08P_g'&<  '_gH[]P''`'). )._g'&P@@<@T 08P_g'&<  '_gH[]P''`'). )._g'&P@@<@TU _g`').yA_g_g_gQ$f _g_g_gRA_g_g_g>A_g_g_g?A_g_g_gA_g_g_gA_g_g_gA_g_g_gA_g_g_gA_g_g_gmK%_g_g_gX`hpx$@_g_g_g (08S$\_g_g_g@HPX`hpxP$t_g_g_g;Q$_g_g_g <JA_g_g_gC_g_g_gA_g_g_gA_g_g_gm/_g_g_g(08@HPX`hpx[$_g_g_g$_g_g_g$>_g_g_g$_g_g_g$s_g_g_g$_g_g_gA_g_g_gm _g_g_g$_g_g_g $_g_g_gA_g_g_gA_g_g_gA_g_g_gA_g_g_g$h`_g_g_g ($_g_g_g$_g_g_g$_g_g_g$_g_g_g$_g_g_g$_g_g_g$_g_g_gA_g_g_gA_g_g_gA_g_g_gA_g_g_gA_g_g_gA_g_g_gU=3$Q;@٩$k:WP7w5&uYH5.&S5҄ rFnhpr*͔| b9fA8ρOR]X.P <. CFC6(;EjXҐSx). . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4%4 (0"0"xixi%$U2U2@X TTT,,%$U2U2Ptdx(QtdNetBSDpmAPaXU|SR ffffUSWVP[-t$$u,jPjjjojR|$0F4 $uH!BtKj/VKt@Ƹ0"M&PVt&uVhL0"h40"h'3^_`SWVhL0"hW0"h'3 1۸0"M&P谉CPrFh'3j wh4%h'3_ uh'3j jD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5D/3蹷 u$1^_[Vh2"Vh3" 5@/3hH3"j wVh(3"j̋USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%SP&tutD$D$$D$% D$t$@N D$l$hH/3hk$D$ @l$0tD$Ph R$sj D$  |$\$4t$,s$L$)L >QPh&5"3 D$  L$s()@L$L bQPhG5"L$ D$  s D t 4P&hj5"L$ D dtPhx5"D$(@9XU莼\$D$T$T$9tt$N9BD$4P&5@/3h4"d 1h^_[]t$|hX4"%WS$h4"h4"jU5@/3h4"j*t$|h3"5@/3h3"3$hs4"jhc 5D/3` u15@/3h5"jԂSWVPD$Hw#t$>P&WϷt ubQ&$h2"W誷t N1AQhc5D/3ѭ u 1^_[5@/3h5"j?USWVP|$t$7 h2"WV< fu <<@/3u !3)u @/3uh2"谈2"t @/3hjQZ D/3u 5@/3h2"Ihu3$(P&SU蚶t uUh2"j1h2"jU$NPVSP& PlV'3Ph5"Vu Vjjh5"SP&P&h6"h'3@ uj5D/3ZWVοV8F ux03/3|03 03 /3/3;/3 03r*jZ/3x03/3 /3 03|03^_[á03 |03 t /3/3hR&hk$j{hR&hk$j{hR&hk$j{hR&hk$j{USWVt$|$6O1#Sj%SVW趆 u=!3PM03u,03J$0303,R&Ah)8"j{03,R&1QQPqT 03y 503t03 t03 =,2r03uh8"롡03u# 0303 9"03,R&103H03,R& hQPS 03yJ103H 03 hP503Q 03 03y 503/3/303utS1V 030303903r_ t03t= 03 /3E /3t# t03) 03I /3" t03ujl/3 x03/303 03t 03 03t 03h`u;503 /3=03 03503VP5 03W 031Vhh03whjWhjH5/35/35/3/3hX-,2e=0303 03 t003(03403,039ss$x03 03tQj QjP÷ 035035x03503P$ xd503-031‰1 03 03|03 03(03,03|03 0303 03xPhk$K`+03u603j503503503P  t503hk$`03 0303 0303|03 03(03|03 03,03C03s 0303|03 03003|03 03403u@s)tP03T03H x03PQQI 03x0303/3 /3j103|0310303h8"jnPhk$j1vWV03=t=ȥ=u 703/3 /3t;/39щ503s))Rj5/3A 03 /3/3 /3 u\5$03= 03 tJ5/3j5/3 03 /3/3 /3/3ʉ/3)Ɖ= 035$03 t jY= 03u03jPu X8u*035 03Pt^_h.#jth9"USWV/3|$,t/3/3(p‰D$l$|$,u 03 xT$ $03 03 t!03jQP5 03R !ƒ~t$VSh/3 $~ D$ `w18D$ Z $03 03 ʋ-d03`03t>5035/3QPVX03\03803<031$03 03T$<$t$ `03-d03l$13L$ @03D03D$11 03t,/3u#/3503hw8"T$03L$ AD$)ʋ$tЃ|1@|p9@|5 03$03*/31 03T$1 uK803<03I$T$ /3/3)ѣ/3 /3503-/39@03D03$ t /3)PQ5/3!\ /31/3/3 /3/3 t(@038035D035<03QPVR輤 tjhe%jI$^_[]503h8"503hA8"503he8"jq503hk$jqUSWVt$(|$,\$$Uh/3jI C4WVs(P( 辴8jUjI 誴8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h8"j0qV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$hk$jpVPR9v VVPQ t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV/3 /3t/jh""jG /3 /3tjh""jF 1t$PVmFȺMb׋ p03-։+h03D$H l03iى tL$ 1FD$|$ 5D035@035<035803540350035,035(03h9"jdW,WjPWjF T03P03 t?ƒ ʺ`h%td#RQPh@9"jd|$4WWsjPWjE L03H03 t?ƒ ʺ`h%td#RQPhY9"jd|$4W<W#jPWjgE t$ \03X03 t?ƒ ʺ`h%td#RQPhl9"jd|$4WWiPWjE d03D$=`03jPt$ t$VӠÉiL$it$V)QPORPVSt$Wh9"jdt$@Vb$VIiPVjD e^_[]EVt$;VEj胮fUSWV03503=0311C03W5t03503P$ Mtg03u503hk$T03W5t03503P$ ݅~03t )u=03N{T,2rOH,2d503 03=03 03503jVP503W !ƒt^_[]h9"jZk503hk$jxkWV03uD503 /3=03 03503jVP5 03W !ƒuuJ03 03ti11035/35/35 03P$ ~J;50303r,f 03H 03Phm5 03Q xw^_xof@ 03Phm5 03Q tD;50303s5/35/3h/3 3/33 03 t503hk$j#jfUSWVX $p $l 7hO1#jvh9"WSu H-$XR&030303@0303030303030303u03i0303S03G03;03030303030303=13-<<E%Pb 03$$=1303D$ D$$L$D$1|$D$ t}tUaÃuPa9$D1t$PL$$XT$$`\$$hd$$lp$$tx$$|$$$$$ O03$tux|$ttL$=13r$1F L$F ;513r0313=03<E03$1ۄ13 L$ $N1 u >=03u =M=03ui $ $139} 13W23 139|_SQ}$13 13 23u 235H13WjPZx!9u=@13D135 13>X 0ާPhi#h'3 h_>"'0赧Phi#h'3 hI>"N^_[诚0耧Phi#h'3 h&hN 23uá23u tjwGjFUSWVjiƋ|$11K< @u=<13t?jj5H13 5H13N@13D13<135H13UjWl A)߉n@13 D13N F543q0,4343-@13F D13^0/Phi#h'3d h&Mrhu>"]1HD13@130Phi#h'3" h>"'0ĥPhi#h'3 hI>"LVX1^_[]Vt$543q0F,4343^WVL$ 235L139})=,4379}>,13829~vRO9G9~-82(13~Z(13΋Nu#82)Ou9~82RN982 L13u 23uu82^_É1jDjDVT$(13t=(131(136(13t@9uхt(13uh|%hK1^SWV123D43j?Dfh"Z>"tWPt|8/uWh>"Wh>"hP13 P13tLPt$h>"PԎH131ۅu@W-5P13hk$=<>"j,<>"PJVe^_[VH13tAPǑxGH13P13t!PW5P13P131<13D13@13;5P13.0PVhaC&h'33h>"I^Vt$H13t3P(P13t!P5P13]P13V走jh43h'34d "x (13(13,131T13@=ujuSVL$D$ T$t$T23T135T23T13~A2T13BI^[fV1X23\23d23`23P:PJJp23Fu^SWV5\2395X23t$X23Vjjhp23ոut=t23p23p23jjPPEthG?"hk$[Hh230x23@u`23=d23VRjtVPCG~*hv?"5w23r0hR?"hk$G1N1Nyh?"hk$G5\23~X23H X23p231H^_[Ë X23u!T$7\23X231\23xD$QX23p231HSVփuUh230x23@up23jjPP]DthG?"hk$Gp23 t23 d23`23aˍp23)Qhh23Pl w23h230x23@up23jjPPCthG?"hk$FVjjhp23e^[Vt$ X23u\23X231\23x 1H^USWVh?"1Ɗtx<0uFD uh$?"hk$$EGuȿ|w WjP` 1T L ш @ux23hjV. P01Fth 23u23utj8?"j&7WV 2352319}'23FىDuw9@u1=23^_USWVD$L$9tV23r=23~=239 t9|1C23Mu9|1C23=23 9u^_[]fUSWVl$}!uEh^"P@UT1h^"P蚰Åt*t$Sǀ}!u?SI=҉0裖PUhaC&h'3ׯh?"=eSڄx(=23uWh5"h'3蚯 543+t$0f07PUhaC&h'3kh @"=^_[]USWV |$$Wơ23$D43D$,431-23-D439-23t\$=43t$ gDž~w1123523Y6ts43PPjJ Å 23u23t$ Dž|$$\$9t$utt #@"<$u=23t!5@"9u D43 uh'3P!9¡D43Ƌ 23Ӏu1A9|$t $ 23 D4323t )) 23u 23ut j4 ^_[]j3USWV1|$=23t WrGHOHt uG `-239}23V239rFU523v-2323 23u 230u D43F8W*<1ۍF-239~N23 239wUQ]vt7-2323 23u23uhtk230 F0Phi#h'3" h&9 2323j2G @utL230 F238蠅0qPhi#h'3覫 hG@"Y9-1230=D43=23  )Ɖ^_[]js1USWV|$?!uGh9"P9t$WI,VP蓫Åt2l$t$ US NjD$8!u?S:=Ä0蔑PWhaC&h'3Ȫh^@"{8mSx-=23uWh5"h'3苪 t D$ )@ʼn3R0#Pt$haC&h'3Thv@"8^_[]USWVPl$Uƃ=23t1ۅtf;l$ `1V$th~;-,43u=D43t =23u8 GWPt$ F x4EEs @6;l$ |=23tt$$$^_[]USWV|$\$l$19t[=233t UPrUPFy&0Phi#h'3, h@"61^_[]USWVP\$5(43FEx @u}|~PVq6tj239~l23239SPrgƉ2323 23u.23_tO5(43;^_[]Ë523W5(43V\ . ,1xщǃ|$uE43| /5239$~Z239V523qcÉ52323 23u23t 23W543Ue[ ,$+HPS523D( |$tM1BDžh?"4 0ݍPhi#h'3 h&41 23235239} 23|$N23239͋|$|MVPpt052323 23u 23umua(/ M0Phi#h'3S h&4 23t123uj-j/,SWV11'3H '37h'3]|u8'3@%f'39u'3H '3ÍF=439~Y239wW543Zo=4343 23u 23t 430u D43F  43C~0ɋPh@"h'3 h@"2%'31t 43043(43^_[~0mPhi#h'3袤 h&U2 23u23u tj_+j*USWV\$ D$1tt$h@"١D$ l$1uHD5d'3J d'3;t'3у  \'3Q\'3;=D2|h\'3hL=%1GD5 | <\t<d'3H d'3;t'3h\'3j\ \'3H \'3\\5tjj Sh@"mW tVG@")Ȋ@"d'3J d'3;t'3Vу J \'3Q\'3\$ !0d'3H d'3;t'3h\'3PR\'3H \'3D50 d'3Qd'3ɋ\$ ; t'3h\'3P \'3Q\'3D50 d'3Qd'3; t'3h\'3P辥 \'3Q\'3Dh\'3Q蘥4 d'3Qd'3; t'3~;ȃ t3 \'3Q\'3D$F9h\'3QEh\'3P똡d'3H d'3~\'3H \'3 h\'3j 1^_[]fWVD$L$L$$$0z4| $ |r123h@"t$t$ B ot9EtzS23ǃxtostypf<<33먡!3  $)D$|$ta$8-uW23D$|<!3b23S 23D235$L$jj\th_jRw1FhVAwVj6whj'wh33ƅux'23|$t$8t$0|$t[h'3h@"v$8u h@"_-j[u$h'3h@":h@"--y =23th43hi#h'3I 33tPhk$œh\'3uQ xt` 43| 43x51g43QPP M=43=23h'3h@"Gh@":,jZ%'343h?",%'3΃t0h'3h@"j=Z51543h'3h@"h@"+V ZQ=23th435 43hA"h'3蘝jrjkuPhU&h'3r jH=23jYunh435 43hA"h'33f$j0yjTYt$8!$h0h230 uh43hi#h'3˜ jL$ ɸ!23Phht@j^ x#$r@2D$ rD2ËL$=23t1@ 23Ql"L$=23t1@ 23Q#WV1F=23t9|$ ?!t!h#Wgtj/WGth B")1^_4343 43$43x>43 43 $43 43 (43;t,uQ(439;u43빋 43| 43 43t9t$431Ƀ USWVP.3(43DJ@t t@(43@DJ@t uHH (43~Ã=w$S&=43!hA"  !