" @`}Pp$U04  0B0 0 1R  0 p %  00 @뜢 t 0 ASL @- 00S 0&4O-SMz@ApP`ᇁ0S*0S'  TP Z !P0 00 Q   0    ЍP? $ 0  M QP0!$R P/(G @p 00q000S0 0p  4 S  $3/Ѝ m00h00dO000QA 000/0@-S@  R   0 凛0Sႛp@-P@T @T 0 Tpp@T3{P`p  0S S/P/O$(0c03?c00 R  0 0 3??oP//  0S RP/O0?c0 3??oP/@-@ MRpP:Q !SV@ЍA0 0`f P F<@Ѝ 0T @0 0O-PP X 0S ' & 0S# p@# ,0aT T 1 !3/Pp@DR00C0S T,0p@[P ?0T` BB \|  i V`! o 0  `C``@ 0p0C0S 0T `p@QQ  \ D R !,03/`PIʼ0@00 "R( Y `10`!P0VQgRJ,03/`PY M 0p@D0C0S T@ 0T p P@0S*V*  000P@DS*`A 0`V:◙0P 00``F0 ``i  0Y0C00 00oP   0 0C0 Z ` 000YP sd0G` `0 XH0HD D0 z 00_ 00[TkXk,kp@-PP& 0 `V @`0@D0T0@T ,0 3/P`ʼ0@00pD0Spp@/0V 0 9 Xj0@-@PP MP 0 P* Ѝ0L P 0080@m},000Pe} Ѝ0H R0 q R/ S/p@-@PQP4 100S- 0 5   0 P @P I0 0$0 s0 00R 0   p0  0c0p 80<4 40 cpl h@-PP0qM`@p' V/ T7 p p 8zP0 :CRo/  S L 0( 0R Ѝ ; 0 Ѝ0| |0 w Vd0` `0 m TH0D D0 c ;0( tggpgg`Hgl#l3 @-@P`SlM0P0d00A 0 C 00  #3 0 d0 30lЍ ~0p0S6 `0P "V 000`S0ppppp>P0 pppH"|D2D 0 ,"(2( 0 `0S$`!@ @Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00  00 %   0SP pl 0M ```  00 `XBP괴 ̓ H p <0e)eed0 0p@-0PUp@0/{00TQ=|0`U TQUP #{pX1P0X1,|0T0`X1 1!0 0S/p@-@0MP{00Ta|V |0T1S OW{0T1S |0`{0U0TX1 \1|0 0U\1X!0 \1X!S Ѝp@z\1x 0 0 0S/p@-@0PzU00 \A\Q X! BX!R p@z`{00OT! {00p@z` \ \0 -4M0 0,008 00 0 ,0 304Ѝ밍 H p@-@QP  ,Dp@Ex09 0  h`O-M`P8@@pp> 0A0M0 00Ѝ$ $ 0 0000/ 0<0/0 0000/Ḃ 0<0/0 0000 /t 0<0 /0 0000/0 0<0/0 0000/ 0<0/0 0000/ᨁ 0<0/0 0000/d 0<0/0 0000 / 0<0 /0 0000 /܀ 0<0 /0 0000@/ᘀ 0<0@/0 0000/T 0<0/0 0000 / 0<0 /0 0000/ t0<0/0 0000/ 0<0/ @/ /H-M2 0ЍH-M 0ЍA-`p@P0@T@7#0PP@-Ϡ "M R0# 0 ! P@,  !PЍG-Q `P@ S V (" RpSQ P` 0Ck ?o/o0CS 0c0<ÁVS' /o?o BR  0b0<ÁppϠ0T0S?p?ᬏ0 Q RVP00B  V 00T# 4o 0a08/o?o0Cs! p R 0b10pÁV V50o800@b0q<à)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 8@-@ $00P  00l2y / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOX 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 000Q0@- @P' ST0 C0 ^@DP \T0L^ Q^P 00PPQPS@R S Q0 S0 0 /U/ S RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P TS Q@DP  ST PUPQ P00S @Q R U// Q#/ C//s R RS 0 0/U/0 00/SR Q 0 / 0U0/ 00/0/R - /p@-@RP` R V  U  R 0 p0 0 DPRQp@-`@P 0S0 000 0R 0 0p 0  00POR0  S 0Q 00S00/ 00// Q#/Q- S  BP0C S P QP 0U0Q- S Q P 0S 00P 0| 0 @-M0@000*00pp00p p4 ,0 0 0 30Ѝjo Hpo @-RBM| č dd  @T  5 PoV3  $o HMpM8(0 @-@-`@#Ms MP p $( rN TG " r @$@"p `P0 "l2 0 $8 30ލ ЍB^T"P@ 0p n0 B^P.!0 3100A@  0 \0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\q~2hn H@! M Lm H$ & L 0 $0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A@-0@0MP @>Sl BT 0 !#00 9P0ЍM00dg @-0MP0@ >S  @ B"00!,3,0 P0Ѝ*00@-@n@n0 00/Pf ,0,0-M 0 000 0nЍ0f -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/e @-H0H 0p@-@0P pbp`h0`ple h////// //1O-0,MPp`W P1 0 A A0 (05/,Ѝ@PK 0S PPP S0S2*,! 00S S' !S000S  0S S * RpC 0QW0010 0 'S0000p0l l0 )0T0P P0 땋@$d$BXtB0000!Y* Zq= 0 0,0=0040< =<;:987643210/.-,+)('&%#" GbS]L/ jkXB 0<@ 0P0p<       P  $  Q [: R} W0 [ 4S0C0S Z0Ԅ0˄PU*0\ 0 0CS0CV [ 40S*P 00H 1!00H SV00000 0   0 /Q0s- #0000  0  00 0pu QPl@Pp0 S 0 S0G~   P $  [* R  BR B{0 [4 R*u0000k0<b 000s 0 ;00SR00@Pp000 b!0000<0P@T `v  0P 0CPV  pbPB0  0 00 x04000  q QP0 ~0<00=0 m 0 0 000m0lX 0000s0;0n0<@Pp 00< 000]0@00X+00T0 R y0L000G *X 00H S00> 1!00H S50S 00. 60 00 0< 0} { p Q\ ` @#2>""d0F STPCpB0S \(0, @ [04    BR B  Z˄ R* R Z\  W ZU 0Z˅J`@!0 00 0d0SQ 000D0@B0 S`@1!:0\ \L@$pᐁ*A0S(" 0⨀<0dW000d? *$00@D0  U0  00000  000 0  +  A0  000 0?0<  0, [00K0"2 0 0 30 Ѝ0 0 /     0 P0 ~H200 0  A 00 H00 @ s0  0 0 00@ 0 0 A@>!1 0Yh!d1d 0 PpbPB0 R 00 % @" 's0000 000 @ s0  00  @p/s0 /0 깥T0 0Rb HxdAH9W @5X5x,5A-P@@ x0`pP@PU J0PEX@S 8/`upW$0: 0 FT 33 0SS S 0R / 0R0@o/ @- oO-p !P1CM M@`00440<@ 6 0 @0 44 30*Cލ Ѝ0`P 4 P)P Pp 0 dPKL+ m  0m/R HR R L2TG-`0S+ S'QU$ pW!@0 S0P@0#S0S 0S0S0S# P Y Q@0 0R!R  "R R R \O-0ഀBM⸏xMXH/ P`t! X' 0 pbP@P UDcAc0 ZP?PD <0 0 4 30BލЍq`P HO O-L!H1 @ AMT M00400?1 Y.: p`x (R5 P_0#s0S"uPU/ 0 0@T bb 0 P PU $ 0  (bPL D0 0 4 30Aލ Ѝ x (R <@PL0Py !fL0P0   8 : X0T L0x<000SJ0`0KD0`Sd0c  凿`@p  0G$0VG00  P`?-$0G A D(4, 0i0 0 4000F00KePPA U0R0  QN `1  8 d9T0 X0H0U[H0  "0H0G $0,0 0SE0@ ( ᐐ#/E)b,"eP 0S @0P D8l(@' 0? # Q3  0 0@ P0`1  8 7\0 X000 04 0P`1  8 x70 X0 1 01 0H0@`00 @ dP 0 P_ O00 0 0`04PX80&D $X ͆MP0@@    0 @0q10 @Wؑ@D0 ` PiT!> 0v/$ W G U$   0 X$ 0$ 0W 岏  ?v@ Š000o 8 4P|@ X070H0 -dP0lL @0P E8p$@$ 0@  (0l00H0/8$@# 0*04 2! { `1S 0     0P0H0 PH F`!!! QB   T38 @ X0 [ 0P RI G aV @*Px 0|@6/P`PT7\0+S .0CS@0PPuPU a8 H2@ X00`!8 2@Xૅl S0d01SD 3h0h00S S`` ``P19 Sh0 dPG0 h0NcP101@PDp_pP 0@ 000 b@00P{00P 㸐D2HM M -4-l-I )\'|&&%x$#h#""("!!4DT|p8 | TP0D Br DR bP0l0P0@@ l06SV `p$0^[pk0P0{ D0P TP0D Br DR bPʬ0l0@0P ׃8H!@! 0҄} RW00 0R 0`1 k 8 10 XP0[0  SY᪃8!@H"H 0⥄8 ,2 X@x0p[0  4q$0 P RP0SkK=00|8"0" wd Gr R000 P T Br DR  R,#bPʏ"p0 P @ 00cPhP 1011S100u8 30 X008 44@" X@0[0  <0l0l00T00P8 x4 X0`m0J (0l00+S .0CST@0P& 8%@,%, 0W 0p0l0@0P ̂8t%@% 0ǃr `0l0`h0 2 g8 5@X௃ᧂ8&0& ࢃedPb0@ ᒂ8\&0d&d ^/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/MϠ-    Ѝ/0@-,MP@bP,Ѝ0PbP ,Ѝ0 0,Ѝ0@-@MbA-   1 ЍLa/O-P #3CM M,p@0Xd0,401$D D$ 000 S  - 0p y P@ȡ0$ \0u PN00A  !< S 0 \4 0; P0 00 00; U P00 [ `P10,430KCލЍS" [ 0?s0S0Q. Q( Q" [      0/?r s0Ͽ|X~[[[4 H2 dl@PC-PH AM@M`p0 4" R3 O0 @ ` P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R@@T  ƀ@ @ J[ꚜL1 H0 O-!1AM 堡M0  0 40P`pPLpPG `กPPB @ t+0CP7 0S4 `  0S+ 00@ p|7P00@S 0S0S 00@ K@ @d @~ zD ,0 0 4 30AލЍ"/ H/ pP. O-p#3CM M`P0@X0,40\@Z0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $jZ000$0D DR @@ 0S+ .S& 0Pʔ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@( 4P/d!  0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S YV0 hO0  Y"- H- O-p0\MP2@0`$T V0 DC UR3*@ pϿ16 /O 00V 0 P\Ѝ@"04 0  VV X0 F0 0XP0wpsYY0崐SUPP[   B RX00 B 0XP jYgYhYaY PAຐUT$0 `F 0S0  sOYwLY MY0sEY0S 0 s <0PAUTQU `0\ \0 1\ЍP<0\ЍPHUT) d l ̶ C-@0 Mp`(P,@D T@>)Y?XpX뵐0 % X  @`DX0 /U ?R0s0?0  ЍXL H0H 0  Ѝ(|`l p  8 G- pPᴒ@Ḃ`6 F0SP`?0WV!;` XPX, 0W`E0V0S?V0 *vG`EX@T@V@T d =`0`  0H/< A808 0 z`0L$0O-䡐 MP0S5 @d @V%0V@Q\ 0\\"  p偣 pp p $P4 O-aM0 MP@060&V0೟ T =0H0E`y@01',d!n d! .0A 0`11@05<0yP 0ʏ 8 Cs@p d1 2d1uPZ `@ _`0H SD@_ S\  S S00 Q@0S SP C0SQ0 0CQS0000 0106|P 0dos 0,0maF 0aGn!