=43" (43A1Qptntl  Ӊ (43A˃=43FP”^ U (43@߈\$ ̀1ۈL$QuH (43H1KDB@,Aǡ,43 43  Pj  5,43j$1  ˣ(43@̃=43t=23y=436DB@jLǡ(43@1Hptntl   ˣ(43@̃=43DB@8!hA"=431Hptntl  ˣ(43@̋ 431PptntlN  ӣ(43@̡43HQPN"(43@1Hptntl%  ˣ(43@̍H (43 43 p1Pptntl   ӣ(43@̡43PPv (43A1Qptntl  Љ (43Aˡ43PPH-$43 43=43= 43 9=,43 -$43 439 9w hA" 43PP (43A1Qptntl  Љ (43Aˡ43PPl@ (43A1Qptntl  Љ (43ADB@;heA" 1ЍrЃ sOmj h(435(43 <43wkm8"%843 (43:o t!gc ptrP  A (43< b=443Ho143PP9 $43- 43 =43= 43 9=,43$43- 43(43@1Hptntl  ˣ(43@̃=43F1Hptntl  ˣ(43@̃=43hRA" 1@$43 43AQP2 (43<kj h(435(43 @2k8"h'A"N@2 (43x w =43,43t 430h%ގ (43x A =43u;.5 43O1@$43 43AQP@ 43jPP>(43x  1q1ۃ=23Ƀ=43 ˃h|% (43x  =43u-5 435$43 543g (43x ? =43uL-5 435$43: 43@;,43?743-(43x =43u , 43IQ T(43x =43u,$43 439QPn(43x QVP (43y F( (43y 1 (43y P5 435$43g (43A1Qptnt lu  Љ (43Aω (43y  43,43=@29|PRQ 1=43u ,43 43 ǡ(43@1Hptntl  ˣ(43@̉(43z !43SPhA(43x  1@+2323uF%(43x <<u<2=33t133(43x =43h43hi#h'3芍 (43x }*x1Hptntlu  ˣ(43@У(43x '23G1 43$43(43@Hptnt lu  ˣ(43У(43x =2323u#|$Wt9"5 435$43QP';,4343(43x ==43uJ)=2323u5 43Q5;,43)43hA"hA"h'A"<43h|%<431< *5 (43y qt@43@P@43@P =23h %+(43x )5,43j 6'(Y$i*tEEp $A8GMi $4391 43)@أ43=43t W6U431 23u 23u u^_[]jjSWV=23uj貽L$ɸ!23,43Pjh9"hOB"Hy|h # tkP =Yà PY8tGWP'm|3/tf/Va ed.hDhup5,43jh9"Vj=23ujL$ɸ!23jh33USWVPl$5$43'Ƌ= 43$43-439ʼn) u)E1u1$23E@23V}tzP蘹t_43PPj DžtO4323H23u 23u[uE6M43@Pi1,$l& 23u 23ut j1^_[]jUSWV$23 23th B"ckjP~(43L$F$ T439} P43V23P439|BVPA5T43P43 23u 23! (43 u1C1E҃!%=23h23P Ɖ$ T439V239V5P43U@5T43P43 23" 237 09L$]9239|WP?=T43P43 23]9~[239V5P43?/5T43P43 23u 23yt vP43 (43 (E (43Q(439\u=Q(43I ( P43G (E,$s (43L$A (43 @43y X43)9~_239VP>I5T43P43 23u 23 X43P43| @43A(EA@43X439r (43L$A (437 233/ (43Q(43 ( (43݀ (5\439}@43R23@439|KVP=t]5\43@43 23u 23S5P43Pp' @43X43D$1!PVM0'ZPhi#h'3\s h& 23 23u!u#^_[]hA"qh?"gj'jVj1tL$Qq p PIH1L0YPhi#h'3r h&n1^V43t.L$19 h43uh43H43t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h43#nXWV (43 td< uh?"1 Q(43I t;8t7P1ǡ 63t?=043u6PK 6395 63hVB"R5 63jo0 63tV043523WPZ 63t.h'h43QP"5 63@ 633/J0WPhi#h'3p h&^_USWV=(43 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-639}=63M23639|KUP7:tYlj-6363 23u23uyS5(43W# 5(43=D43tsj jSWmeI0VPhi#h'3o h&1 23u*23u(tjhD$hjB"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u(43 u63E#t(43 uE1^_[]8uP(43HЉʀπwRwHj h(435(43 1wIH8"uh'A"1gu@(43ErUSWV(43H (43H%u,8Xu'(4363hA"t18u= 639 63L1}5 639~[239V563v7#5 6363 23u 23\t Y63 (43Q(43 u (\t u^(438uT(43H (43 631< u0=43u't 43| t %'3ى(43823639|NWP6t8= 6363 23u 23uuuw563063M1IEF0SPhi#h'3Kl h&1 23u 23uu^_[]H(43,j'jUSWVPL$43$4319 43}%43ȃ EhB"Kl$ 43PUVPt$$KǸ1$43PP$63231S̪á43tP芬EPPjM Ņtl9u 23l$ u23ue$43 43+$439}yF43@43P%Ut$ Pt$$hDž+9 23u123uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=D43tj jvS肮vލD$jPjSuxt1t$ED$$D$1E $A9T$ 4(639Ɖ $T$~c23t$ 9V5$63U3\5(63$63 23t$ T$u23=D43tjj RS藭T$=$63RSW 4$D$D$ (63 $9~bt$ 23$9V5$6325(63$63 23t$ u23=D43tjj t$(S=$63t$SW2 Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuv&D$)D$(639~V23 $639SQ1(63$63 23u23|$~#D$$ D$ ud$thB"$=D43\$tjj SV賫$63SVP $63f |$%C<@0MPhi#h'3f h& 23t e^_[]Ë 23u tjjUSWVPt$ =63T$-63E<\<&I,$D$h)(639~Y239W5$630=(63$63 23T$u23%$9C $631F9uEEπ;D$$,$L$l)(639~Y239W5$63_/>=(63$63 23T$u23ml9}C $631F9u,$y^=(639}$63_239|W5$63.=(63$63 23tT$ 23T$M 0E+63;635(639}$63J23$639|KVPF.t)5(63$63 23u 23u^u`I>0JPhi#h'3d h& 23u 23uu؃^_[]jjfWV463 0639|ld 063j Qh,63 tJPXJPhi#h'3c h&@5,6321,63063k463L$t$T$ =,63@Q葤 ,63463RDVu,635463@LF5463,63^_SWV463463r9 ,63@<u|L19tWW#29u46343H2,43L2^_[USWV=H2=L2=463t 4343$,43D$j荣23463 ,63ÍS4R4nr@44v\1L1 [ ,63\1l1sRt6,lmL)1 ,63t)|?wt)LI1 ,63t~l)}L1 ,63,u44vL1Y ,63l1}w4R4Ӆ HA9~R,634@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=43t׫H243$H2L2,43D$L21 23u) 23u&tj\hB"$^_[]jlUSWVL\$d3躕hB"B"tNjt$`hB"SV fttu=<<߃u !3r|$L$ D$1V&FC"D$PƋO9rPSt$ o tu;_Յuͅu t$hB"-|$dD$ Du$$1Fl$?uSt$ hB"jL$j QP` $;Fl$|1ƋD$8u&1zPUy!Uhk$jD$ thB"jZNjC=m@!sHQPW xs{QPW x4$Uh C"\ =muqB dut\$fCShmWN HefD$t$Shmh=m8@u֍D$Phm8@W  y?60Ph"C"ӍL$fqQhmW 3Uhe"D$ukD$Phh"hC"7[ T$ͣ"hjD"T$C"hD"d'3H d'3~\'3H \'3 PhC"kh\'3j `t$8t$8t$8t$8t$4hC"Zt$Ht$Ht$Ht$Ht$8hD"Zt$h7D"zZt$ hPD"iZjQ:5PhD"h'3\ jQSWV֋|$t D"?tD"VQPZ JB8d'3H d'3;t'3h\'3j<_\'3H \'3^\'3H \'3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hD"VthD"P&u863hD",thD"Pj&u hD"hjhD"hD"+ P u hD"j0kD$ u h E"jt$,)݉\$D$$D$11D$$hE"SU c7~+Hr߃8tlH w&$X&<<$뼃4t6맃dtket/1@D$=<<umWt$7%Xh E"5<<KD$71@D$$+L$ !3 !3T$uA!3$T$uȋ$D$,jj@Rl$L$ $tL$ $L$,1ۋD$PCEu Sf)St$PʼnD$$5 Ull$$T$DtIL$ىL$$U$E L$)QPR 4$EuED$ush E"h$\Du]hJE"bh$E"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh<63t$ t$,QPRQ,t$ &yjL=<63y heE"|$$tQt$(jVjhS y h|E"6jVjh5<63 y hE" h E"Cǽt$(1CUVSwD$P UVSw5<63y t$,1L$XAAA @D$HPQS =863u'l$hD$h7jUX&. ul$uYDžy h~"1O~fVS5<63 VSt$V |$h5<63l$0fE<u1/u@hWj9 u\/8N/18tƉjjU tD$68Zt /8tEVSt$ x )b.8#ThzR%|$l$8fE=863ul$0fE9EjD$LPj |$@f9fGfG<63G$jVUP tQf|$<tٺtf|$4t?<63L$0u+fD$<=863ufD$4 .8t$>Nf|$Dt1BuNfD$Dh|$u%j t$hE"jt$jHhY#y,hE"PhE"h'3SjpHPD$L$jQ5<63 XUSWVA1K8uSt<։0-hU7 ~WUV ~)u1,1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSy?ƅu]jjtqƉx jPS ǀ;t$8u<,8"u(G=w(rfljF^_[ÍG=rhhE"jh E"jfD$0ŇmjGfP=@63tD$L$ $QPj-9 XWVt$|$ t8PhF"j8 4K! D63A9tL D63^_SWV\t$lt8|$jYPWY GY$Y&Ӄ(Ӄ,T6F60 4 8 WVd^_[USWV $8 $4 5H63VPVi0W5Y&1WWPփ (JWWSփ _ƍ Wh PY& WjjW Y& TV$Y&h <<Ƹ jPPV((Y& hVU V|E=a==hD$\jPSY& 1Nxr$ SǃW0t^SWPz tg0$8 h&F"j]60hsF"jF6 1N ^_[]þh&F"j 6۾ShMF"j6 ¾hF"Vk=bt =buk $}u+Zt$WSVL$  FYD$t8ShF"#ShF"WVP 1QQt_0( Lt5L63tQP%0,tt|@P Ɖ4P 8tg04@tt| r>1A8Љ4DAtt;L5rShG"j&4 10hF"WV|$x$t,WDWLDWDW8Dx uWJ jtw\wX=29}5PBt852WVhG"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$WZ $>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP谮̀ uCt1t RPpL$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RPx$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$PhmJ",hQJ"!|$PQt$t$RhJ"j"C$t&8$\T$XT$H|$RQt$t$Vh+K"j}"$L$l$8htK"hdK"hhI"USWV u|$W谺1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h`G"j!NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPjl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hvRj,PSwD$HPhY& |$0hvRj,6S9tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhG"j^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhG" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ X63X63`63`63p635t63D$D$TH Qq T$T$ t$t$QShL"j 11KL$0t.w SPhJI"jV563[S63463t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h=ljP8西8H H;1D$8<9638D$D$ tD$tD$L63ڋL$4Iʉ9w9vˋt$ 1t$t$81QSPsM"PD$tD$t$t$8WSPsM"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhM"D$8Ph63Vt$,V'~GD$D$8D$HD$L$PD$LPh63VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L h63l63tt94 S.8L63T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$PhM""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhN"D$8Ph63St$,V~D$@s, D$¹tt;<FG;D$ L$?-VhZM" QhL"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVhL" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1QhL"je1gD$4$DŽ$߬$D$D$D$@$߬$ 0Y&a111CƋD$|$8D$|$H|$LjD$LPh63VL$HL$8t/63ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh6N"b11ҋt$  t<=p63t63$T$p$1߬$$$߬$X63X63`63`63DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=63$t1J8D$<D$ۋL$؋63k,L$1T$9|L$$)щL$ Ɖ$D$HPWhfN"W $PhD$(Y& yN<L$ L$tL$L$8]:u*t$ tD$PhO"j, ,uhO"j uhO"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP蓅3D$ t(Gdt;<r61@hxt 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWNJ1 t1t$|$ 9|1t$$R]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPU4$]0hVP: ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhQ"jT$$BRt RP譃RPVWjt$$VhQ"t$$.k,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`PhQ"j D$,|$D$T|$XD$TPhY& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$63 63 29|[563tFNu 63563t5FNHNFy F4VPV63@631@j@PڸU1@P˸F ~4D$F(^$F0^,n#2^863 63t q463^G FtH 7~ F^_[]É 63=huS"hnS"hhS"hnS"hh!S"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 63H63N^,H 636363H@63P 63 63H63H4I63H89t;tprp634063t4F 63H^hS"hS"h4h!S"zUSWV}]uuu W@t 631@631HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$g,Y&s(Y&G4$O,52w0VPww D$0^_[]USWVPt$ff,Y&s(Y&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j޴8p 73HtƒQ 73@ 73^_WVt$ 73F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdTFChjv v&^_USWVPT$|$:%473\$ 73$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4G31ہ=73| t Pt G3731t 98t@^_[]Ã^_[]`V15735G3hVh73 573^ft$ t$ 蓨jYSWVt$frLN4F,=2~0WPvv 1,Y&t\fv4V1AN4F,=2~0WPvv 1(Y&1;NuN^_[hO"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRm׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSl$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h W"hV"h hI"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPh3T$3D$M u1^_[]USWV(t$e$#!|$GdL 73D$@%73t$N0tV0Q40F4G3V(҉tL$(J,D$G3@,G3(^_[]USWV|$j8jN1F>FFF ]F F$|$0tfhjljPLtLXt uB\I\$$|$ C$|$4Nh$X"'<1ɺPt`tLtt l$,\$(|$0uejttP辦ttP蔦A 芇t u_4u_4_HoL_HoLUS6jjW'hޛW>q$ 1=2lj2l$1 UPQSWVhjË}Pw ST P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhjjNjl$hu P裦 P E1PUtA|$4t hW"*%SW1^_[]u C4CHKL1}Mt|$4t7hW"$t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW":$  $ V 19tQRhZW" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhT"ܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthT"h\'3蔢D$(u KHKpStURQPt$DljT$t hZX""u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhT"^ G3VRh9U"G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhU"D$L$9tQP$$hU"݋t$Ht$nL$tI9ȋt$ tPQ$$hV"衋1t$<\^_[]h~U"hpU"hhT"h~U"hpU"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$aV"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttU|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$V"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ޤ,LD4@hD$D$D$,$D$ 诤,@o M|$@ t"D$D$D$$D$$V"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$aV",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$DG3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW[HƋD$0T$UW?HƋD$0 u$$$UWHljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPGERPG$GW #RPrGERPbG$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaV"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaV"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaV" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWCNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPBt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP BT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPYA|$FV D$t RP1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP'?|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP>$ D$TBL$?ttXLT$BtJ J T$$T$ QP/>L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP=ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV;D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv : t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hV" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hV"hW"h h W"hV"h h W"hW"h"hI"踛USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p kzA L$H SjQ衝 ^_[]USWVL$T$ BG3ulF1GZ&UhZ#,$d'3H d'3~\'3H \'3 h\'3j mu q1^_[]V3'3PPh]"VVjjh^"s`X"@Z&Ph#h'3|Z&ujGUSWV׉΋*h`X"U"Y&tCt[PUjhhG3s 5G3趈K3t2G3G3WVS5K36^_[]Uh2"jW\5G3hk$ju\USWV$:$D$VuPsY 9$j uPVY E1ɉ\$QSu Ƌ88"u11F9Ή$<$ܞ1ɉQSu K ËD$8Չ賞8"u !t$$Vhyd5K3豆 tbVhY"^_[]jhY"7jh7Y".uhiY"$hY"hY"$p hY"hY"jZ$05G3he"jZUSWV}E ph}%V貏FhHZ"V蜏hf$V膏SD$(P5K3+Z#D$0= M$L$A1yyy D$Phwd5K3g D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhj脋D$v1111O w+Ow?u$L$A1AAA D$Phwd5K3}  \$tmt$ NL$,D$(G3D$FD$FD$ FD$$~D$(PPWt$,t$t$t$hZ"{ KuD$1D$|$Ynhxd 5K3փR5G31111VQRP5G3hZ"hxd 5K3莃 G3LQhZ"ww ww5G3hZ"踾w_G|$9w  jPQ5K31!¡G3tNSVPh["eWt$ 5K3m0 $9t"Q6h\'3rSVPhZ"?كT$;r ZƉ[|$?e^_[]jjV5G3hZ"lh}"hqZ"hNZ"h'3 jQh9Z"WV$u>$jvWS s'Wh{dЀ5K3 t^_jh["j%V65G3he"jAVVPPhtd@5K3蜁 $t%t5G3ha["$y["uJ["5G3QüG3$$["["sO1#QPh["虼 G3$$ ["sO1#QPh["t G3$$["sO1#QPh["O G3$$["sO1#QPh\"* G3$$sO1#VPh>\" ^5G3h=["jUWV$u^Vhzd@5K3^ tH$D$PWVh}\"讻$PwwwwVh\"茻^_%5G3hl\"jTUSWV}D$Phd@5K3 tzD$Phd@5K3 u5G3h\"<G3$|$\$ t$jVSW譇VRPSWt$h\"Ϻe^_[]f5G3h\"jSSWVP|$uX|$_h0#SЈƅthX"S輈u+1Qhwd5K3~ t ^_[75G3he"jQSUSWV|$0t$,1@4<!3$1ۉ؉D$h\"WV:^ qt\$te+$95!31|$7wWh|d5K3?~ D$ ;D$t-i9l$sUt$хƉD$l$묅hhPVPG3L$ O1#t#RQPh]]"#|$ t\ư1P`VvvvvQPhn]" G;|$ ru5G3hC]"Ƹ$t1^_[]W5G3h\"jQ5G3h]"j|QjկP|$u1Phd@5K3| G3tQh]"QXD$ 0Qhe"jTQSWVP|$t$^h"SHtDh^"S6t@h9"S$ttT$da3 D$dD$ tTj/S;`tF1;tٍT$d#3D$dD$,t>\$:t$1\$(Xa&a&ho^"k u1\^_[]h^"h^"z!3=,K3uj=4K3s1@![Vs ) ȣn3n3n3n3? n3 m3m3n3pp3n3tp35n352=n3=xp3?w4n38n3=r$r$4n3 pn3tn3lk3u 22]u1hQP0 2u25lk3hk$s.522j52|Vmpk3u Vhr_"8 11htk3t1A1A1ۉL$@1htm3m3 m3hm3= K3u#TK34n3XK38n3\K3m3uM `K39w>UUUU)ʹ3333!!сisdK316m3t!tt2m3rm3cԋ:m3 Dn3Hn31>m3‰ Ln3Pn3Xn31 Tn31AhQh@n3G i-@n3=Tn3 / Dn3ًHn3P+==w !r%1H$D$ ʀŸw1D$ $}ȹ:m3yt,m3t  uTn31I $L$9 @n311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uhfu"$D$Nj n31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$4n3-8n3= p31K1Kޅ`1PPPPPP =28hw"12m38LFu=(K3uRh{"%tajh$|"v1P|"WjWWWP+ha|"t҉rm3u 2m3=8K3u0K3u -dK31ۉl$(-D$D$D$K3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$Hn3 Dn35Tn3dK3D$t$m3xt,p9߃| 1019޾|ω t rr ؋ $1ۉ1ɉ6m3t;:m31ҋ>m39߃91Ouω‰ӍQ|;-m3m3|7PK3L$ T$t$u.h"h"E\$ L$ T$t$=(K3tt$1|$4uʉw"PhPPPV @K3D$ \$1 Pn3Ln3m35m3$L$$L$|$ u4$T$T$4ȍDD$u~t:t  Iu8K3 щ $ )uhO1#Wh{t"w |$Z)uhO1#Wht"w D$|$:m3:9m38m3 7m3l$M?>:m3>m3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$w"tD$x"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4hbw"s D$ՋD$D$D$D$D$$t$t$D$$  T$dK3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$ThB#S耢< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhw"p p3Vlƀ p3t$Vhw"p 5`K3D$,$t$P։ω,^_[]hw"jo USWV΃ twttu y"^T$(|$$+dK3уD$ ;Dn38y"L$ Hn3|.|$,T$0 Pn3|$9=Ln3|=(K3u|$4u 1^_[]Ë-Tn3~} ʉ$9tw@n3|(tk Dn3t( T( (t1+dK39\$ \$$}2;T$}#=(K3u6|$4ttD(OG1nF]y"t(n9Չػ}n9l$\$QAuƉ6m3tt  $tt ^:m3 Dn311 Hn3t$ -Tn3t$|$$|$}@n3] ʀ|(tP Dn3t( ;L$T$|L( (9Ή} =(K3{|$(t ;@n3KC Hn3Dn3y"1$t=t Dn3 Hn3Sy"=(K3|$(5Xn35@n35?1\n3Xn3Tn3Pn3Ln3Hn3Dn3Ɔ6m3t$ |$(P6m39Xn3u85@n3>1\n3Xn3Tn3Pn3Ln3Hn3Dn3@n31Ƀ|$(T$3\$1 5Tn3n @n3|+D$Nu @n3[\$j5dK3Dn3)؋ @n3P|$(t$ hhj/7@n3VfǀUXn3L$ Hn3D$Dn3ƋD$$ȉ5Ln3Pn3Tn311Tn3u@n3=(K3hz"?z"uWz"y"=(K31|$(9 Xn3u85@n3=1\n3Xn3Tn3Pn3Ln3Hn3Dn3@n3Ju UPQ Tn31|$(tD$Dn3D$Hn35Ln3=Pn3^_[]hnP"jWV@n3t^ tڋt֋|҉tΡ@n34 Tn3 QPV Tn3ƀ^_USWV T$L$Tn3@hPh@n3  Tn3@n3~CHn3Dn3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR[ @n3;UjPB fDŽ;UtZF , M ;M;MU;; Dn3 dK3T$)ʉUL$  dK31 EE=Ph"h'3e jZUSWV\T$t3< $Sm$D$9d$ՉjRPt$ V'11 Sl$UV 9 1U\$tL$j@PQ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4 a&hN"$bT$l$ u31ɺ$u31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$u3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf u3ŅtMaQ4 a&h " aT$ t tuf f111u3|$ u3 u3T$$u3%u3f&u3l$E<$g\$ttXaQ4 a&h~"` ;B Q4 a&h"b` <$\$t4 a&h݃"B`<$l$!F1D4 =v3L$"20U?PWt$h"jv3{<|$\$W4$'Wh"h"S薊4$u h E"jF j/Pt|4$4$|'jLUSWV\$ l$|$t$1Ev3N,&v3 v3hӈ"WV h~n3itVnv3Ѓa~.btCd$v3봃otBs,v3띃NuS<<v3(v31= v3 v3mjSh`d&5<<tHPTEuA!3)ރu4t$$V41ut$(t^_[]h"jv,/Ph3"h'3V jK$"= v3uD$ D$@-"v3t e#P=,v3u o%=$v3u 0"=(v3u ]H$@P0h"h%jWVPh^"QkVt1ƉPjPWwd WNt jPV*P^_ÐWVt$|$ VWGt$?/tWh"cVh"c^_Wh"j#fWVt$ |$7ߊWVUSWV $$l$WVSU$ $ hU3Wh0"uWVhw"jGD$@tF$j$hf&hV=V$$$h":RjIUSWV$$$$D$1 hl"SU% $D$D$1G$D$ȃ 1$e&N|w5<<Ft|$`N|Z5<<Fx|$Cj$he&5<<8P5<<UFp<$hl"SUR V!3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h"jWh~$jGs.