$Pm%F s/r$G o t)F( s%r&G4 / X  + 0=P 2#S;S 0S" 0 S 0 SV 0 S 0( S0 o>R00sS2 S S0 $ i>R2 S S 0S00 S S SS@@ $P `0J_<_AP@ t hP ̭4(vt H04 0S? e2R2, S S800R00S 0@0 S S00 PP0S Sk  P}_05 C0  C10`X1 0BPQTP RM$0P ,0TP ,0R@$0,@7$P ,0 S 0d12d1 AX| E1|XZAp 0 τw`0S X `0`H@DSH .S0SX P`.HX00V0S 0 KP " 0"002 0 6 30%aލ Ѝ l9s4GRB T T 0 SH3L`0@0<0\3D0000Hp0` T T@ TT  ;T R[@T #P00  ;T 0s000@@T  1pP 00CP $ X0們<h1P @@T;T x4`0 0s000@@T;T   PX h!2/R !R/$ 0l!0@ S 0@DHpL`N c8R[2 S SW 0SC00 S S SS@@8 $ `P] _AP@$H `0DPS \R=* S S00 QP0S000mOrP.P `^1  : DQ fD@`9yQ, 0 SQ`@P $ X0偑h1h13?S 1/S$`jp0pP-`Q$0 2 {86SQꇔ!1 p@-Ph@lHMP ^ T 000HЍpp Qx#r cXV p  X0xXPT $000HЍpqp,pRA-P 00P00S0p `V pP0\\C\ `@`@ ꃃ `` 00/ @-@P @;00:y ܡ0M 000Ѝ\ @-@P,000M 000Ѝ O-0P-QM 0 $0P0$P$`V pgu0P0 (000@   CP~ uPY( RP - 0 !⌰pG#Y $0`P  `P wuP ` R Y@ 0叇"0b W : pG`^ P@TP $U a` AT #Y F @TpG d 0  uv900pQߍ P0` `FQ* @2 " 0 ^@?Y8 i p0 S叇 :@C0 T: @D 0I P崠P`p   ` V@D R 0  8 @  p P `V @D U`  0 a U `   T @D*r0 0  uu 0  un 0 h\p@-@PP  P 0  p |0 0 Y긗`p@-@PM`'  0P   ` z P" 'P zBP 0  Ѝp|Ѝp8 404 0$  0  ЍpЖx@-`PtA M@J h!h1hQ P0p0 SpG0S< `QZp> ЍA@!tP 0tP 0S@ R @ tP  A0Xv Ѝ0   Lv Ѝh0d d0 PP P  ,P4h hX lp h0A-0PU" 7U"P7UP!q|@@``FdtP $\tP 0!E`$1(`P 02~PfTfO-M 7 G@`P000 S 䖟 $0(@600PE 0 0FTڜ6&0(0p d10@PY %-7<B 060(00 ƟAd  0@'0J0( @P@( Pw @0AᨥS p@0S 0Sj`6S 0S0S S0SW 000S*P00]0 S 4 0 ( \ B/*0110SL TA00 S^|40( p40 0S p T4T$0@8C1@40(@(000F^ 40( Ѝ1RCp@ 0Q*# 08C3!# (@(00Q0001Rr8 3p00A ǒ\ \#  G S:p 0(" !" @0(0Ph)20( 20(0020(00t20(00`20(00L20(0010 ,20 (  "0 0(0 (1 0( 10 0(  0(10(0 R 00! 010000x1000l10 0Xp 0( Ѝ'p B"p 0b  R8Cdg7# 0 R0C   /t8 l,e|e(eXddXXcbbbdb,bxȁTaa`````p`L`(`____,Pl_X!X T1O-0 $MpWG*,1(Q0 AP01o@0^O, 0 ^/@5> 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X,00 $ЍX ,^\(0 $0 @- ttmq P/0| - 000,00S1P00$000000 L\,8p@-@P0`T 0(0 P0S  1T  0C00`p [0 00/t P0 00/T 80 00/4 p0 00/ X0 00/ ,0 00/ P0 00/ 80 00/ p0 00/t 0 00/T Sp@-`0P@P  PP 00|p>tSp@-@@`V 0 CQpPP 0P P @ @pP 0` 0`pY G- @P0@S  P 0`<00    d   80@p`pЁ P0X 8X,`Xp@-@0P0P R \p\ 0!0`0 0T@    8$  pTp X@ W,8QA-`AP@TpQW0C@P k (0PP pABC@p@-`@P$P U0D @ S000P   pda@-@@p@-@PPPp00 R P  !00L0 0@@    $$  p8 UU,8R@-@PL  0S  T0S@@ Up@-@P@P0Sp Pp!S0C0RpX00!Rp8  $  $  pT tT,8p@-@P@P0S# `0 a0S  PX0X 0D  (,0 0p0T4 SP8p/ R ` 4 ``0 0P A0, 0`3 00p ꮀ( ß( 01P H  P A `0 1, (3 P00 ` , 1 A@@ A,P( PX2P |d@2 B@,` oP T ReP` 01( 0nP` 0 ,`A1X0,`1@(P `4 @@! ,^ρ~0 R  @ PP 0  PP\105>0:^ ^810 pz($0 S> x008 @0`0`,ST ,X RQ܇Q8pPP8PPPO\OhNLNNML<LlK,KJJlJ  -0 0000qp Z Z 000@妥$L@PЍ < 2R"00@ᑥ\ 2: 28iMP0 0^ 2< 21 0 010010 01001001  B 00l100P 0 R00   0fT 0 2 13/pT`0-00ᴡPP ` 02 2q00@Y@0SwZy 2: 2dܘPr 2 @0 28001,00L DH8G`C-`@ MpPQ 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH zP (0$  (p  2 00P9 ЍP Ѝ#00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-`@ MpPQ x00U,0`V( 2S * 2 P13/PPF `P 0 p 2 00P Ѝ J Ѝ00PO-1PMS-:00 X0*q`I`[ =p@ p W  7 0= PtZ 2< 2ЍjPЍO-MrX>*`00Q̱P@0p@ W [KPE iP0# ̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍiP"! ЍG-MpZ Rb'*Q* U@0U @ RD0 q P X U 2< 2ЍE@ЍЍG-`p@ᴑ 0H PP IPuP 0/ @0 @ 0CSà101aIz0S0Cs  0S001R@10CS㣐+*y0/ 0 @00CSÐy0S Cr   0Vq00R!2 B!0C2Cph0d d0 P bL0L 0400 00 tsr(r<p@- @TP ` wPP  pPp@-`P@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q _00 Vv 2+ RJ 13/p* 0 00i" "0$ 0 004 p`0 9/P 9/P eH0  ^ 4Ѝp$  08qp 0 $P 2: 24Ѝp`?(0 0,009/P  S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!AMpP V0 < 0(YO-0 `tMP/V@` 0P(0d 0  P0 \ (v`0 000 00p0SMH@0P `0 PP H pPp朼0 0E0 0Pᴀ  Rڴ R HD @A0E Pq 0` v`AL0H0봀(00`p@~ PX 0,00 $40<8P00CS0s00 R*< @0 @ಐSr 80 አZ8  @ಠ0, 00_0P,0 \f 40|Sf 48,0400<0 \|PdP00Q0  00R`P p 000z PD0 s00᳐Y;0 X0SPB CTP P\嫗0S$0Q0  00R 0P 0Z 0 $0p 00040S,08400<0 P$] P^40S 4,, 0 0`00 000P(d0S 0$ ``0V$0 h0pS,0 40l0Bs0@0@U:0@E@0pP( 0000 000tЍ` S\0\ L 0! (@ <0< 0X 0PSLDXS4 O-\p? P0`S0@L$P \a `P' Y  0z S40 3 0 (!S$10$10 10 0S0DP  0P0 S04P  00S 1$10$100O-MP@Y000X00 ``FV*Yv`s @$  8$ 0$  =0p岠00`00PP Y!```0S S 1 !r `0Hp0 pG0wwp湺pF00F000 B 00p@0000 ``FV"*Yv`+ V0  1` !I`Fvv`攺0p0wps00አFZ`p01:0y 102"v`0 &Y00``FV*Xv`T hhh2 000X`p00ഐ00A00000``FVA*Xv`2 V 1 !r0SAq 0H0@ pp6`0`v`s0p0pIW㳐`01: 0 000SY`00FlЍЍ00PP @0 0 0k 0 0 `0 b0 0e 0 0|0x v`t0 XjꌝQ8ܛOOL (NțNdMxMPdM G-0p`@PQ"  0\ϙU@ T9 0PX APQQR0 B0Ӳ0Sr 00ô000 0 S CY 01*s0  0000cUU800C80?㉐CY 01*?N8 404  0 0 S㲐lKDO-P0( 0S 00Cs0Z@ ,WPI Ș 0S"M@P  0 S 00Cs0 S  p`V S@  0घP@@A-`P 0@T@ Tp Q Q\ PTG-@`P 0S 0S  0Q@PS" 0 00ᲀ\S: 0 BS P= \0 ИP  0 (!0S 1$!0$10 PἘP 0 㼐@pᲀ 01p 0 S 10 B\ἐrp ᛘP $1 (!0 $1E00 O-\?  M0P`p0CS0@L P f^ ]P& 0 0  eP 0{ S0 6 Ѝ0 0S0QP 0 0P000@- M@P p10 Ѝ0O-$M@ 00p P`Ph 帓  P`T0S !f1 0L0Z0 0@@   0 PUM0r PE UHs 02*0 @P@0000S 0C⸰ s0PPUp02*0 P00pP L0Z$Ѝ 0 ἗P` }0 09x t0t 0/0 PL H0H 0 !0 ETLD$$DCȏG-`"2(M @0 0$00w?0Rp2S:0JS ^PP 2S }p 6 GP ZP崐7 Z1! BRE:0CS㣠5*z0Y(:ቐ @1p01 p@” 2 0„ 2v !1 0 $0 308(Ѝy C 0@0b 0 z0Y*0 p処P202 fp  0000`0p 0iy봦 H( mAA-p@MP`Q 00 2   Q `:1Q嗶0" B!1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E E0P VP V$P 0  Ѝ00Ѝ0PU Q:(0 $P0PU`PZP  [P 21 s!\@--M" # @ M;xx  0Sd000S 3/V ;<=|, <8 80 0(Q/$(0S/ S =<<00 R/( 0S/ lS P =-AF hFF #x /! FD M)h1 J#F I Hx F0khBF1F8FAG5PRR -OFhFI W M*F1F FXBыK8h$$*m" !   0^рI B(Рb+I+GFF"FFFFF&F+FFFF05FCH:" 2h*6H(a5L2h>F O !OFbh:b`*ŀ FVAFv )@($*\ -t/@ -@,$Z^ 0]I 0X)F/$*p$'*@ $B JIHJd U? $"$ 07 %(FTT vT)' 8 T  |cXTTTrTT, $Z$ -  .I/HJF d SբR )H" "`d S?DE4 F&K' -x'$*- M .0- )0j1 ^ 0-E@? \"hP `x=碉"`0F>T8 rT-OFhFJI VTK$J&FFFFD!(F9F&JCK^R(7G((>гfO  9h(mH8 (Q =cO Ox(e(X( d(!uI hO sI hB:W" -ђEђx ; `iKh- (,й6*aM F:0B^I"FI B F(FJ[,!FY&3IF3H j0K!hF`cp,IjC*Ij+)I#bW%0+@𩀢l#l*H%F@K #lV<ԣlV<0F`#m @B+l8F5FE)TC`0!X`____ ```)'k*+#m+Q!~Feccl{@B!(JI `ObOs*@Bck'flYE@&k.@EckB#kcccl(9Ff l](9F Ta `Z"((@B}F@AUxuI >@I#ccV( ( 0hFcm+1hjH5hpCO(F F5hak(F 1 (4l  j(F^8cm+TH)FlbZ 0cm+NJ1hNH78FHcm+GK:F1hHHcclЕ8+h0BF.[ШhQF,2L,.2L.02L0 212B2242 [B4262[B6282[B82:2[B:2E`9FZ6xaarT"a:aXash(,hD#2B23`#p( E(S("IFH s( x(фIHKh|K"zK""xK""uK"!3; @ 2(NsI B! >pI :oH,F(AgIlHlH(,^K2#hJiI_HvZM)iѴ(tUM1+b.@SL]H!F\H0F(S23SK"VI FUI AK" hxh!Fh7( F chx!+"AHh+/I9H@hx+ (7H6H6H4S2kL2+T {h2!!e  e)'9C2!(e,el5!~a6e:eQe)404! drT8 db "M&"L#H)Fa!H,0F(2+?PK(F"IrG 8K"IHfJI H` L H!F (֮J2+?%K" h2!6e:el5!Qe~a-AF hF/! FD FqIF(BЁ'mLBF1F(F(CPjK!hh)𗀠i-! (***BBh:W"P+iF(F :(@pC O@x#`RI*F 4PJ1F(F0KKh*V#Qh 0{!F w(e(L(2P(3F(,зIf8(S ___________an#c`kg`i#'aca`d`b#ga#a^'`\aZ`X= a jai)gcIV#byh"iF(F F(upCO?WB F")FCf6! rTT[fN-OFhFfI U %C4FJF9F@F*C ]KhW#pFFF-h!F8F B  (1h^FQH7h/U%m(p(OйJL hF "h GI:@FPFU.FFAI@F?I PFB`9F'HF[/&#&8F (/! pAO!