+Ph"h'3R j@GWVPt$jWV 9u9t x^_Vt$h"jVt$V t@^h"V^Vt$Vt@^h$V|^WVPt$jWV9 9t9u x^_Vh"jdWVt$|$ VWCt$?/tWh"`Vh"`^_Wh"jKfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h "q-1VWt$ t$MP:1@PPVVu4u0u1OËPhhf&P; }D@u hh l& hh n&S }D@PE,CEhc0%V\$thc0%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5PhS"+%t9\$t hq"+\$pD$p\$D$D$ 9\$~\$~tSh"+\$9|1} t hˊ"s+hW5\v3h" ]}4xME0;E4ru0h+"(+},u,D$D E4t hN"\D$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tSh"(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh"((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"'3PJ |$)Wh"'3PsJ D$ $L$t$}D@tCW&1@9tWh"&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$uDkL$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$LhPttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2Wh""h'3?D ;$uh'3jjHhW"$$D$tD$|0Wh" $tt$SWh"h'3CuDt$ vhC"GA ~$r-D$ t$$$0h_" Aj #@}D@uh"uh"uD$ttt$$DŽ$߬$$ڌ$ 8Y&|$D$ \$$}"z@F T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttPFx HIt$41VRtRRP*t$ tPhaV"AQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$SR VjW  t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjhV"}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8qWFD$(+D$L$,L$ ʃ{1QPWVےth}"jԯ1F\$D1VPSh"D$XWVPSH%|$$u1Ʌ|$t1ɉAw1@|$Ph"AD$tt$5Tv35Hv35Dv3t$\t$dt$<5Pv35Lv3Q5xz3 z3 29|[5z3tFNu z35z3t5FNHNFy F4VPVxz3@xz31@j@PNU1@P?F ~4D$F(^$F0^,n#2^8z3 z3t q4z3^G FtH 7~ F^_[]É z3=huS"hnS"hhS"hnS"hh!S"sVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP z3Hz3N^,H z3z3z3H@z3P z3 z3Hz3H4Iz3H89t;tprpz340z3t4F z3H^hS"hS"h4h!S"USWV}]uuu W@t |z31@z31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gq&sq&G4$O,52w0VPww D$0^_[]USWVPt$ffq&sq&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jR8p z3HtƒQ z3@ z3^_WVt$ z3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjvP v^_USWVPT$|$:%4z3\$ z3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=z3| t Pt3z31t 98t@^_[]Ã^_[]`V15z353hVhz31 5z3^ft$ t$ jSWVt$frLN4F,=2~0WPvv 1q&t\fv4V1AN4F,=2~0WPvv 1q&1;NuN^_[hO"01HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRy׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSGx$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h W"hV"h hI"MUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPAt3T$3D$M u1^_[]USWV(t$F(|F}|F |F F$|$0tfhj舳ljPLtLXt uB\I\$$|$ C$|$4Nh$X"3<1ɺPt`tLtt l$,\$(|$0uejZttP2ttPA 芇t u_4u_4_HoL_HoLUS6jjW'hjW>q$ 1=2lj2l$1 UPQSWVhj菱Ë}Pw SȲ P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhjްNjl$hu P P E1PUtA|$4t hW"0SzWb1^_[]u C4CHKL1}Mt|$4t7hW"/0t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW":$  $ Vx19tQRhZW"s 1@^USWV |$,\$$t$ tCPPt Ttt4RQhT"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthT"Uh\'3D$(u KHKpStURQPt$DljT$t hZX".u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhT" Ċ3VRh9U" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhU"D$L$9tQP$$hU"t$Ht$L$tI9ȋt$ tPQ$$hV"X1t$谸\^_[]h~U"hpU"hhT"uh~U"hpU"hPD$L$ $QPjĀ2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$aV"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttia|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$V"nu0|$ r]@hD$D$D$,$D$ 耰,[D$ p D$D$D$,$D$ R,LD4@hD$D$D$,$D$ #,@o M|$@ t"D$D$D$$D$$V"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$aV",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$DĊ3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWSƋD$0T$UWSƋD$0 u$$$UWxSljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP SERPR$GW #RPRERPR$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaV"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaV"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaV" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP Nt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPMT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPL|$FV D$t RPL|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP8L t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPJ|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPJ$ D$TBL$?ttXLT$BtJ J T$$T$ QPIL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP Iي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVFD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv 训 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hV" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hV"hW"h h W"hV"h h W"hW"h"hI",USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p ߅A L$H SjQ ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QPV1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD'Ɖ t,UFtf^81FFL$IIlt|t1҉D$M41ˋTt$0t$t$1ɉL$T$ L$D$D$$tD$ t$D$$"{L$0u%ltUH#D$'ltD$1ҋ}47RA 1҄1t$4 t$ 02ua r u:1GX tX U<T$A4 $Pe^_[]D$ "D$"D$C$w"USWV(D$@h+h1T$<PD$ AHltl$|$D$@@0|t1ҋl$H1|$<΋t$  3uN 3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPUPr$K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ 3{3 3\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(Њ3y ؊33Py`PD$@Ȋ3 ̊3C9݋|$"V$$ h<"=Vkp ^_[]1ىj=ߊ< t< uGjh#WP k2$( aj2WP;* EKu$( 8~y$( 1\$ىj(Sh$PEA u$PUh"K "j2PW) E2$( ;(|V¦\$c"V$( @V菦T$J"Vg$$ h"h"跣uD$ $PUh"SjuUI(<Shh"m $( aPWh"Uhi"$( x?$( Z1ىjPySh$P? uSUhB" j2PW[( E2$( ;h||$jt\hÛ"@PUW H $( ƁaD$ a9QPUh"g$( ƀa$( ]UD$PD$ PD$Ph"W9iL$\\L$\\ $\]u^E q&Yt8u1҄tʋ$( t?r QVR Vmhqm8uUh"Ih"Ph?"4USWVՉt$hR菡 1I t uFjh#V u<^Ft t u^F t tW%PWVg tt$hU u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV贠 űD$ 1GtPhk$e^_V%1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىhZ"+C< t< t< uh^"SԑƍD$$VhPן L$T$\$PQRSD$0PD$Ph"D$@Pf t$$$ىhB"rC< t< t< uS#=$<rLjSho"Sh"Sh"۞h"ɞt$<L$D$D$L$ oP(OtXljo 1tX L@uH~vCtTjhh"S V e$^_[]Vd )UjSe D$ D$ CD$CD$C D$C$Cl$UhQ1#VE= u D$CV~d)1$<;obD$D$PSh͝"茝 =USWV$0xjWWƅ~F$0h$1jUW~4$hPd C9uЋ$4h^"SǍ$ىh}"$0S!t| uƄ$ $0ph"QU]D$$0qh"QP;ىD$PU!PUS u׋$0EED$1ɍ$D$ $PhS7 D$PD$PD$PD$PhH%SbD$L$ T$ ыD$E L$ T$ D $A9L$D$uPPbh+"h"i }Sh+"h=" Sh+"h]"G  $02t$t$h"$@t$Ph!") |$Wa}~14\G;}|V\1^_[]USWVD$(}~;$ ~VE pS2  $PjVWjSND$11D$D$D$D$$D$ D$hg"u Vu- H5$r&D$>j 5<<P Cr3밋<<$PCrj h0#V ىVvSj1Po|uE$ ~S4VR $PhjSPt$VKuVh" ,WhT"jÍD$LPSCu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV"H _8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQ1 $Ph"Phr<rr h֠"jhr +rryt$$$PVWU>ލ$P|$xh_"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP0 $Ph"Phri"tx"PShJ" .1$P;$h"Shrt$VWϧ"9;$PVh"|$$Vh"h"jhr t$ji=3:$h&"Whrt$K"?c.\$j"h&"WhrS$d|1$XAA$Pj2PQ- $Ph"Phr9rh"農$`>ߋN8 &w@u&PVh"} `Ouet$$P\$ ZSh"c}h)"$P\$;$PPh"2} VD|hp"Sh*rt$  09rh"h&"߱$\>$Th^(%| V{h8"讱$X~:$\1j h$V "tQwC`;$X|j {~-h]"O$`>V?`Ouj O{$X1~$1:t @`9u9u$\Ph"{1@\D$,\$H|$PS$hjVAT L$,9F Vhʤ"VhrW hD"聰F0Ph"o{F0Pv,v(v$h$"R{j hzhQ";$Th1"'{Ph""h"Fh9$VcD$0L$4$PND$8Fh|"Vh(r WO  FtsSh"z$PtPhZ%zh"z$Tt*Mbi)QRhã"^z j ty$XqPShУ"4z ]hu""$X~n$1Wȃw,"$s&L$7С"!ߡ"" & c""PRh"y F`;$X|ۋt$~G$`>G8tu #P &w Xu&QWh"ay `Kut$h"VhrP>"t"P)t$1 E$`$d $jj h$QPjVyjhm$V! V$`t$Vh="x$XMbi)QR$\Vho"~x$|$|$|$|$|$|Vh"Fx $\uM#1whɬ"%L$!rK"$PPVxt$h"!11҉4hӀB9uO1#t#QPt$hޢ"w=3~S$h1h8"w1PQh"lw C uߍ_ j yv rt$h"Vh&r@t$~";$Ptq"i"tx"RPt$h;"vt$ USWV`p׉͋$tph"S E,$tSÃr t1C1|L$PVQ, Ou vu hu Z$1hoVWN owt1$0 j2t Wu  F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh["W  Ƈ$L$h\"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jh7%SI  tVjh"S5  tBjh#S!  t.jh#"S  jh0#S  u$D$D$h("PhrWhA"PhrW=3t?