`!F8F 0[/0Fx+p^F/c.F0h!F 01h^FHbT rT)'U|^wS-OFMhFWI UVOVN%:FAF FLCSK , NI0a i , ihX*ui( f(h(йv(#s`a"###SI 9U) ,F(pCO U)@BPFZoFU)  )I( \|!ܞU-GFhjtI TtsNtK$tO`3h BY#9FPFZFPF.EkJIF(FB2hf(.cI a+R#$! (  PI$$MI (KHJI (HHGI (EH,У+h3M=M#3hq+F(@6IPعv*hh#x320[ FFFZ!F|#3I" F aH!F&KI P(Ht T rTBt @ht@t@¶, ԶͶgt޶)'hT -OFhFFI TPL&FF5FFfx `oSBSAJc`K9FXFJCKтK + iֱ+\5h0F 0@uI2F R(&G((1H8 (Q ;;;y;;;;O%h(d(f(!v(!XIh!O%OO !%%+=5 йFI :%EO33.chW*+=:!@FkuW*`3x;#+'6I0FA-K`  ")FXFF(@.I .!@F((I@Fh0F$I0F`0@F=ch ``P0; +onn4nn]nn]nh#")F0Fb0FF(h+c ITh!u U)'(Ut!UpTX9F'FPFlFhzHmiB ѠhCjBђh`oТhiGȱ)jHpT/9FFPFD',F+(j'8FrT|U-GmFF]L``]5`G5 `]5`5`a]h@C5#aaH2HFO&AF:F(FAѢi*@}I" 0F`8h7yh)wI2F uOA86(!9'-15VQpī#fB Љ#55#53FF#5#5#5VKVIHF AQIHF@@NIJFJKh "!L?F h"+ BI "!2?Fh"+ 4I "!?Fh"+( (I#x Kh0#m#5v#cas##i#1k#j3#bg#X#V#TI $#iAB%@AB!Ix!a@j)'ʜ:n@G!ai BI h\ Ѵ`hEєBػB# `#55KuhO*@ ~# ` F%b-u%*pX#&! -h)cX#&#JOc^:ڃJI -O%:..GX#X#!I5s PpCO#55>.@k'-@F#5s8F-@FaH`KaJOa`K(F22pBFUH2'WIF(Oq0F "LJ(Fq%OI(F(FLL #3# !E*F  D < f>Hx>K>I(FF22F$ù9I 4h#+ " 3H82  /I/JFCF0FS FB(" ."I2F H21FOrH`(FF(Fv@FFH2 |Kh3;Kh?KFX`CB?CIs!cAHO;2#23=H2+?si38H-O #::*F!U0?RF(?F:!U07`%HX7`d20i+: 0C1hH0i O33ao" 0a01hH8!")' "w!"U"9'"Pb,N?V#1OqH1h:V+F@C@ !@P\:02T7,2P7OsH7(2L7H7'\Ts`L7P'?+钗@<"82.!(2锗P3i`uh;(FR`(4gI*F &fJfI B01hdHfaJcI0i 601haHJHF9F-@!@)F 6GF`WHD0i T5aTJ !* zPJ !NJ8a3023,2 3(2CM\2ӹ#SC#)I1!D RObB\"ZBX23K"Fy()@8h&Fh RO#Fa!iOrPF1(i'hC'0K:F0@H6#+b#a"2*E+@EKZiiBIX%"rdAedAU"8'"'""f " w02o,2(2?+"\@3?! 2JBYCa?0 L '8F 7W(MPFP:PFF(7:: # cR!Ơ aPVCFp2(F1CFяH02  /ъKd2+ꮈHvK1FF\PF9FCCFE5 L  HF( @3B  23B  lKo(Oe(regJBs®Oc\2:?31*?+?䮗0*(ڮ!*ծ!*Ю1K #L Bs i3a(?1B{ FO +a2"C';O2B+@7N ( xi%?@)1I1HF1J-Hd!(@.I ,H(Ѐ*OOjO &3F8F0"bOr#0#3FH,"R?"#,#"##3F("HA(H(В"w " 9m#QF F#2+Db.@uK\ibF2+@pHJoH!mOO O #"F8FFeH/(dK6!.!,߿$0c 03+ 2+@THb2O0?8$)CMHRLH(oKHjJHgMf0FO r}!I F 0I  F   D<`BI  ya;0!+I JTm,  I \ĸH"H"edAոsB-OFP FL'MNBF!F(FC-$G00EH'DKh"! (?I 0ܻAZлCAـ`K"TaܻCL𕀛a"+=AEIS`dhW( o@! "! K$?>I#"EH### h"5K.5I#oB=H### h",K ,I#O25H### hOR#K$ #I#oB,H### h"K(I#oB$H### h"{K,I#O2H### h"iK0E^EEE pk"G)' EEEFFLY8FLFpFKhK[h FNDPJ#xh320ZԝI"FG FFoBH#!F##"KX`yI#oBH### h"K`hI#oBH### h"~K4V{I#c"H### h"zK`FsI#oBzH### h"mK84jKh0sqI@ eKeJfI TKdIPh F,0D4CD4^I F D4CZI"FEL"! h("hTI?I O2QHoC#OC h"_MKC5Kh FNZP4J#xh320[EI"Foh F(K:!(L@FPj /!@Ff8I n0 6I#T4##$2Zh* ""$t"N5!4`<4ZY$H\C@<4x#yh4<$0)'k", ~FsMpFFFF|;F֠FF |(G2G@GPo"QGaGGEG<4Z4HD -к|-y"!Rx"!S v4Os4MU2CR@F0OEO5%4KU#*s@*O @QF@FCFyIBF`R0vIBFX4+,F h iC$YIYi.yRP$I]K.q Ca\I欨BFOaY.F(XIBF XFOa `[f)FOcPJ(0FZLJMIRX0RhpCOEJFI $ BH!^?JAI !F:J>I9I"=H ,;K (KF >8N4{h4x-H)F$ 0'(J/I"*H iIF`( IOr4 IF0( * J  I C04;#X443+4IBp2+C2C'JIGPo"H"HHUk"8HJHpHH k"k"HHH $xIN@Fh#T4SI@F(KJIT4+сI@F(Kx*1p2zKS#Bq uIB`6oNV#KC3 F! D0V# gI#BF2ӱ ka F0#aHAFpOZQFOpPzRF[I aNN04$$T+D*@)O!CIdL$H4rC"i4+DEH2FKFAF.Os.yOVERFy F2FB6I6iy*F*O04ܹ*Oc04@̀0oˀ$_Q%HORhKKS Os۱s۱_sOQ40B-*/ F$4*OqOaOa k"8k"ߪܷҹPo"HAI\IpIII"J*04 4S$O0w( 44#0444 0+ @4+#kJkIlH#@4,4K$4 *Կ,4"F)F@F\k?ХB: Fnsh+?xh +a*F`/МSJ#Fd! H ka +`(VLI +bX )?bOS$4.FHObT4++(F2eо?HO 8Jd!F\" F  4H\$4/Hg0JR,JC +aZgx#<$4B@B0h P0x +a xpZ"8I Xp(? " F  SH"0'OJTI$"PHg9Fd(GOr49F4 y00@JFI C 4+4 ?IC1h2C3J;IbC:Ij 9K-J9I,NGh2Ie1h $0Bq -I]o $ZС#3(F*0# I#2FEr(Ff0tH1FOZQF NF(jIRF|T"HHo"8HpHHo"έHHHHAI\IpIs"i $ 4*@+` 4i4 $+vFPF FAF*F0FjkB(Fb ԡ$ t0w4+5HJF;F1F2OswXFOERFw(FYFJFB%I gwIFOExOc 4 44IFOPExOS+  0IFFOExt|IFOPExII-GmFFh"!pBF9F F*C Kh<,@@85(S GFGGFFGFFGFFGFGHFFFH7IFFFFFFFFFFFF%H9HMHFaHwHFHHFHFHHHFF I#IFJKIhr#40nKhj}KIhbyKh@([vHO2wK!hup0C p0KnKh GlKhCjHOrlK!h]<8dHO2hK!hR._HO2dK!hH$ZH"`K!h?HUHOr\K!h4JPKh NHOrUK!h%PHHOrQK!hRCHOrLK!hT=H"HK!hp0CV6H"BK!hW1HO2>K!hp0Cu*HOr8K!h\%HO23K!hp0Cp0KHF0.eeLO RFQFHFW??F F8h+4RFHFEF F,IJF )'lZZZZYZZ[`` [[-[<[@Gdx+h+HOrK!hYd4W#@/! F2CKOaJ.tFF ih F m)'M[[[-O'- FF:F! %LKP.BڡI b:F! "()F0љH|0іI'FO5FJIF0FCяJh @ @+@~<;+@L(IC84(ŁgP8#5:T[E_dPhCC`"x ( ZI hCc8;C8;xhCPKh8oH6GJ x"  DI8 RS+ ?I~"x ( 7I< 7hCshCSh0I \C@`-Kh@; hZC~hCzhCv8;C"PxF ( IqOsBIhCThCPhCCL`RMb@Az#%:SmH#Z |)' 4"xF( I&"xB* {IKyIhyJCcyH`# hsIhuJC tH`# hJoJ x* ?q iIO iZ#fI#dI2+aK n(?i\I YKMQ WJ FQ`S A0 8`( {*(+ LIhHCIH$2s<+D>2CKhBoCEFFOsH h h3SsEbF”FbPC \0~EC 3+H F<z;FF0F2Z +J(+V; NHC;/N'KF; +; 32H 0 2K'gFh{# |#@#8 z#; C H;IFHX# K 0B  E܇>H FzF0FmJ JDzHD &O0E'8FHF   ;+fYddd-8CNY#2F9F F(?ax): #%')+-/1357bH aHaHaHJF_H1F F\#0'YHYHYHYHYHYHYHYHYHYHYHYH#2F9F Fz(?խUH#2F9F Fo(?ʭax) MH kFJHJHJHJHJH#2F9F FL(?FFAHj#2F9F F7(?;H^#2F9F F*(?6H#2F9F F(?zax)/Hq/Ha/H_#2F9F F (?g!y*Ha#2F9F F(?[&HFq@## %Bc1ARkG0\w#2F9F F(?Hm#2F9F F(?Hb#2F9F F(?묀HW#2F9F F(?{HL#2F9F Fz(?լwHA#2F9F Fo(?ʬ!xrHhƮ1F F0+`+?+𸀏'xH FzF0F]Hh5+њ  ,/ :* DPHND Vܩ oO   ; 3 FF/ e  BF F/A2I+E1JF@Fv@,H :(HJFAF0@ 'E#HD ܪo + H /HO0&6J\qz#-OFFLIxF-+4 F(=ѨK$"`OO FF:F1F(FC9ѢKhBw'>3FS}](FMFV)X/DDdF(Y MIF $I FR(цK"@Z`d+ '*!$DtDOvKh DdDD4D$D$O O XF/(F0YF(F,%)F FXcI .і F(KphUKhb "!RHMbWI2F MUN[h "!+OHMSRI2FMHMM-7OI+F2F MmMJMINHM#JJ#IIJHMH!F! ! ! ! ! ! 08I8I2F!O00|h+1H+Lr!hFp-K?F(FM*I"FF  * &" !O0P0Jh+H .H)F FH0F6$kc rTbctczccTSccccJcccd(-OFMFH*KM(FH whK(F+`;x-+04LMF88F0LEF! V+8LFFO D+?V;pD>V?D;+Ѥ NF$3`+~r+TR+i+C t+x+ {ԑԡV ObPFFЃ C#+d0BF;Fr<^, Fki+{ ?op#HL*sj:FIFH^FH* mQj?IAHPAH"#5;:Hp EUkicj1I5H45K"2H#-H!k(I/H"  2j"I*H$H"#HH3   MObV k>F FR<" aLU8 !gIk($)LDshx*:B FJF Fb/Ik($)ԀLDk@K$33sh 8Fsl+@9F0l"FCF@h7+hFHjO4h3+@0+xg+AH0+= I Jh( F Hx8$$$$"|+_H,@[Kh+XhFXH  LLLLLLL  /FC+Fd#b F- @"p$@I0F>LO =I0FO :I0FO 7IFO 4IFO 1IF&4h+?TWx+?S +?OiQh)?J2a  h0b$=,?~(FFHx80 F#)FC(3C<0C ")F FO B H,Fr$$̍ݍd@-GFh F쀹OOL)F:F0F$ 88 U$)'-CFFIF.FL"F9F0FB/ѡKMh68.I,iLI F I F ML*F9F0FrC ,BF}I}H2}IBF{H,t(p@(A83(S A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~A~#/z(cci+_Osci+X#ca7ci+Q#ci+K#ci+E#ci+?#ci+9 ##c`#a#a#ci+(@####`#`##bKh$`ci+Osci+ ##i+ KIh a(߮#cb  $$H)' 1:ܮ-!#j+?֮chh+Ю&i.̮W)P h)F(ۮqI*F ^#i+chh+&i-5-gI0F(dI0FpcI0F(@-S4-(-=-?S%]s~Us~s~s~فMI0F`(cj+?L s- -~W)''3е AMBN(cAF@H8c-ei#"jihZi##"jihx(NHhW)W)A" 0(H 2??#H&OBF H FKHѲ3 C "4#F`j(?ѭ i)F F(1F F(AFHrT$̖Ȗ^x-OMSNFSO FO2F)F FCOKhBO;(,D8'U/8F MR(f(O#4O*OaT :I* $d a*\(@ `(>pCO@гO5 `jF!(> d ZFOa0F40F/K$h+H1F, FV0!F*PF `jF!o( `jF!gF( H a'v*$ rT-CtML%&I KOghKH8X<8KDX@8K`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8FF:FVB? KI*FF "xL H }K<|HFX{IK(@mK"T(XuIFX(@eK"XT(oHlaK x^K^J,\Lh8C<x%fHhXdHR(bI,d `KAKJ]K8(BHDM&`h$7dh?K$QM&FL*FlCF@8M#F"4HJ!|h #<,wP FB ( #C(b (@3hK/IF"F:.I FKKTQ+I FK K"h(I'I FK0 K"T(X(="H!F8 I F(AK"h(;$_$TToa>D 8 & M0N4D+R#ϊCىÈ9is {K"(H.K"X(T(K",K"hdK` x+?KIh >K,B,,2,~K",|K"H(} zKFhuK,:`|x`mqK"L(hqOObrH9h2o^? !F 0!FL + !F'!F #I +@Ā+W2FFdK88+D FIF(?V]M<; j(x hUK JOb FZoNL? \J)FFcH#8GK<+>6^IOb Fo!  :!hȱh}MH!@LI KI FH!2F(CI BI @!h0FF F5FKFOb'F F FL[h P|Px 0,8P+ ,*OK",+-:F)F0FN$c|^zT§Χڧ\`/-OFF IN(ڟI ,5F,ĕ0FKm(P D(C(AЈIH p(Dr(RF9F0FB*,H X pCO&+'s|&& Q*R{SS<&&$R 'S u&S&@&&)&&n&pS)'D&(?o <8`,G1H b +H  (-U!(FIF(?M&O #XD#A#p3B #*F!F #O3CF?*  m(F9F(F" F +ѯ H P&I T&I6  8[S-OF˰hLF&FF O3`RFAF8FFhяKWE!ݹN"HFFdHڈIJF ,p-a-b=-   " 4z--8m|IoB#{H#" h#h3sKqIO2oCqH#" h#R  hKh`6OF[5 8FH pC_&##&^J#aX)Fa 0YVI(F0"0P##bHYF(iNI.л0ѹ-JIJFIIFGI 2FOqjF( "  "IF0FN(9II* v(5Ih3I 9F Z  ! P1F8FL  &I&J3FFJ(?t#ID(!I6I@)F&!FX*X* Ip& U)')8 ht@'*))))*"****=*R*)P;I NO08IF8F+O  BF(h+ 8+IBFh+ 8x&I) 2DBr2DFGF+OqB #Bh+5EFV 8C! HFI<, F8F,BІBFFF0 r*d*-O(-OF F3}#`NhI0FHH 3}I0F(IHHO(r! & :K!0FVKhO3y3v3U3v00F9o!Fn0 9f! d0c OF9[D#FFFY@FK)FTJZFLBL30F0BXC3X;Z;0 [ab># FF>F(@Y@jKhBhK hJ+!3XXC3XaKhCE@Á'_NV('M( 6(?(t4(O l'N8(S 7iiii f('j8(?v(?sS ͨ/ii7iiߨiiiiii5KhVMZH 2Kh4ZD3L&F='9Y&CcY&f0##*#Y?%Hh$O |'x'FCF !>(1Y?DHJ#[P0W0/4-4H4,</ -}4 )'/----(ёH0B!F ># FU!>F(FCF !>z?  рH3 4'0C#X 9w0vIvH; ;jh+@ !F>ꃘHDHA >:fH; ; 9KeKhBH.Y^@у@ÃUDȃ"V0@UIXH;X11(FQ AA5@44705@ U5f5|5555550536O +6A:yHFH; Y C@YNbFFIHRA,Xԙ RFWK1FhU#80IHX#W~JIhU"T}J~J~HL~KzK> ;0qIzH !9M SOq@0tH; y"qK:0cIoH; a*XY\CsXb ;$h(4YIeHbR#;baHS";3ahBhY*~YIL  ;G 9OXTHj+8FbS"OO#j)[hhh/Bh ; ;(XY 9#hh-9X1Zԟ@2 .wu՘sԋ7IL  ; 9!F =Jh1Mh,?#j3+F"!:dh;j3*FAF8F9h+jC(F9](F;f(&mhhh2.՛j 2Rh6A>6 R680-B0oI0d6w6]S +666667L *? !K:2k`h(F`;hh-HfhB`H;Y@C4: ;ZHQ HiHKY?6%H U78  Q/0@-0 pp@P ^0vpR@]0 , 0 010}PxH}/p@-MdPP@T Ѝp `H0   @  0 @pIpI0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/ᨖ|0@-M@4PP)000Ѝ0\x0x 0@-M@Q ЍT 0   p 0 S 0 ?O0ЍH0/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/S */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*/*/6*/*///*//7 */>*/ 4T*/@-@n@*/*/*/*/xGUxGTxGXxG xGЎxG4xGxG xG vxG%!xGdxGxGXxGuxG4xGxG犭xGxG紎xGpxGgxGxG{xG~xG_OxG*xGxGGxGwxGxGkxG ~xGxGhxGxGˏxGh3xG xG筄xG~wxGxGxG,xxG xG3&xG$xGjxG畵xG&NxG2xG,xGkxGxGxG瀐xG4 xGoxG_xG0KxG xGaxG0 xGxGxG"xG:$xGxGKxGUxGVxGs0 xG %xGD6 xG>xGxG xGfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mls/bin/shSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headssectorsmount point (or '-')cylMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease10.99.12evbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.centropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbetcgamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmkcorevmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d ,T!SAeSfS!Sm$Si'Sm-S50S4S8S;SCSEBSEFSQLSRSXS .^S!dSkSUmrSm9~S Sc%S'S-,S0S0n0S1S1+1SC1S]1S]1Ub>,c}FSJ^^SaSaSgSUrTyTE{T}pIT1J"T%T1*T10T17Tq %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %s%s%d%d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): ???CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.0--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.0 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.0 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingaddingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  ʕܕ*>EOZcx# _Ė^ĖFĖ<Ė>ٖ?PATH= ֠۠tn6\fds6\cmlr  (p2:nFv Nmb    EOF reading here (<<) document}̤ æʦѦئݦX^chkqexq<bF}-+?=B@LSHRX^djq{@ >>abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!0ƫ4!1Ϋ !1ԫ!8ޫ!0!B!0!0"x!0)`!025]x z 9g /[k( T N g2cn !:Yυ                  ح;ޭ;[< *#n=9%ğM=m I=-#  } %!%!)E=/q m8:I$l-GBoF pP~N T%SZ 4Sab hL`I=p5Jv1} 5o~ FIT  *k ı ֠ʱֵrx:g²SEɲԲܲ9Sgqg`?޲ g#(#038#>3G2F3L3R#;Z`$ h@n@rCLzгسӵ @ õʵ @C$DCKC$JCR[ flu29|A@@  f@vȳ ! &,28 @U]e@;@k@s@z@@@@@@@ @@@@@GMǠ̠Ҡ٠ !'3@:@?DNT_fl4rxIơ{Ρ̝ݝ/CSfϞ âȢТբۢSNzWeM աܡ#(05>INSW[ekow{3;AFMT[bkr{ʟɟПٟ$+49AGMâȢТբۢSNzWeM աܡ#(05>INSW[ekow{âȢТբۢSNzWeM աܡ#(05>INSW[ekow{`)J]  $ O k J5Zn !#$&12 345&681979>:W;q<=@ABC2DYEoFGHJLMNOPQRS0T9UAVYWs\}acdefg&h&i&p-qstuCvwIx]y7Ws*A]u7?[0Lo&3E_o0Me(C^  :M}F[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]Xcܷ|ܷ¹ҹڹ $*048DBFNRX\hxreturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockvvvu        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-V#LVaZ-AOwHywwwxx8xPxhxxx`yxxx y,y}¹ҹڹ $*048DBFNRX\hx}&M     /?Vl&<Tp !B#B$&B1B23B4B56B899:; <*=B@QAeBCDE F G H J5 LR Mc Nj Oz P Q R S T U V W \ a3 c= dx e f g h i p qBsBtBu vBw x  % O n {       . F c {       - = Y s y       8  &5HSBBBB]u/QQQj5PltFqBB(B ;B\SFH0eC쬻SSFU0eC8Hah!IdontNeedEFI(s*K>;q|nQn- q+|nQn- q+ |nQn- q+ |nQn- q+1<|nQn- q+J=rGy=iG}NY;Mt?domWC 3KOOzyD<#*=(3Dh&Ǧ\ M}-@Mjy֬-чH0-чHXZIчHܷ4IчHGIчHjR2IчHmL6 %?ay~S'@ )Ѹ*1@ )Ѹx1x )Ѹbackupstore_gptstore_tblin_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps###setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus+Yprintallmaindo_setifpreferencedo_setifcapsfzi0{yi   zH"~,  z%~%~@"@~+4"h~$~,Mz<*L}-z$~-~ -z-z/-:-E-Q-]- i-u--@---- -0-@------ -- -@+Yinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst/G//z 00+/0 /0`0"0@0"0/0z 0media_statusmedia_constructor//.../..././T////p//../paddr_match!M!7m+!!settunnel-1z&1 print_link_addressessetvlansetvlanif 2T2@2z2T2TsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanF8I8L8O8sethidessidsetapbridgesetiffragsetifrtsu8@t8 z|8({8|8 z 8ȁ5 8u* zCX88\8 z888* zv8F3x8)77977u22invalid major numberinvalid minor numbertoo many fields for formatffs@x -@ y J%2HY{ @@$]*16?FKOW[a;;d̷;;;; ;; ;;s;@< <<<!<%<*<1< bnorripbgensbextattbnojolietbnocasetransbrrcaseins;;d̷;;;; ;; ;;B@LSs1=8=;@>=@H=N=;;d̷;;;; ;; ;;X= a=B@LSs1=H=>=@8=m=zb;@u=~;;d̷;;;; ;; ;;;@;;d̷;;;; ;; ;;B@LSs;@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror;;d̷;;;; ;; ;;8=s;@@@d@ @@@@A AAAA @??? A??? ?