|$"t"PVhT"s |$u$40u&Vho"s ^_[$oWV}Nƿ'3Ph"Wu VhJ"Wu Vh"Wu Vh"Wu Vh"Wu Vhݩ"Wu Vh"Wu Vh!"Wu VhB"Wu VhY"Wsu Vhz"Wdu Vh"WUu Vh"WFu Vh"W7u Vh"W(u Vh"Wu Vh*"W u VhK"Wt Vhl"Wt Vh"Wt Vh"Wt Vh"Wt Vhի"Wt jiVRhQ t^Vhk$j WVPΉ1WPhPPj PQ u^_Vh"Qj USWV։ωl$PU\$hjS:J E9C Shʤ"ShrW Vhs"zqssss h"aqss3hå"Lq{""t"t$(Ph"%q t$4t$4t$4h" q$t$Ht$Ht$HhF"pD$8Phy"p$t"Vh"p$40u&h"p$h"pĘ^_[]t$ t$ t$ 4 tt$h"ju USWVӉύD$(jP1t$`FFF FFD$hO1#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPD$HD$PD$P @Y&54Y&|$D$ fD$ l$ \$Tl$+D$Ty1s&Phk$j($PmT$D$ +T$(+D$0хyL$XD$\D$\5DY&D$XuT$hL$l+D$$D$ $߬$Y&ݜ$ܼ$D$pt$t$$߬$Y&ݜ$݄$T$xL$|l$xY&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$PWl DŽ$ <\$D9r<lh&"UhrVuh"lt5|$d} r"<$c!rɬ"P^_[]USWV$`T$$<`$8`t$D$0hp"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$  u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ < u$8`D$1@$C`Mu΃<$t $`^_[]t$h:"jUSWV$,hB" B"tŋ$0h"d >"t ,3~?-|$h"VS M~%Hwv$pu& 33ǃDt*Mh#5<<l(3u5<<M\33nNRt 3j W5<<3 03L$9&-<<Ԁ2 333Ѐ2j W5<< ؀2L$9]`433}3nP*tW2P)ujjQPhb"jhD$كL$l$ umt$6:l$ 1  ut$)K3h֭"5<<h"p5<<hE"` $L$L$GȍQw[sV?PJP)-G A6P]Gu$t L$-AGL$AL$$j=3us5= 3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$he%SO!t jh{#S; t ;/u f. Gf./WdSY9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS}tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 5Ѐ2 3H $s-t$$tHfHxt P2)1^USWV= 3th\'3jjhִ"jj9#tvƃ= 3th\'3jjh"31GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=3tV$Ph"h\'3N ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph)"h\'3M W_1l$$ttF9u t G9t$lv&Qt$h3h"h'3-M<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"h'3LEuFufFFV!|$WP`WV&N=31ۈ33|NIL3h3=3ǀ3|NAMǀ3EFNDt$h3hѵ"h\'3K1N1@=31ۈ33|NIL33Wǀ3FNDǀ3|INOW3ǀ3|NAMǀ3EFNDVdPt$h3hM"h\'3IKC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$hZ"h'3J1t$h3h+"]a >W\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@=3$ WbPt$h3hM"h\'3IUt$$t$$|$$WƀH1@=3ىV_bPWh3h" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3hM"h\'3I؃^_[]S133|NIL3t!h3ǀ3APEǀ3|ONTt!h3ǀ3FNDǀ3|INOt(h3ǀ3|NAMǀ3EFNDƀ3t(h3sǀ3|MODǀ3ECHGƀ3[SWV= 3th\'3jjhF"3=31VWftmxtg 3W sJX tCf{u7=3tSPh`"h\'3G S\S [빃;=33k53tc~ tWuLfth~"W Z=3tWRPh`"h\'3G Wy\W9 륋v$^_[SWV= 3th\'3jj h"3tS31{ t$C$Su[SFuՅu53th"VKYv$^_[USWV=3R 3utDh\'3jj"hж"3,th\'3jjh"5 3t$G!jj#^ơP3;3T33,׋- 3WV]Ɖ׋ T3P39sAWV2ÅuWVh"p\ SPh"h'3E c렉1‰1 u`WVÅu hP"%\Cuhf"SXCt SZcSSPCcQPWVh/"h'3E:K 39tPt$ ZU- 3P3;3T33^_[]USWV= 3th\'3jjh~"fH3jY9T jj\ʼnT$3 3PQ\D$5T35P3J\Ɖt$U9\ʼn$St$p\Él$9$\$T3 P39ˉs6fH3j8DTk D$;P3T3rM\$ - 39sIT395P3s9- 3tS  3E9uT3 P39\$ T3 P39ΉsZWVÅu h"YSCPh"h'3C cWV[ƉסT3 P3911 uU9t$D$ rIWV<Åu h"|YSPKAc9- 3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5T35P3fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ= 3th\'3jjh"FtVPXfvu݃= 3th\'3jj h"3=31ҹ$RL$QtMƋhtDEt9VP|$ W51ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV= 3th\'3jjh"3=3rc11CWS5t:FfN~u %fFfthʷ"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"h'3? 1^_[]fUSWV`= 3th\'3jjh:"53535,3hY"hhހ2;3 USWV$ $=3߉+ft`hjVh =3tfʼn$D$CjPl$U U4D$fD$|9r9114+=3tȉFffF=3t>t=3uFFF%)Fu9rV9= 3tJh\'3jjh"AF 3t(t$h\'3jjhջ"F 31V9vtRPh"h\'39 3th\'3j fJ$ 9̓>t9߁^_[]á83tPjt$t$|uùބ2WVIAfF=D3|CH3)fP3543jQhL3u5D3F1L3PVQ` =H3FD3^_ùހ2QhZ"$8u"h"h"5,3h~"h'38j~-WVjhހ2耨1t)h lt 8@ W0^_VP3 T3t7#L3=@u%o>P3 T3tL3!=@t^USWV$$$ $jhWV(,L3tE1M1 tmjWVS$8jWVS$8t$Shy9%hV3V$ @3U Rh5@3DžtGhe%P tSh,"h'3&7 5@3DžtGh#PtShT"h'36 5@3[Nj5@31jPP6+^^$DOGrhPD$Ph}"h'3z6:hPt$V $(j7V@ @3u D5@3Nj5@3j1PP6X+^^X^_[]SWV׉1jPP1&+FF9tX\$)yWh"h'35 %؉jQP6~tF hP67 F^_[USWV|$_ OtGhS7  GO9}vDty)9|n4 ȉG.uFhV%P;-33rv=3tUh׹"h'34 \GP1=3t:Ph"h'34 %1=3th'3jjh"t1^_[]USWVD$$P+(D$x/@thV%Q;1ƀ81Mbi)L3H1ًP1 t @3P RV5@3At\G9uGSVPr t5@3Džu*hV%D$P;tƀ8MbE^_[]USWVt$!M1 tFjhRWh,L3t(E1M1 tm`ƋU R^_[]ËD$0謣IUSWVX= 3th\'3jj&h"3 ߉^_[]USWV|$u h!">W3u`Ɖˋ-83UDžuh+"z>-83)ً39w؉9vlj<3|$3WS2^_[]USWV։ϋ\$ t;=33rVWh"= -33QPVWR{s LK$\=3t%[$tC1K 1 uh "S9^_[]SWVt$f~th"V9~u(~th"Vg9~ thԽ"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>W333F$53^_[ËAP 9ttЋR9uIHËIH h/"Qt8Vt$V貸33^SWV|$t$Åuh"V,8;^ty^C Fs j/WvGSH3 3W W#FV86P1ɅF fN^_[USWVd= 3th\'3jjhF"=3td|$xh9"W$ƅu0Z0+ Ph`"h'3`$ Wha";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSG39|͋ 3 $53T$|L$<q$Q Ai@3D3QA 33QA03A$t$ Vjj(QF @t30Ph"h'3" t$xh"8V h^_[]USWV$= 3th\'3jjhȾ"e1PPU蓑 Džy0u0FPha"h'3{! Uh"88D$,PWy030Ph"h'39! Uh)"7$jSƅu hK"7SVW訐 xD$j(PW蔐 y00Ph"h'3  Uhs"{7Ww3RrD$l$D3=@3,$1Չ1 9$h'3jjh"jj5353ә3jP3u h"6PjPhe%HĨ^_[]fH3D$L$ D3@3D$L$ 33=3u t$(6t$pPhʿ"S6D$ L$$ 33L$T$ 3<)3؅~ڋt= 3tPWhh"h\'3 =̼3 33hQV0 3 3^_[]t03 PUhh"k s-3hh3U X0)Ph"h'3^ j4USWVE3fH3l3 h3D$?SDžu#Sjj0SDPO/F^_[WV|$ th"WWNƃ=3uhVHx= 3t.u Ft#zfUSWVt$l3hj p=3t3:h E"h$3iPǠ30,l~Ƌ=3j@WtAt0.3_6Dju_t - Cu@33@jhe"QVPh3芪ǣ3V03 9| $=|JjVhhW4y($ $=|jVhh53̋=3VPhhW|$VWjj53ȫ1@VWPj53谫=3^_[]Whn"jch'&j'xhJE"hX"jwh8"jwSWV$$$Vh "hWW3S ^_[USWVӉ΋|$-3RtPSUVO Ss9u ^_[]j\=3u.#"j3SWV t$t$4h"jVY#jfƅ~'|$01ۍ)QP53O ~9߉ ^_[jUSWV t$4|$8\$Wh"jS>-3SsPSUdN WV53TN 1BzR% ^_[]SWV Ӊύt$sKt$ tVWhe"0 |$W*P01HFu3h#Wͧt9h+,%W軧t'\$j SW\ $ 9uy6h*"U$~h#Wxt@h+,%Wft.\$j SW[ D$ 9uyvh="jqD$PhU53f u ^_[2hM"jqSWV |$t$ >h#Wզt9h+,%Wæt'\$j SW[ $ 9uy6h*"U$~h#W耦t@h+,%Wnt.\$j SWZ D$ 9uyvh="jpD$PhU53n u ^_[:hY"jpUSWVh $(1hWD$ P |$ |$ D$~P1ۈD$$,,jUhW"a tjUhb"a tG99ufD$u\$ tR$,4jVh`h%4a EjVhh"a 4jVhm"a 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@hv"P蛌 ߉tD$PkDaryDpriml$t?tD$PkD andfD D$PkDgrowfDnt$VpkD defDectsDuVMkjh"P V53535353h"Et2tR}jh"V舋 AH}j1h^"Vc #}jIh"V> Xt6Wh@"Shk$UփOut$裦 h" ^_[]1hC"jtmUSWV}\$j S53O D$t"NuD$Hj@PjSPh"jm$j$Vjj53rF=tPh"D$D$ D$$fD$t$j VE 0O 9 1L$81qAQQ a A j QV53-D$t$ *jh"E p]  D$ @L$jhtjPjQ53h" h\'3轇D$t$H1D$`D$L'Ƅ$0VhQ`53M $j D$tPSӈ |$'y9D$(ȋL$;x&|"@D$Phh"`h\'3j 9)D$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53h" 53h4"h'3E P53hG"h'3*hp"h "jjE 0h"`USWV $ ~($ 1j4h"[ ?C9u1CCJt$LUPV迩 CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P53535353h" vL$D$$jh'hVjS53Ffȁw$VhU賆 VhU袆 ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWh"Whh#vL$D$jh'h$PjS53$f1Ɂwh";t$ t$ 1؃;D$ D$4ƜF>|$Ń x&h&hc5% ~y)L$hL"SI1L3H3D$L$P3 T3D*h#Pn|=3<3<3)h'3PW G?t ;3rx9u;3 <3\$)<+.3T$JDHUBRq k<H3D$ L3L$D$1ɸ=3T$ωD$ \$SPƋD$)D$tGD$ D$H 1ۋL$|$=3VQP= 33=3ۉu\$ .3DQu+<:wSDPeKC CCCCuhP"=D$PuD$\$SO $&D$KL$  S J#GBD$ @h=3O@3H3 L3uh"hP39Ph`"˹6X3uedPym$t X31jPPe =3u'?4tu/ht"ȡj貰 ej jhI"询 MPh"<j肰KAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQvT3P3!уu+D$T$H3L3hS"j QPh|"h'3t jJUSWVP=L35H31,9|1C=L35H39}`s&H-&E9ƉMm|)t6jju uL$>L$9ȃ}  $QF1F,MUۉu1;}E|u E EmubWV"V<?WjlWjaWjVWjKhhV) x`j"h"P' hP3 jPVf' jhջ$VV' =3WKPWV=' V)^_SWV։ϡ\3H \3uhh`3B`3h"h"hS蟴h9"SatZÉ $"tO1#h`35X3Ph"S1Y|@hP3 Ph+"S ykh"Ph"j<|.i< O1#t#QPhH"S諷 t Sjj!hl" Sjjh"zd@3tSPjh=3`dhd3#u;h\V\j\S1W[WV4^_[WVP"=03u%$3<u" 3u"uI"h=35X3Wh"j违j= h"@=(3uh"*=3u6hhh "e& xjh"P$ V&'3Wh,"jQVp3h"jB_V7j h4" 03u$3ujj&"u""u"$=43u D$@"D$=83u "=<3u "=3u 0"=,3u e#= 3u F#H$ 3uH18h"WPV% 8Vh"j ؎8Vh";4j=(3u h"j褩jhd3hh"fUSWV|$D$hD$}4$>D$0D$D$3$c"货GHtD$$t"蝧G(D$$~"芧$ 螦|$,u=32t| 3uteXu<$L$$T$  3u t GX@r9=$3uD$D3$Գ"GXHw $B#$.