@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvs;;d̷;;;; ;; ;;;@H=N=JK@KxKKKCLZLpLLLLLMQMdMMMMMNKNNNNNO%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@a[Br[C[F[I[L[N[Om]S[a[b \c\e*\f<\h\i\k\m\n\o\r\s\u\@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:b@@b@h bpbp cpcp  c` cc@ c $1м|^t0 Non-system disk Press any key to reboot ܃{wsokgc_DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY1^vɎ1Q}׏IwUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_print78880888%9(96m:N8]g8zA<33-8888 8*=68C8U]8u|88888-58-]8-x8-8Y>Y>889}2}2.898@8E8bitmask_scan-$+07hw.disknamesfetch_url{ȸsendrequestrecvrequestT*.26:>***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aE E: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-VP\ SSSh&STw&TT&TT<&&T0T&UAT&RTZT&wTTz&TTx&TT&TTۇ&TTڈ&TTB&TTu&Tn&TUP& UT&Uܷ$& USv&*U;Uu&GU&TUy&fU2T|&pU~U}&UU~&UU{&UT&UT7&UT6&U2TD&U~UC&VTB&V VD&2VTA&>VT_&JVT^&collectpX,`lXX`T&`¹ҹڹ $*048DBFNRX\hxNAME=|fXcmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds¹ҹڹ $*048DBFNRX\hx edit_fs_type_ext# = B    ! e" + + 1L d- t! edit_and_check_label ¹ҹڹ $*048DBFNRX\hxdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiyU ] ] _ m\ _ Z W ^ X 5Z W W h \ f q[ Y T Y '` b d T T e X {X X Z X disklabel_change_geoma  outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default&&<&&pm_from_pepm_whole_diskgpt_freegpt_create_new8Q - E s  g h q 9   1 Y ! ܷqq N0Xj J!VLa $',1ܷ|4:S?DHR(0W DfDc\`XfpxJgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬻SSFU0eC8Hah!IdontNeedEFI(s*K>;q|nQn- q+|nQn- q+ |nQn- q+ |nQn- q+1<|nQn- q+J=rGy=iG}NY;Mt?domWC 3KOOzyD<#*=(3Dh&Ǧ\ M}-@Mjy֬-чH0-чHXZIчHܷ4IчHGIчHjR2IчHmL6 %?ay~S'@ )Ѹ*1@ )Ѹx1x )Ѹ  | n $Aȅ҅څ %mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new  =     a -  !   } 5  Q a h " =&  e + !  I U    !- - mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************-****++control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2Ac7h7dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2024 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionv.bp?c:d5 eK9fw?g9h:i%j?k?lFm?nu$o?p&qGr?s??t:u??Fv?w5x?z?y?A?B?C8D@E @F@G@Hm;I$@J.@K5@L;M>@ND@OM@PZ@Qb@Si@Tn@Ux@V@W@X@ZL,1@4@6@@i?|@~@}@@@AA AA'A%A,A4A9A?AEAKA=ZAcAF<kAsA}AAAAAAAAA;BAAAAA>Ay?A BB)B7Bdefault_configread_configrt_compare_proto ߕ ߕ rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtu u rt_buildrt_deleteɕ ɕ sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init`AF4FFFF':a?Fscript_buftoenv0@A7@nAFmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os,I3I9I=IBIFIMIif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpRRR SSdhcp_bound"SiQ+S3SHP;S L CSdhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa      VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bˆ97 ȈQ7 Έi7 Ԉ7 ڈ7 7 7 7 7 F8 )8 A8 BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ 4 @+H3@/P3ˆȈΈԈڈ F@ˆȈΈLԈڈ\F(l !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6  (08@P`p   0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c  _prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_formatprop_string_create_nocopyprop_string_append_cstring_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_reset_locked_prop_dict_keysym_put_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dictionary_externalize_prop_dictionary_getprop_dictionary_set_prop_dict_keysym_alloc_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_dictionary_equals_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_internalize_decodeprop_data_data_prop_data_internalize_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_resetprop_array_getprop_array_set_prop_array_internalize_continueprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesortsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainN_freeaddrinfoget_ai_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtentgetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXleq]$$$%l$T N`'<<  `         ( 0 8 @ H P T \ d l t  |              ( < x\ ; B ,@ h    X `D     L @  < \     l 0d3 D     <,+ x    ,, hh    XX X X        $( , L .0 4 | 8 < \@  H  P X `  d  h  l p x     0 00 0<$, 8 @ H T `hltxhHtx  x|4ad9<eDhLPmT(rU            HXP!dpP!\gntsLONOOHsurbmnq8qppp(qtcid̊Tx܂l\ yekd<0atadȝloobTyaraLlЭ,8P\t   8D \8 ht(P!@pLPX`hpx P\ht|pl,8HX\`dpHLPTp  (,08<DHP@X\dlt| $,4<DLT\dlt|$8HT`l0H`t0DXl  4H\p$ 8  0 @  ,     0 @ t ,  `h8\(,lllPPX|a\LPXl $,8LTdl   P!P!t $@HX\pt|  G   ,08<PXlp| $(48X\ !"#$%(& '(0)LP*TT+X\,px-./0123704cLPhpx#4$L%\&hl'((|)L  $48DPTlp     ( , 0 8 < D PX\\PP(+(+Pcs_path3X3 bc_base_max84 bc_dim_maxl4 bc_scale_max4 bc_string_max4 coll_weights_max4 expr_nest_max x5 line_max5  re_dup_max 6  posix2_version 6  posix2_c_bind6  posix2_c_dev47  posix2_char_term|7 posix2_fort_dev7 posix2_fort_run08 posix2_localedeft8 posix2_sw_dev8 posix2_upe8 stream_max49 tzname_max9 atexit_max9|gC@'dd de;;;;;;;;< << <,<4<@<D<H<L<P<T<X<\<`<d<h<l<p<x<<<P<<<<<<<<<<<<P!P!P!P!P!P!P!P!P!====(=@=\=l=======> >8>L>X>p>|>>>>>>>?(?H?X?h????H??? @<@\@|@@@@@A$A~ Rb]jjfcnfshklmooȃpكppqrsuCtvwwxبx%Tz0Tz&BCJ7OAPPSWTbVjVpXZ}Z Ƅτ ׄ FT(qwqmYA()!w%mY) Ƅ /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin!}-+?=###%%%}h!l! a*2EV8e@FEIiOL\lbmjCtn{fpbu0\q|csˣhvԣVVףx!@=duHud U:eY<(΢E>S"%<nK?!<;թP;%);LS;#DZUR P-OӬ-N --R#IW-P,-W7@MYO`jM(wvr ... ...)|w@Vw_fYwx@@TٜxT˝0x@^Lx@f*-dx@T=|x@gծx@n\ x@xqx$py@Tb yuW@y@zI\ySty@k!."tm#z"yAabCdhlNsuvW:w:zzzzz zlF,En  '@@;;d̷;;;; ;; ;;B@s;@H=...... ...... lost+founddA.##.(F0:,<" r  Ս ب ˆ+$."̈f}҈nb%@"܈$ !"#R$%&' ()*ވ+,!-%/.181D2P3Y4^5b6%) ; <CIPV\dkqw. (prog_root)`ܜx%§ΧڧFq~Eikjtܜaj<Ն]x5S*\-w,ysM{$t)i.45:ْDEsIkT Nvب=q}ew$l-umT-ajYx7T%^ed$SM{juqym(vX,m@$!ҡ\] j >I=M?<<`gn!!e<s9$>Y%t$p%|Q$}C+c/.@%@%N"i"sm!?)2#m"%EF(Pcalsh% !"$'(+-.03569:0%EdO,%Vd(%`hl(av\%z/bin/sh-9hGHhGQX`XkXrX~XXXXXXXX!X(X4X;XGXNXZXbXn2u hG%%5XK^*1b~2&Hb4 ܩz  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ      H "" HHH e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<" is a directory is not a regular file (use -f to see it) (\ $i s  '  " >:     ;  7     # 2" 84  > N  Z ({&l x !  9   &>f )  5 e : %  6% 4   % +3 ,E -T .g *t } ?( EӐ / / ' F@   6%@       >f  L $ V c- ,  ;  G Q WmkRkRkYcWbkCkc kG ky wb YMYrWca%b@X%<B\%[c%dx%A%.JD(i_e%lfP%F|%g%<[hl%id%,jTbJ!(%okHHK %Lx$%mp%+9nh"`%E\mo`OXapPHPHq8%r0"T%5ks(!t%S !D%tTMu%<XVw"0%nx(5XA<%5yh%SjzL%"~!4%?# A8%)9%Oq%%(u;%Op%x%) p%+ L h$%Eg { `$%q  X%  P!%!!H!%!8!@!%N!!8(!0!%!!(%!" %-"O"p"%""%""%"#A#!@%W#s#%##%#$:$%Q$|$$%$$%%(%1%@%T%?']%7#f%{%%%%w%%%%%%&&&$&0&8&F&R&Z&d&j&p& w&&&&@ && &&&&@&>\(' '''+'7'D'P']'k'w''''} '!'''x'& (press RETURN)k@@Ltags643{}abcdDgGhHilnNpPqrs tw xy !:#=&`&-e^H-i^C-k^UKiv $$ TlT͂T l(Tl|4 m  T7oTF t}TF$t~  TFT1o-TFtuTFtTF4it " ! TF K)o|TF TM!o|# $; ?T2$4:sT2$:T2$:T dT $T T T DZYbtTFiQTF$eY~TFio!5ItosoYo]rvtayot]ydcMyfgEy[]\^Nn .nnnܷot o6nHnUn`n_njn"qn,}n?nMn YnenUykqyVIsPQrRxSWrdrsqsNtOsPsQsRsSTrUxw)n/nx7n<M=U>[?cmnnooo)x9wmREpmpUp9pexw%pMtmSm?mNmpmemqm}m%-5 =pppp9q%q qYqMq)Ajk aq|=mܷQm 5mـquq قӀ9r!r rqqqxwqt́̀5u%uuEuuuuuuuguYum%m-mmtmvuuuǀll%[v&Mv'?v(1v}vv5tvv$mvvvvvvzbkBl|clc5lcMltelc}lleNx6VN3#0^=J]S/ekpt|SS )9E*WI?0=4a+qk P`o Mb<8 N     - q 0-J(m9]x"8AVhr~ "4Nj#acvi$8Tr:"3EU`v5?IS`dim ! . 