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$\3$D3ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$,7D$(u; 3 43Y= 3LD$D3$"3D$(M I"$&|$D$ D$D$$$)_83ZG4D$hL$$T$ JL$0$fLưD$81D$D$D$hD$ t$D$0D$D$$$:6"4$wD$8i8 D$h$ff1uG0D$$<"D$,-1D$D$D$(D$ t$ht$D$ D$D$$$514$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$V5D$(D$4$D$D3D$(1ɉL$L$D$ t$ht$D$ D$D$$$4{4$D$D$$.e`1D$D$D$(D$ t$D$ D$D$$$4D$($D$D3S1D$D$D$(D$ t$ht$D$ D$D$$$A44$D$D$D3c[iF D$|$D$ D$D$$D$ D$D$D$\3$D3V 8 D$($ dt31D$D$\$ t$D$ D$D$$$|3&A1Ah2$D$D3D$"跤D$ @D$0t$h1AtD$h9k4$s^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$bT$<1Ht |$t$ $WT$a΀-% plj\$ Cut$BT$ҋ $)|$4v1ɉQD$PS D$ D$ 938*v8\$ L$ D$D$W|$h+"S"hDhE&S h;h&Sg7h#Sg3hN"Sg'hS"SgD$t$ |$@u1ɉQD$PSأ D$D$ 9؋t$8cu8|$Eu1ɉQD$PS L$ 99։D$uL$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShD34t2hQ#v 1<==3 ڍt$81 D$ \$phjShD3PVT$RG$1BD$L4JD4`L$p$QRSRPVd((3 $3u1$Pm$w &QhD3h# 831<=4 j=VVE9=3 j=V6ET$81 D$ t$ hjVhD3PRW$\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP8'$hD3h8#D$49t 8Vhx#S1JD$ $$Qh%#,=(3D$t$=3$D$D$,D$\$(V+GC@D$p9Vh#q0|~Pt$h#|$oQhA#=(3D$WSt$h-"VD$ 81ҸD$ |$\$ Cj"$PVÍD$pWVPSt$ $P%\$ E $D3jt$tS7 $D3jWV# -p0g}PhD3h# B(3 $3$PhD3haC&D$ $u1@t$2|$ Qh"(11G|$1\$ tpupth{#Qq)D$ t$D$t1@L$ ɉx%t"PQ^Q|$t zo8t1j t$ d4$`St$hx"FQt$h"7.l2m2L$ L$ ف$K{8P|$W^_D$ t@j QS( D$ ;$|$8tQtUL$4 T$hjRhD3QWt$ l2T$ gL$4D$ D31ɍAD$4tT8`T$ Q$QRQPW"c(3 $3T$Jm$w&Pt$h#t$L$ $d$ r $3 $tu¸#tS"PQh#|$D$u |$u |$TF1@]x%t"Pt$h"$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0QhZ#l0yPt$hu#|$L$lj% L$St$h"{D$$&_l1ɉQD$PS L$ 9t 9St$h"",D$ D$ D$D$0L$0RPQt$,t$$P tBD$tUtsD$ |$D3jVPM D$h|$tk811FD$&|$D3VVP  D$'$D$8|$D3jVP D$pD3jVP UD$1=(3D$44$Vt$h" Ph"=3he^_[]4$h"ًt$D$t$$t$S#@9s Vt$ha" S#@D$t$|\j1ɉQD$PS T$tD$pD$ 9t8u/j8 St$h"Qh"j1ɉQD$PS觚 ƋD$ 9t8t}St$hC"St$hZ"D$t$։D$iL$8`OGL$0d$ rxL$D$nT$_iL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h" jlj-=uPhD3h" h"h#h#hD3h"SWVPD$t$|$L$ $QP67"9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS41Ht$L$ltT$d;WuT$h;W(u QhL ŃtD$ppPU)A D$DGXHr P\oXd^_[]USWV$l238D3t 3/3ShD38tWD3މ)ˉESQ|$ W@ DW3V Vfǀ3/SU8uD3Uh3I ,^_[]USWVhT$D$l"$&1Ch3uD$ CL$;rjt$Vu ufD$jD$Pjh3V.t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVP|=Wt$hL"|$$j@WVP_=Wt$h\"j "WVPt$=h2cPhԳ"Wm 3t5<3Ph"5h2JD$$PV5h2裏 @3^_V΅tOdHw;s1 3 43ted0qPhD3h"M Atʡ 3 43t"d0mqPhD3haC& u =3t^jiUSWV=(3ˋ}$3 ,3 t u tth\'3jVu%7}ti=03|}t j MO؃thD$VuP= t$UtuRhԳ"<{5p2Rhc5%# bD$VuPM= tMD$PVh " D$VuP= t+t$ t$ Vh"辆]D$ s*P? D$L$ r!QPh $ rD$rIPhQ1#QPhhY$xt$h* $_}u h"Lj ce^_[]Phz&USWVP=(3u(ˋl$ D$$|$5$3 ,3 t u^_[]Åtth\'3jt$W85܅03| t j Մ$^_[]uCuWt$h"舅 K4$~DN1ۅtPh"ft#=03uPh2"G9t03C뿃u,h")'t+ORhԳ"tfŋ$L$ 11RRQUSP tO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU= 3tM<$1\$t$Whl2Rhn"jSzL$$jjV G;<$|u 03 ,3tщjPV=$3uRhԳ"{<$~/1t hH#{ttVh"{F;4$|j zt$pMĄ^_[]Rh2"j`USWV$=3t  $D$\$tW1ɉD$QQSP$V j(&WʹU&t3j&t$Su$U%W8W$h"{ =3vjq11ۍL$l$ PSQU$Vb tct =(39$$D$,3 03tT1΋$PjU$h"1Ʌ7_l$ 11΍L$AAQUD$L$PUh"jdQ:x$WPUV to,3 03t$jjPDH1L$AAQ\$SRD$|$PSh"jdWw$jPW Ā^_[]USWVP\$(|$$1PPUPSW $P.:1PPUVSW tu=$3u5p2t$hc5%x $ $ r/1۸O1#WwwPh"\xC H#;$rj dw1A1AyV J^_[]Ph"j/UWV0EMT$1|$ VVRWQPt0M|$03 ,3tT$ jj1Ay=$3uQhԳ"w1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$#"+we^_]Qh2"jUSWV@$ @=3t Z$ Viƍ$ h jUHO h%V t}1ۍ|$1ERSWV$ L$99=z  h%jƅu$ 11L$RUPQ$8@$8@tIt =(3$,@$@,3 03t.1T$Ph X1Ʌ1ۅÍL$MP $@SPUB U$@CGtW,3 03t$ jh V0$ P jPS SF@^_[]@Q8"tD$9t 8uVhQ"Vh@"j h3"hk$j USWV \$0|$,1PPUPSW)4$51PPUVSWl=$3ut$ hԳ"It>rt51t ttt ttth" t 9uЋkT ;$tl  1L$D$Sjh"s {t+1:LtPh"s G,;{r܃TD$@TL$9uj rVOE1A ^_[]hD3h"+USWV }=3t D$ toh"WFAtcJO1ɉt$QVW T$$9t8u O8,Wuh" =3ji11CL$ t$PSQVuuqtWt =(31=,3u?=03u6L$1J1ыT$1 u#MUPj h"1ɅRaMUPjV tK=,3u-=03u$1H3$3|$ uMUjj h"MUjjP e^_[]ÉSWVt.3q~FDx@uAFX@ut9v.30Dr@tH^_[USWVPω11s6tUVhg"SԥUh_#Så t9VB4$EuuhO1#hƉ$t^_[]hs"hn"j hs"h"USWV\։ύD$ jPj PI 1u0D$F|fD$Y|Uh "j D$ Pn$L$D$ L$/Ph"j D$ Pn[ $fL .3/LA .sD$ L<u\$ SjPj SvH E9[|$ t D$ PɤVh%"od^_[]WVth΋u\~8tU~4~`N4F8 I9rPSA1F0F4F8FXHr P4AFX^_fUSWV\$33hS#sP\su 3Ih0"P3=u 3j-3Jmx &蹶'?c.53芓h0"P<u \4=\4^#t#l$PKrt Pu|Qߋ<-t<+u{uNh%SP<tGSM16khc#q3t8u)hj#q3Pqt 3#hq#}q3Pqt 3z#1= 3tjh#~FP7֛j觛N=3u0j_`ujjB=03t!=x4u=3ujh# C1FVV7=4uh#502:u\~jh#B jM54f:0BuK@33!Ѓt443Bzu=4t0譚|4jS=4u T3=4~jh#u j j 6GWVt$ y5 35 3$3ut[<|=,4t=83t|2'V1Wu=WSBV|bWV|$ W@jP36tWPDa^_t$t$ 6tjh#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9<3<@3U504))=p3u D3p3U=v====,=XAf2 D3it3x3|3F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fj<D$t3D$L$d$ x3 |3D$D$fD$ D$504Pj5048 <3,^_[]VPhht@jb, t1h$#ktP蒵$t$uչE%~3h#rkt(PT# 3 32 3 3u.h/#!kt P#Tƅ~53h*#jtPϴ# 3 3 3 3P^V[tP茴=3t1H V&{^PL$$31Qw$&7#M(uMf3 x:#4=#+@#"C#F#I#L#=YÉO#/uf3R#uf33WV׉vu1=3u WVk{^_SWVPhU#iPi1Ʌ 2hwU%ui&t3Qh3$xt3h#t3Vy T"3k#3n#3"%31"3q#|351"y33333333~ L43,%3tj<d#O1#O1#t 3##gtlj=3t#O43w#>#t 3#!#t 3=|4t8=3u/湯#3 &3=3u 313O1#u 3O1#KW$3t8u033O1# &q 3=3tt8u03 3O1#2#:3t8u033ջ$湲# 3t 8t1@ 3O1#13O1##a$VWWh 3h3q"6&V5 353h(3h$3H# %V5 353h03h,3N% %V5 353h83h43S#;tlj=<3#m@3%#O1#O1#tơ38t,<$1QQPx PWW<$W6@$h#D3Ac%=2O1#uO1#uO1#38t2<$ 3IQjPx PWvW<$W@$"S>H3繢# tÉL3#O1#tƹOC"=3uO1#t‰hO1#Ɖ5P3>u 3^_[ÉF$@3z8{lV t<0 1=3u Vs^USWV׋t$$\$l$;Et*+u( %O1#t D$ L$M^_[]USWVր9tMτtC1`32U53Wq `31`3U53Vq ;`3|ut$03^_[]Ë 33USWVL $։ύl$ D$?h#W[)?SWU< D hj VUq $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$ xt$4hj VWp L^_[]Ë 33V=4t =3=4uF 3338t!38t=3u H31B83=4u 33b=4t 33HT3=l4t!=3|1Fj 2F;53|^Ë L31B^ H31B L31B=T3ug=4t =3uN=4t 33=4u 33=4u 33T3Ã=3"T3Ë D31BY P33Ht$j53s 1B)=d4tË <39t3 =`4jË 33 31BV=4L3tH31B5X3t-F=33t 31BV^Ã=33t 31B^_$X3t 31B>X3t 831B'X3t 031BX3t (31BX3WVD$ #=$2 lj Ƌ $3j" ,3j 43j=4ttV$ 3j5X3^_WV|$ 1Ʌ<+u OL$ GW-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$p&1@ÃQ*A wO$@& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th$V&trL$PQV t4uRL$x# $x2P #T$x #$x #w^1J#^aD$# $2  X39uVD$ T$5$2! щ щ! ‰ 19^Ã=2th#Ë @31BSWV@΃=2tt\3tVsw%tx1Cj S*VGVSP_GVhaC%P8 \3=\3!Vh#j@WfUWZ@^_[ËD$`3WV9ĉ2t#֍|$RQjW$U1B$5ĉ2^_Ãw&ÉfUSWVPt$ P!уtRPtt jh#jh#l$$\$|$Q t^tY9uE}4u ;Ճt(ˉ $19u tC ;$u~2KՃujhP#t jh#jh6#D ^_[]1ۅs IQRP踒fVt$t=ȉ2tjhd#5ȉ2^á2xy=d3uE h30@#4@u.d3jhy#?t  4t2P253&3V1N=h3t9t/ h3,@wB$@(@1҉,@Ɖ^USWV=2h3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh#1@$qQ52 9D$}h3럃^_[]USWV-h31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5 4(h3@9@S h31JЅt8=l3u/@u1u0@4@ &[WVh31t[@t @4v h34@0@{!уt RPF1G)t  4t^_USWVh3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHh39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë h3t$@(@ ,@1HUSWV5h31H(@$@9t#H1ًP1 u,@;Hs D4%D$z9tG1؋O1 D$ ~9 $tG#G=4t @t̉2x9 @}lh jtH @1HGG7FGF8~FNOG Fx ~,@;GsN+4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@!ƒ5h3@@ȉ2tODȉ2Q@u;G  )RQ@w u&h30@4@L&OD1@l$1tʼn$yjh#1=3u 2x~OUQP 5h3@@o<$t0@D$4@=l3tU=4u#L$ Qhk$ 4j2=l3t=4u q= 45h39>tOOHOh35h3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh# 031H^_[]USWVh3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H̉2áh3@u1I4@0@Ë9t1JQQ 9u@o h34@0@1@@(@$@,@PPP@;!ƒtjh#81PPjt$!1WVh30@4@!΃t@@9} 0@4@^_SV\$t$ 53({h3h8@jh3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV !ƒth3 h3@P53vzh3@u@^[SV5h3@  ˀuH9tPQP Pdž @vv Hu5h3@uE u@5h3dž@tVo1h3P53y^[áh3t@1fWV|$t$ t=p3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVYtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hO1#j,1h #lLh3h3h3h3\$ -uF :tjh #]jNbt'.t53bt0:wtptcu+3F&jSh3 3jSQ ,uF3333333333333333h #J1tPhj #J1F$2Vhu #Wht3P(h~ #dJVh #Whx3P ^_[h #>JPJj3.1B th #Jƅu&h #Iƅuh #Iƅt]h#VBu6h#VBu$h#VsBuh#VaBt1B#w1 .3TA ruƀ|3ƀ|3ƀ|3@=u=p3D$|3SVt$ 3M1ۅuD3;1Cu1񺐗2(u!