3 B W l {       G'    !!%!2!>!R!Y!t!!!!!!!!"#$%X&%'Q'm'''''''''(((#(8(_(k(w(((((((()$)M)*1*+*+9+X+t+++,.,>,[,`,,,,,-B-S--. ..,...f/////////00"0C0W0k0C1pXYpFb1p11111122 2AA2I2(N2_2j2233]35 6&6:6c6h6{6666$777]8$808[<L8ͅV82q8~888889 969A9b9v99>\>\ :,:P::::E;L;;;;;1<l<Y==R>>0>>b>?.?W???@o@@A9AIA_AAAABhB|BBBBBCC&C.C8C=CGCPCaCuCCCCCD EEE&E1E8E?EHEREcEsEEEEEEEEEFFF*F4FIFZFlFIFFFFFFFFFG GG)G=GIGSGXG]GoGGGGGGGXG*FGGHHH.HFHWH_HjHGFHHHHHHH.,HI"I3IAILIYIeIjIwIIIKKKLLALyM*NwNNNNNNN O"O]OOPPP,Q>Qɣy`}```````fffjff/t no n n$nVn(n.n|4n,,AQ 6? P PuO @f(M AtM BtM C O D (M E XM F (M G (M H7M TX-M Tq Yu u %j 1t1j 1dx t1j yyzzz+z9zHzUzczpz}zz\) [ٮ \} [ m7I  [TTTTTTTTTChlptx|          щԉߢ׉ۉ߉  F !-"<#H$T%a&k'v()*+,--Ɗ.͊.h/v/b0h1؊2܊3452\6789:;<=">4?B@P[d\n\~]^^__ċ`ы{܋{|} }~#  -dd-ddTdd:dd:dd  $@(@<4<DLXd l t |@@@@@@`` @  (#0#8#@#D#L$X$`$h$l$t%|%%%%&&&'''((()) )*$*0*8+D+P+X,d,p,t,|----...///6;;00 0(141@<H<T=`=l>x>?222333978:444$505< D! T" `# l$ x% & ' ( ) * . + , - / 0 1 2  3 04 <5 H6 T7 `8 l9 x: ; < = > ?  @!@"@#@$@%@&@'@ )@,*@8+@D&`P'``,@p-@.@/@0@(`1@2@3@)`4@5@6@$7@48@D9@T:@d*`t;@<@=@>@?@ `!`+`,`"`#`$-`4$`D.`T/`d%`tCCDDEEFFccdde@e##&&(08HLPTX\dlt|  @@`$,8 @DHLPX` p33333333P!P!3333`dhlp@UTC33@Q@Re e  o     33'339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž ( HS 33UU33UU33UU   `88 8 `88  `88h O' L T \ d XdTxl 4p t  x   @ 333333333333333333333333333333333333 33 33  0000000000000000 '3333(3333    (root)`33|gC@'dd deep xtP``txH,dService unavailable,MA4aeabi*7-A A   "Dx\TV7xگOAt9, $PCs/@Py J\Uuu%I&(P,A ;]D\&ܼ369a^'hoރyoL]+S?ƙiKȵFu܇-a[BԶGjj3xqiH!wgk/=բbL~GN5kZ4߯WZMw|fHw)3\]\3_Y=mƹr?6E]?ǟ{NK)sBN_Ƴ;}|{Ϗ*:/Pc:žRe~E)=?)ì:anXl4lƇ/EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+n[0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHEPAVA$bAgA%tg7yj:8  'p5yMSGTXTS626 5024 5049 5066 5088 5091 5096 5104 5111 5119 5127 5130 5133 5136 5140 5152 5161 5174 5203 5218 5762 5796 6479 6767 7475 7531 7605 7701 7748 7771 7794 7800 7809 7831 7835 7839 7842 7845 7950 8153 8392 8833 9271 9306 9321 9333 9339 9351 9370 9390 9430 9447 9464 9479 9526 9564 9612 9694 9818 9954 9995 10033 10070 10105 10115 10164 10314 10320 10325 10329 10349 10459 10479 10485 10499 10511 10522 10559 10593 10617 10719 10756 10778 10877 10932 10990 11001 11017 11069 11237 11444 11615 11679 11731 12003 12553 13082 13514 13852 14185 14298 14313 14322 14482 14653 14803 14967 14990 15014 15029 15104 15244 15421 15576 15588 15668 15769 15815 15841 15911 15922 15931 15944 15970 15985 16001 16014 16069 16080 16095 16299 16532 16561 16576 16645 16719 16792 16822 16860 16914 17368 17394 17423 17527 17633 17818 17930 18045 18149 18836 19095 19235 19271 19441 19482 19618 19641 19678 19723 19974 20070 20124 20223 20234 20271 20308 20335 20344 20378 20385 20410 20437 20472 20486 20500 20529 20543 20560 20569 20591 20609 20626 20637 20656 20682 20700 20723 20740 20755 20770 20788 20815 20842 20864 20903 20921 20953 21181 21255 21298 21344 21491 21647 21691 21970 21997 22356 22540 22692 22873 23020 23178 23199 23247 23257 23265 23276 23287 23297 23304 23319 23331 23369 23399 23438 23491 23549 23570 23577 23596 23617 23624 23647 23669 23689 23711 23742 23779 23801 23815 23861 23890 23924 23964 23999 24027 24075 24084 24093 24098 24107 24116 24133 24137 24142 24146 24184 24193 24220 24240 24263 24282 24309 24331 24363 24379 24384 24394 24417 24439 24456 24473 24486 24495 24504 24510 24537 24544 24568 24589 24613 24626 24645 24670 24693 24709 24715 24727 24757 24765 24805 24816 24827 24838 24855 24872 24886 24903 25119 25423 25871 26087 26351 26623 26675 26711 26747 26798 26815 26853 26867 26874 26891 26894 26899 26908 26920 26931 26940 26961 27003 27019 27035 27066 27083 27098 27113 27128 27149 27169 27210 27239 27287 27520 27555 27762 27781 27818 27879 27917 27956 28112 28127 28173 28200 28223 28259 28269 28279 28290 28295 28358 28406 28450 28511 28544 28591 28609 28748 28770 28893 28907 28917 28940 29045 29101 29217 29248 29253 29279 29318 29328 29371 29381 29397 29412 29430 29453 29483 29504 29530 29727 29770 29774 29780 29786 29791 29802 29816 29845 29877 29889 29936 29986 30026 30053 30069 30078 30121 30127 30135 30139 30159 30176 30188 30219 30475 30524 31100 31127 31159 31187 31239 31245 31251 31256 31277 31293 31315 31344 31485 31619 31632 31768 31770 31772 31774 31791 31804 31822 31849 31853 31859 31864 31872 31878 31918 31920 31930 31945 31962 31996 32028 32066 32095 32124 32146 32189 32215 32259 32395 32397 32477 32523 32571 32676 32778 32817 32884 32891 32952 33016 33020 33027 33149 33218 33506 33644 33785 33866 33913 33919 33942 33988 33991 34017 34060 34125 34187 34257 34325 34418 34637 34662 34666 34702 34720 34748 34790 34834 34898 34948 35024 35046 35098 35142 35181 35215 35245 35276 35301 35310 35322 35330 35341 35353 35372 35396 35445 35462 35486 35529 35851 35854 35868 35881 35893 35900 35911 35918 35925 35934 35944 35961 35977 36027 36035 36043 36053 36064 36082 36099 36120 36142 36151 36161 36188 36194 36204 36223 36239 36257 36277 36286 36297 36304 36321 36340 36361 36371 36388 36394 36410 36425 36440 36461 36483 36502 36512 36517 36522 36540 36559 36578 36584 36603 36623 36643 36661 36666 36672 36689 36705 36726 36739 36747 36767 36791 36808 36816 36827 36848 36854 36866 36888 36902 36911 36932 36950 36959 36993 37016 37043 37075 37098 37118 37129 37161 37177 37188 37201 37224 37246 37754 37784 37815 37843 37857 38058 38280 38447 38534 38551 38569 38586 38615 38662 38673 38692 38714 38793 38985 39013 39131 39153 39294 39313 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.12. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.12 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.12 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.12 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.12 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS626 5024 5062 5079 5094 5097 5100 5105 5113 5121 5129 5132 5135 5144 5156 5168 5177 5186 5212 5223 5759 5786 6352 6652 7293 7340 7453 7546 7580 7599 7617 7625 7634 7659 7663 7667 7670 7673 7795 7980 8208 8728 9079 9108 9121 9134 9139 9159 9178 9199 9258 9275 9289 9311 9356 9382 9423 9501 9619 9733 9787 9816 9848 9887 9893 9926 10049 10056 10060 10068 10092 10174 10180 10187 10199 10213 10222 10255 10274 10286 10396 10458 10477 10596 10647 10699 10711 10730 10782 10986 11194 11385 11445 11494 11761 12220 12886 13309 13631 14056 14188 14220 14232 14410 14607 14768 14902 14922 14955 14969 15038 15151 15323 15458 15478 15590 15682 15705 15728 15787 15802 15823 15838 15859 15879 15904 15918 15942 15954 15972 16182 16432 16453 16469 16522 16590 16663 16700 16726 16802 17297 17323 17345 17452 17559 17760 17833 17917 18017 18512 18750 18901 18935 19070 19114 19253 19294 19339 19386 19630 19763 19825 19919 19924 19958 19992 20007 20035 20068 20075 20100 20118 20144 20151 20166 20181 20201 20241 20258 20278 20299 20321 20336 20356 20378 20393 20406 20420 20432 20444 20458 20481 20504 20522 20565 20616 20653 20838 20901 20937 20986 21077 21207 21260 21520 21567 21928 22078 22247 22387 22507 22639 22679 22726 22736 22744 22754 22762 22773 22784 22798 22823 22865 22898 22931 22966 23020 23045 23064 23086 23091 23097 23127 23144 23171 23189 23210 23232 23251 23261 23291 23317 23344 23393 23421 23448 23501 23511 23521 23527 23537 23546 23566 23570 23575 23579 23614 23623 23654 23671 23698 23719 23739 23758 23784 23797 23805 23821 23852 23883 23904 23930 23943 23951 23962 23968 23992 24002 24014 24032 24043 24063 24079 24105 24127 24143 24155 24175 24201 24207 24237 24251 24265 24288 24307 24326 24344 24362 24585 24891 25309 25510 25750 25934 26012 26067 26134 26174 26197 26231 26242 26250 26273 26276 26279 26285 26296 26308 26321 26351 26395 26408 26421 26458 26472 26483 26494 26505 26522 26533 26580 26603 26652 26893 26926 27181 27202 27235 27288 27314 27341 27497 27503 27546 27566 27585 27614 27621 27628 27635 27640 27689 27727 27761 27818 27846 27891 27908 28009 28014 28091 28105 28115 28139 28262 28343 28453 28481 28486 28502 28531 28539 28580 28587 28601 28614 28622 28641 28674 28694 28714 28930 28961 28966 28973 28980 28984 28998 29010 29025 29058 29071 29126 29184 29220 29238 29256 29274 29311 29317 29325 29329 29350 29367 29378 29400 29578 29622 30324 30348 30382 30401 30446 30453 30460 30464 30488 30499 30504 30567 30688 30811 30824 30958 30960 30962 30964 30974 30983 30996 31023 31027 31033 31038 31047 31052 31079 31081 31094 31106 31121 31149 31193 31240 31256 31278 31289 31322 31342 31391 31491 31493 31558 31607 31656 31760 31858 31899 31990 31997 32058 32122 32127 32133 32242 32301 32552 32693 32820 32888 32925 32932 32959 33005 33008 33029 33074 33125 33184 33253 33300 33405 33548 33573 33577 33611 33628 33652 33704 33755 33827 33893 33991 34008 34039 34075 34109 34133 34157 34190 34210 34220 34228 34236 34246 34257 34271 34297 34345 34368 34388 34429 34728 34731 34745 34757 34764 34783 34797 34804 34811 34820 34830 34847 34863 34911 34919 34927 34937 34948 34966 34983 35002 35022 35029 35046 35063 35070 35083 35118 35135 35154 35174 35184 35200 35213 35231 35251 35272 35282 35302 35322 35335 35354 35367 35391 35414 35427 35438 35443 35450 35468 35487 35506 35514 35533 35553 35578 35596 35603 35610 35623 35632 35653 35666 35674 35694 35722 35739 35745 35756 35787 35795 35808 35830 35852 35861 35882 35900 35907 35930 35949 35976 35994 36014 36027 36042 36063 36077 36084 36098 36113 36132 36677 36710 36738 36767 36775 36812 37124 37301 37378 37395 37413 37428 37450 37500 37510 37527 37549 37608 37766 37790 37920 37945 38071 38089 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.12. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.12 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.12 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.12 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.12. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.12Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.12Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Set up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS626 5024 5060 5077 5092 5096 5100 5105 5116 5122 5128 5131 5134 5137 5141 5153 5165 5175 5205 5217 5647 5674 6250 6610 7295 7356 7434 7529 7569 7591 7609 7615 7624 7650 7654 7658 7661 7664 7786 7971 8199 8728 9146 9175 9188 9201 9208 9228 9247 9270 9313 9333 9352 9375 9419 9448 9489 9555 9667 9781 9835 9864 9896 9935 9941 9974 10052 10058 10062 10067 10108 10245 10255 10263 10282 10296 10305 10337 10378 10391 10516 10574 10593 10712 10768 10820 10831 10847 10886 11136 11308 11480 11535 11570 11820 12224 12523 12791 13152 13332 13651 13671 13684 13873 14017 14213 14347 14367 14400 14419 14520 14675 14863 15050 15070 15149 15247 15285 15308 15398 15419 15442 15461 15485 15515 15559 15592 15615 15627 15645 15913 16232 16263 16298 16362 16437 16507 16538 16568 16660 17151 17181 17198 17338 17479 17676 17795 17942 18109 18667 18963 19144 19189 19352 19406 19541 19577 19637 19687 19978 20087 20144 20241 20246 20281 20316 20331 20355 20388 20393 20418 20434 20457 20464 20481 20496 20515 20547 20551 20571 20589 20601 20614 20632 20656 20674 20693 20720 20747 20759 20780 20810 20840 20865 20898 20933 20971 21224 21293 21348 21409 21527 21686 21740 22001 22052 22428 22583 22727 22867 22975 23160 23190 23233 23243 23251 23261 23273 23294 23303 23309 23341 23382 23418 23456 23493 23541 23565 23577 23591 23599 23607 23635 23652 23681 23702 23725 23734 23753 23765 23809 23847 23874 23918 23946 23973 24026 24037 24048 24055 24065 24074 24108 24112 24117 24121 24156 24166 24196 24219 24248 24270 24292 24314 24341 24353 24365 24384 24418 24451 24472 24496 24509 24521 24534 24540 24566 24576 24587 24611 24621 24641 24661 24678 24704 24728 24741 24761 24795 24802 24831 24854 24877 24893 24908 24923 24938 24952 25140 25445 25876 26067 26302 26490 26532 26582 26636 26684 26706 26747 26758 26766 26790 26794 26798 26807 26818 26829 26844 26875 26921 26934 26947 26977 26991 27003 27015 27027 27045 27068 27113 27136 27196 27448 27475 27737 27755 27782 27831 27861 27892 28024 28031 28080 28103 28127 