=t4u2 1ۅÉ^[D$|3ËL$=r!=p3tP5t3j h|3!C'|3u |3}3u|3ESC|3Ãw@|3uQh #VPt$ u 3ESCuw |3u;Vt V5x3B$3xPV@,@|3uPh #V5t3j h3KB3^WVD$L$ =p3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=p3t'~3P19wKS>~-19s2C,9r9v)CK$SUuF8AU V o ɋl$u9tSv t1|$jjSOF ~.EFE0uE^_[]V$3t";T2t1FVh 3P/ $3p^USWV\$,=p3tV3tgفuH43J 43,319*Qh,3~-35,31E43J43,31E3=3u 3 $31҅; <2t҉օt1PS;H*$&=83+"@3Шu*%=tS 313]^_[]Ét$835$3 2y 3 3)É 2n1|$ l9} SWh 3 uԉnO1#t3 3VWW,= 3= 35* 38u!e083<3tP<3%MD$P=- 3E˨ - 3E83 83? ǃ,3^_[]83] v83e83 3= 3v!x ux ;| 3= 3w%83 3< t 38 t8383 833B5 3a83 38r 83 3= 3wx u 3= 3\x tQ 3= 3.uD$ L$PjQ课 $T$e^_]Ë 431; 3| 3á$3t @@@ 115[1PPUSWV=3׉΋$$L$ D$1AyōD$PUg#D$=xh^"U1UW$ShU? 0jhl #U/ ShU? D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU> S#1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=82u=h2u =4P1TAP@PjVP/#Wv|8QZtQL8h9"W/É4$pu1ND$PVx#D$ =uhV蝢h_ #a0tPCzƅdո(2Ex uָX2Fx uhl #hi#S. T$Za]VUh #S:S4$VW胠W V Ā^_[]SWVh #/P/tt;^_[&h#V1ۅt+h#%VtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u% #+ #Qhi#Pc- tWh #vN- Y=82t"h #hi#v.- V(2=h2t%h #hi#v- VX2^_[^_[USWVPӋl$D$ $uSPSS1tD$ t}t8^_[]StV믉h 3jPN SPuSqWV 38L$ Ƌ3 39}I9u 3xtWD$ 3$3V 38t,t$<$PD$ 38uڃ^_SWV 33$ 3+ 3|51ۉ|$8tZO\$3+ 3$9|Ӏ8t-t$|$D$|$D$$8u$ 3)ȣ35 3^V^_[V5 3 3tR 3)Ɗ 0@u 25 3A= 3 3"(3= 3 1@^À= 3t83 3 25 3(31@á 38t AUSWVPQC$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh #O+h #@+Vh #P@ Åt^_[]jh #Wz@ t Vh #Pe@ U uh #*Vh #P:@ ÅuVh #W%@ WV9G t'փtPh #V) G?G uG^_ÐX3i ËD$u5Ã<2Ph #USWVD-43ÅE\$9uz$1ۀ|tisljDDs9u>rjjx \3\3$t,tV#hj:} = 4TeuYÃ= 4e4΃eX3~o6/=p3u #=3 t t =^=p3;3Ct}.CЃ jS&ed~h3 l3h3=X3t X35=X3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=X3iX3ihD?%jjS\Fc`$&=3 %t#-l25X3=ES[jUY  xSX3H݃t = 4-`3>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$D& 5X3 h #9t39@39x3=p3Sp3C1Ƀ 33ῃ5p35p3X3/U]VsWWr!2@*=3%a3X3704X3h#jj33n=3 5T2X3 }h #X3 _ghr%y1PPv041; h3`3 l3Hl3h3/=3 X3%h #1PP9t39@39x3؉ك u. u.S莍i35l2X3%aih %{jVy33 PZw `3 *3уBЃ@*? !1҃ ƒ!D$Z=p3,9t3t 9@3h 9x3W jhJ #j#t$(VOVrlp1BsRtM&=3=X373`3Щu`3Mj5<2ùe= 4Iv_*-t%+q1҃¹) 33S\B D$t1< 3D$ D$ PD$PD$ P萪 p3tjD$D$-<{|Q<`ʃ=3tR D$HL$@븃@3|$ ^s 8eBX3emh #1PPL!ùe9t3e9@3e9x3e e 1?PS1FP@/3PhO1#535p3虤 1;5h3l3|l3h3n蔰VVA 1;h3l3  l3h3|,3'M1PP5,3 =4 3 t|7ػT 1;h3l3|l3h3蛻=4h3u' l3|5|35x3Ph31QQm1;h3l3 l3h3|,3|C=4u5|35x3P1PP5,3A l3h31҉3P541;h3 l3|l3h34聺觮5l35h3DT54JX3NVh #h1PP5 ùe9t3e9@3e9x3e e /йSE*re|褹ʭ3313 t4 3t4 @4 3@4h#CjjhV #l3݋5h31ɸd9 jhz #=3t>t5333t43@4j)eD$t Pj{@eJr蘬 L$Qhk$1;h3l3|l3h3)O=4h3u' l3|5|35x3zMh3jjP1;h3l3|l3h3跷ݫjj蟷ūD$<2D$Ph #=3jh #VR l3h34 l3h34h31ɉ l3|l3h31@Pe(ejh #e1;h3l3|Yh3l3 諶Ѫ=4u5|35x3Ljj- l3h3ʃEݣ4c l3h343  31; h3`3 l3|l3h3q j5<2?h3153"531;h3 `3l3|l3h3 j5<2RCih31D53=4t5|35x3J1=W l3ih3me53V?P/V$h31ɉ l3|l3h31@PuGjh #h31ɉ l3|l3h31@Pk 2V_e!ֹe54RPyJ1A诳է l3h31҉AQPcM3Nn3X3>X`h #r1PP?ùe9t3e9@3e9x3e e S賁+̲1PP54n豲צ1PP54jP#'h3l3ؽy蟦=4t5|35x3Gjj5h3d:0ؔh3l3艽*Pjj5h39; eS贔D$D$Ph4 #{豱ӡh31ɉ l3|l3h31@P"etbt3tFu j11A; h3l3c #|O1#L$Qhk #11%h31ɉ l3|l3h31@P'"e11A; h3l3c #|O1#L$Qh #je53<h#P531=tjh+ #o5l2X3nvh %1SVUh蠻Ag53rSPx]4 3݉h3 l339‰}h35l3)‰303e4 3h3 l3303i1l3h3154QPHFjh #H3D$Ph #d ։u=3th3 l33e,535h3tI~V8Jjh #bUSWVP趮ܢGVD$1Ƀɉlj щ 33l3= 4uH9ljD$u21xUUjn6 9- 4u;=33D$tl3 42t8teue^_[]USWVPӉơ`3u`31 r4$0utV4$#`3`31ESWPO á`3 `3 3tu1Fx` sKu j]j%u0SW5`3 á`3 `3 3ujh #t 4$4$^_[]WV=2u=4t =3u袬׮t 33!ʃt]53QY03u =2uP5l4=l3l4l3u _BLE5l4=l31jPPB ^_SWV3߾+#&t#X3/ V+=3u V@t h #t u %r%P1,3PP^_[V蛫ơX3"~S.#V$^%=33VPujhj #  tY>!t 3t P V!3=3M3.h^ #qF<+t< t 3t Q V菛3/7E=3V蜭hd #Pt% =3V^Xh3^(N5h3jF5h3jQP軯^53V535p3p373`3`3PV3h^ #hO1#r^SV `3t s7X3Zb`3shp #i`3 sh{ #Q`3 sh #9`3th ##`3 sh # `3fyh #`31Ct$‰sSh #jVgV`3CuϹ"tV% s #Q,3^[fD$=p3t@WV|$ Wjeƅ~WhV ^_USWVt$0l$(|$$t U諙,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD p3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW0 t W] WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f 3 3 3 3USWVi $AD$)< u?FP貛^tP9~ #ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2h #htjPV_ jh #h #htjh #h #h jh( #h #htjh9 #h1 #h ^Vt$ t:j j tL$HΉp 33jh? #荞^Vt$ t:j j tL$HΉp 33jh_ #H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]h # t8tMjQP[ ƅuh #t98t4jh #P/ ǍEjPW W iUUUSWVP1F=3jt$qP#19jVr n1PPPS!ƒJVWSEq <$SWr11 ?$:81xM'x+xG1O|E(|n|dȃ|$3t3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW Sq1N^_[]4$ |t|uVP11xtɉSWVh3t$b<ƅui\$h3e53PSh3I53P|3t3h353p^_[ËT$ 3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=4ÃB1ۃ=4ÃCɍH9 3~Pj#|k03SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=4ÃB61ۃ=4ÃC%|$mu93~HPj#j03؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P蒍V0ʼnPzD$X9vpG$11Ʌu2~>9sWt$V t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW܌V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQcAt1=<4ƃtEuG%t|Qh#hhx%AVhk$6) Eu ?=u QhM#$ u 覣!ƒtVHQh+#^Ã=<4t$3tPP&t53ËD$t53PF$1PUSWVu1953O3t_jP%=3tJtWg%W"=3u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =4uID$xAPNt4D$8\$Ph#FًT$WVt$j 1@t=3jWd$53t$V$t$53g$53$h353#(3t$ t$ ۨP4=84111 4D$4PD$,$jUuWPWt Uvڃ,$C^_[]SVt$ h#V蕮1Ct'h#V耮th #Vn1ۅÉ^[WV$ VtVWVGtWt^_USWV 1=4]=3Pj\hM #1Ƌ|$ 11@L|uM@-u)Fh#W语)1%tuQ%t s@AAۃ\$WVtWt؃D$jPtWVt$PWð "S豰 1tXt^~u1O\$$D$jPWP uQD$P4D$(0#^jh#4|1 ^_[]ÉOV);t;V)1|$rɅuŋD$( #1O;PrS USWV=3t^_[]j荈h#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh#U{PljD$UVrWrS\$r,8jUHrS\$SVUP4$ S \W V' V|V$9#N@ |^WV|$=4taPW81=4#D$=Wq*jP`qWPhP2LPWx8x#D$=@{WqjPqWP=h@2V\ WoƉ|^_V|$PVÚx D$XT$\1jPPVV|^UWV蒊lj53# QP7t1GL$ T$333 31@ u,L$3 3$33 u!tL$\9|$X}e^_]øR#Vt$Vp9vHx/uAΉ^fVn $31ы5 31 u^ã 3$3=`4t^6~^P~SWV1ۃ=l3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=(3t(3USWV-4~ON}=4~Q111SWuljӉ:}qF;54|؃= 4' = 41= 4|=3111;54| V|ljՉ!<$= 4FD$1;4á3D$ 3D$3D$$3133PPSUt$ ljՋD$ 3D$3D$39pt$j pF1M3H91Z{1@^_[]Vh 2F;54uj{ t j2^USWV\$,=(3t(3&|$$t$ l$3t  $9~ 4$x 9} H9$!tT=L4t 4tCP31҃=l3TRQPWV脘WV Ɖ1ND$(D$<$=l4t73H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=l4tzmz1@D$/1@D$=|2uu=2t h#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 3t)!u =l4u=4u(3=4t Xm,39l$"3HPj-|1Ot1E1=4~1VV|{~ VVVD5 -l3t <$tw y|2j@ ^_[]USWV=(3t(341=3u!4y=l4t 3'|$t$;D$||$$t D$93~ =4É!tF=L4t 4t0P3,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=3tá4y=l4t 3ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åt3HPjytm=l3tPay1u11FUvUVRPVjv!уu 4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 3~&111RP!уtF 39| 1 319^fVt$tsVGF953u#1=2tu1Ɂ2tщ 3AF=2tH 43v ݣ vң ^ɣ ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá43USWV\$S@Nj522tv W胟6W |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@43VEES/fËnU!f9Ë\$sUe SKeFWP 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P{ w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=3jjPWV^_USWV,T$Dl$@ظBӃ=L4t  4t0P3 @1)ʉ|ЉjSUQP虊كQP4v=4tK uu|| t u+| t u 4tt 4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t 4ǃ݃ tkwRPW v=4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N 3 CfN =3=4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$14l$t$1E1!1M,^_[]Ã=4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjh#c^_[uƉס3HPLi11 u^_[8iWV!Ӌ 3It*QRP4 3HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjh<#bKy1V[hVjRPUo=4jusj'hD$ jhD$T$l$ !Ѓtd9}\3H94$SW!