28156 28164 28174 28182 28187 28240 28289 28329 28395 28428 28472 28495 28596 28601 28678 28692 28702 28726 28849 28930 29040 29068 29073 29089 29118 29126 29167 29175 29189 29202 29210 29229 29262 29282 29302 29518 29549 29569 29575 29582 29586 29601 29620 29646 29655 29667 29721 29779 29814 29833 29850 29862 29897 29903 29911 29915 29936 29953 29964 29989 30167 30221 30912 30931 30966 30996 31042 31048 31055 31059 31083 31099 31105 31180 31330 31449 31462 31530 31532 31534 31536 31546 31559 31576 31603 31607 31613 31618 31627 31632 31659 31661 31674 31686 31701 31729 31773 31820 31836 31858 31869 31902 31922 31971 32071 32073 32149 32204 32254 32353 32448 32496 32586 32593 32654 32718 32723 32729 32832 32884 33130 33291 33446 33517 33570 33577 33604 33654 33657 33678 33724 33779 33838 33907 33954 34059 34202 34227 34231 34265 34282 34320 34373 34413 34489 34554 34648 34669 34707 34747 34783 34807 34830 34869 34899 34906 34915 34923 34931 34945 34961 34989 35041 35058 35079 35123 35465 35469 35484 35495 35503 35522 35534 35541 35548 35557 35567 35584 35600 35654 35662 35670 35680 35691 35709 35726 35742 35760 35767 35785 35802 35809 35819 35850 35869 35888 35908 35918 35937 35950 35970 35990 36011 36021 36040 36059 36069 36086 36100 36123 36147 36160 36170 36175 36179 36197 36216 36235 36240 36259 36279 36304 36319 36323 36330 36340 36349 36370 36384 36392 36412 36438 36455 36463 36474 36505 36510 36523 36545 36560 36569 36590 36608 36617 36661 36685 36712 36727 36744 36758 36789 36813 36844 36851 36865 36880 36899 37444 37477 37505 37534 37542 37579 37891 38068 38145 38162 38180 38195 38217 38267 38277 38294 38316 38375 38533 38557 38687 38712 38838 38856 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.12. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.12 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.12 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.12 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.12Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountMSGTXTS626 5024 5065 5081 5099 5103 5107 5117 5126 5132 5138 5141 5144 5153 5163 5176 5184 5195 5220 5232 5741 5773 6265 6554 7099 7145 7249 7335 7371 7386 7404 7412 7420 7447 7451 7455 7458 7461 7572 7757 7985 8461 8795 8824 8839 8854 8862 8876 8894 8915 8966 8982 8992 9012 9058 9088 9141 9198 9309 9430 9474 9507 9546 9580 9587 9620 9697 9703 9710 9717 9746 9858 9864 9875 9892 9909 9918 9947 9959 9969 10070 10132 10152 10272 10309 10365 10379 10400 10437 10647 10822 10971 11006 11058 11275 11589 12113 12475 12765 13158 13293 13306 13317 13463 13642 13773 13907 13927 13960 13979 14062 14177 14318 14443 14457 14565 14658 14687 14707 14783 14800 14818 14834 14853 14873 14890 14902 14928 14940 14958 15159 15398 15425 15442 15498 15560 15620 15651 15675 15734 16110 16140 16157 16265 16375 16515 16589 16665 16743 17235 17455 17566 17597 17724 17760 17888 17915 17955 18001 18217 18341 18409 18509 18514 18550 18586 18600 18623 18656 18660 18685 18704 18730 18735 18750 18765 18784 18809 18821 18843 18860 18873 18885 18903 18927 18942 18959 18972 18983 18994 19014 19043 19072 19096 19131 19166 19193 19380 19429 19461 19509 19606 19739 19785 19977 20007 20329 20458 20598 20738 20855 20990 21034 21077 21085 21095 21107 21119 21127 21138 21165 21199 21235 21266 21301 21337 21384 21404 21421 21439 21444 21451 21477 21493 21514 21531 21548 21566 21583 21596 21627 21652 21683 21714 21749 21776 21829 21839 21849 21855 21864 21872 21887 21891 21896 21900 21935 21945 21974 21990 22016 22033 22052 22073 22089 22102 22107 22115 22130 22156 22175 22203 22221 22232 22238 22244 22265 22275 22286 22304 22326 22343 22356 22377 22397 22417 22428 22441 22463 22470 22495 22510 22530 22542 22559 22576 22596 22615 22792 23076 23386 23566 23777 23965 24031 24078 24133 24177 24197 24226 24238 24244 24260 24264 24268 24276 24286 24298 24313 24332 24368 24379 24390 24429 24441 24451 24461 24471 24487 24505 24554 24575 24620 24864 24890 25144 25159 25185 25242 25276 25311 25453 25470 25519 25540 25556 25585 25590 25595 25601 25606 25645 25680 25710 25765 25798 25844 25858 25937 25942 25996 26010 26020 26044 26130 26178 26284 26318 26325 26340 26367 26376 26415 26422 26444 26463 26479 26497 26529 26548 26565 26722 26753 26760 26769 26777 26784 26798 26816 26835 26845 26857 26898 26943 26972 26993 27016 27035 27073 27079 27087 27091 27112 27129 27138 27157 27303 27345 27855 27863 27887 27905 27949 27954 27959 27963 27994 28007 28016 28062 28188 28279 28291 28355 28357 28359 28361 28371 28385 28400 28427 28431 28437 28442 28451 28456 28483 28485 28500 28511 28526 28554 28598 28645 28661 28683 28694 28727 28747 28796 28896 28898 28966 29006 29051 29126 29192 29227 29308 29315 29376 29440 29447 29453 29552 29608 29884 30008 30119 30181 30219 30227 30249 30298 30301 30322 30367 30422 30481 30550 30597 30702 30845 30870 30874 30908 30924 30949 30997 31033 31094 31148 31229 31251 31290 31327 31359 31383 31410 31436 31450 31458 31468 31476 31490 31503 31515 31539 31580 31606 31623 31652 31976 31979 31993 32005 32011 32027 32039 32046 32053 32062 32072 32089 32105 32148 32156 32164 32174 32185 32203 32220 32233 32259 32266 32274 32291 32299 32316 32340 32359 32378 32397 32407 32418 32432 32450 32470 32490 32499 32522 32542 32553 32568 32580 32599 32618 32629 32639 32644 32650 32668 32687 32706 32713 32732 32752 32777 32794 32800 32808 32818 32830 32851 32867 32875 32895 32915 32937 32945 32956 32979 32986 33000 33022 33039 33048 33069 33087 33096 33127 33143 33170 33189 33209 33227 33248 33262 33282 33289 33308 33323 33342 33887 33920 33948 33977 33985 34022 34334 34511 34588 34605 34623 34638 34660 34710 34720 34737 34759 34818 34976 35000 35130 35155 35281 35299 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.12. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.12 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.12 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.12 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.12 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.12Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.12Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..