уRPvlj9Љ $A3H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$31VVjt$t$PY954^_[]1K16-(3-033H $)QUjSWP(1K[6=l4tf"g1503SW=g3HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9D3|#>$4,$tt=t|<9D3|wC^w \$D$Sh#jWּ$4,$U#f9D3u+9D3}9D3t9D3hu_G t t1"~#ut|\tt t tL@?3~|$j=Wk9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu#O1#6$4t$ t t_G칽#O1#$40tUPۉtu #dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVZ<3^_[]SWV׉Ή5@3583h#hS,=w )WVRQ<3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^H3H3I3JtGtO GO H3I3l2 tH3uH3^_[]ÍZ w6$&tEGЃTZ$<&btPeu>fH3랄tGOm>""놃>"w>&h>%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]H3I3d   >H3 H3 I3J3N3Rh#jhH3ȶ#H3_t>O1#vVh!#T3P+t T30R"h2#蹻X3Pt X3C#jVL\3jVL`35P3h3h313PҎ $u3^1|$á 3$3Sd313h3 \3`3 h3h3@h3;d3|1ۉ(3,3034383<3@3D3H3L3P3T3X31H$3 3h3#h33P $u3[USWV\$0l$,1=4uSUƉס4 4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| X3=4tU tX33Z3l334 39}Q3Ɓl3 3ك=4WV^! tt$j VRP)NVJ1 4)~$3r53Ƃl3 3Iu܅~+1ɊT 53~=3l33A9uס3H 3ƀl3 33(3^_[]Ë 4t 4=4t14@V5d3h39}9 `3<u"\30Ph3 `3h3F9|Ӌ5d35h33(3^SWVt$\$u$D$0j?oPqI/=p3t&v!Ss1҅ SVqt1҃Pn1҅t$Sth3~- `3Vt[u`3 h3LV3Zt h3t> `3VtV[t'i=p3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3áh3\3(3`3á\3h3`3(3ËL$1wQ5T3`1SVt$ 1ۃw)V5T3Z`uV5X3G`1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ\#9u!B1@uDA;1A+u%uVt1@^ÃwV5T3g_u߸ع#L$1uj jE1ɉHH髂 SWV=H3 u|$t$\$t-1 |15l35h3tm1@Z ugH4t t4uU=@3~+t3 p3\@x3@3H35h3=l31H3=p3 @3%=uax3Px3|319Rh|3bmh|3m|35t35p3t3 p3H x3@3u"x3|3x,1WV=p3t x31At^_[ÉШu-%=tS0l@3=t35p3뢋t3 p3x3@3USWVӋl$,|$(83=43uBu>%j jzC1҉PP3P38383twQPl'UWS 3xtT3Ph3蔅1383u+@4tt4A\$l$͉=p31؋5h3\383Rk5h3UWS% 653 33PV軄3@3VP诅V荄 3AVUUUЍ@@343 39}oh3藅ơ43 3Y$gQVlu&\3h3PjVPm<3$#5\339|h3l$ EVjUek L$ )v %uh3蚃53} 3 h3; d3 5\3|tq=`30jf j`39u"_l$\$u4Шx$_l$\$u$5\3 _ ‰$ u*D4t =t4uKuG ڃ^_[]p3m_uiud1UWj(3+3 t2P391J$;T3} qɉы4X3)t _\3\$ PjSi 1EL$\3) h3PjS`i ǡ`3 h3tW4V)(3~Z<3t\ [5x2)Й)֋$F UWhD?% N183E1-83$_PdtUW ]p3t6=4t-QdtQd UWl $UWS t1@1^_[]SWV=x3~4։1|3Pd VW u C;x3|1x3)^_[Ã=@3~t3 p3@31WV=@3~t3 p3m@3|$t$ =H3uu 15l35h3itb=4tY4339(3|03(3,3h3A3 43H9(3}4 j 44jf=4(3tLX3tBx 43 39}; j,(3P 43 39}X3ы 43 39|L=3tC3„u0=4t't4|$t- 1j1j 1j5h395P3 u\30`3^_V=4uajm5T3TtMȺj9#Fu=T3u"Ⱥji#Fu^SWV։ˋ=h3Gh39=P3 u\38`34D$ (3; 03~~ 03h3,3 (3^_[SWVd3 h39}1T$5`3ׁtu Ӊ h3@9|^_[ËD$L$ l33VD$ L$=D3u=4ttNI1҉ tK1G39~3l3+5d3)΋ `3 \30 ~^D343USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8 4u/P3H9| Qu@\38GO1H^_[]cS \39t \3Mtۉ>?SUSWV-P3\-jS9o jS,o DžtVtRU5\3V3Z `3UPWZ Uu 5\3u 5\3=`3P31t Wu 1Gt Vyu ^_[]USWVL$D$ʃQPO1H…t$=P3\3D8OlV tn 4uc~\3>-P3u@\3 (I=P39rHŠIJ\39s=P3)\8OVà uQL$ t \3t=P391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vs 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$1531K3|EtESSP t衄3@ԋ=h39=P3 uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q$5@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=4u1@$5(3+543~1; 3^USWV։L$|$0\$,Ѓt<3!t6tC؃T$RjQPWSQ=4=P31ۀ=L3tw4$L3 3ىȺVUUUЍ@)I3~4,I31E 8Vt$0j* G;}|Cu4$SG X3tf 33!Ƴttt$,9} 53=3L31ۃtQ\3 h3T$ 1ۅ~&L$ PjQ\ h3~`3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E43;3uX 3#$3uD$, 3=$3=3~013 8jG;=3|h3t(3;03~<$~03 h3 ,3$(3~1 ;j_G9u431;3uD$Ph3th3 d39~~51ɋ\34*1 `3444A; d3|١h3) $ 43h3 43; 3~(4 j43H43;3؉^_[]WV|$t$ =4u1WVP PV WVt1@1^_Ð3H ȁ\4r1\4434|44 4 4444444USWVL$0D$,l$$4$44t-9Br }$r1z3|$( H4u$$r4t :=444<$:rBJ jl$(jW4tC:4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?4t_ )ϋ,$]}4t4tV+BJ NF=4uW-4MEu$9ˉ|-4],$ϋ=4t sKӋ$JHJ^_[]USWV1=4tD|$(T$$!t3|044=4t'9PH }=4u11CŋE1ЋM 1 u ]u,444EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR} 4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[ 4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt4 11؉^_[]Ã=4xÃ=4u 0314Phi#4V4xNH 4d|@4* 4549|jh#z54^USWV|$ l$1Ƀ44tKC9⻤441 41 54v vB1IʅI~nVv 4$9ʼn1I1PPt$R9 4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R 4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=3~%GW8É!Ѓu O;=3|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh#231111ۉu WVSU1PPWV+ 4u Ɖ!Ѓu3^_[]WVT$D$ =$4t 541)|щƉ^_fUSWV t$ >-uF(s7h %+V+h""+艣D$1S6]+S)S\^S Stjy W hR#À8t>tkV聪tmSʼnD$u($Ui( $ȃ$jP'袷t$PSh|%t$UDt$}d  Sa'Ņu>tVh#1"F'UwUCd jWW1FVJ]V'D$$t*P*h#y*/j ))303t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh#.1N\$h9"Ss4h %Q)SH)h"";)3(1S|&S[jj 'j1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS$jh#1KtL tGf;t=ËFHN~ ;F~à tQu VSĕV1Vj 3 4 41 4 4 4 4t P,^  4Fu,~1S薺PW豺Fv] ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh#x)1HËA QUSWVD$T$1ɾ4=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9 4u 4 4uUSWV\$SκƋ 4t@PPV7Yu 4 4\ Dž 4W\ u^_[]USWV=4|$,t$0hi#W l$ 4 4!ʃtWj UQP" 4u 4 h#VXt 4VU 4Ph#W蓌u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=39Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P*[  $FQF^_[]V=3tjh(#&dt$D$tt/uKV3;m?u7=2xCjh^#뵃=2x%3Qh#l&^jhJ#jhy#{Vơ3t PVZ VޣP3V4Z 53蛙 ^33VD$$L$ t tC8.@L$$Vh7 &Q 2>jh#2xxPh#j VWV>||P|0tB D$0Ph#;D$$Vh7 &P >t.jh#14L$Qh#$^ã42V2x$ 31Vh@BVPRQ_4^VD$$L$ t tC8.@L$$Vh#Q 2>jh #2xxPh#j VV||P|0tB D$0PhV#;D$$Vh#P >t.jh$#14L$Qh:##^ã42V2x$ 31Vh@BVPRQ&4^V|$u%t$jVt0Phz#N#^V|$u%t$jV؇t0Ph##^SWVD$L$tP4p=3tjh#"VP>PR Zt V踘)X!ЃtV谕54SW? ^_[VD$L$tt\uoPe02_Pơ02t=(2t PKV VӟP02V)V 02Qh#!^V|$uJt$ =\4tV3-4hV%_V_h@^^WVD$t t0t$4l7=tDMtGhuXF 2Pp44Qhk$5!Emtwt su!FF2F4F4F$27U V^_D$u546Ã|$"7VD$Hs^\jh#7<2V)hot$&Ph#h#V;2xu'h.#hh#h#h#h#h2#hg#j^^WVD$t$ʃc"y$&m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=4utjh#$FVPMy0Ph#^_ÉPh#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;P3~T3A9s } uE9u9t},u E&| t2P3+L3x2 ^_[]WVD$Pt t*$TV1PVLD$ps D$ stopD$Tab =t2|i1Gt$rVfD,V4T3hQ1#P G;=t2|VD andD theDen t$V5x2h #P/ 0Phk$D^_à D$t t+uyL$tJQtQytWjh#Mà$2L$%2AAD$Ph>#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh$QVP46h#V&Lt5>t 4 $484tP94#L$QhH#O ^ËD$Hsjh`#/Åu  3Ã|$u=4D$u =4~GT4ÃD$ u)=4| Phq#4ÃD$ u)=4| Ph#4D$u"=4t=3t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh#V D$,L$(t tC1ɉ 4 48,uT@L$,t$Vh#Q$Ql >tejh#Ot$5 454h}$jVLz0Ph##t$D$,Vh#Q$P >tjh#9 ^ã 44D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$&d~&s wR$D&s wU$&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G041 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$QhQ#1QZS04^[ÍD$Ph6#҃=4= 4=4Ë 41 3+4t$4Ph#h4 4USWVl$,H ,4t&AUjQD$}ol$,7F]$l&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph#h4 4FVEŅ8D$EH$&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=\4nAL$,9 ItIT$uWoD$,74j+o2Ph#4VV T$jV%D$,|$?+3t PH GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WPH |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh04P ,4I,4^_[]É|$|$ u D$Ph# D$Ph#͉-,4ōD$8Phd#uA0h#j*h04-tËI1Ph#j*h04tUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph#=j UQ xt-u)%tt0Ph#1H^_[]SWV9toӉQK @jP ljtG\$=4t <\u ~t F <$t)\tPS"t GFFuD$Qh#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$04Ph#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h=/#3rtP~21@USWV\$(|$$1E=T4uhX4ߜ?T4049<$l$D$l$ =4t=3t=4u2=4ubPjD$P D$tD 29PaHD$=l3t=44tft$,SWI T4=l3u"t1P4@P4| j=y!6I8(I8#1Hpt9=04t4[1T4D$ D$D$$PD$Pj 9=04t  4t, 4T4^_[]øjhX4?UVVVe^]USWV\$bH03U SV,jUVShe"UPqj^_[]Vt$VU uVhM/#h4 4^USWV D$0щL$l$ |$$t$4PWUƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV!Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPQÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$Sqыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPLe^]fSWVP 4t 03Z14WP(t>1C4$$4u V WSCu ^_[S=4t4 \$2=4r 2H 24[V524t(42VP52 9t 03^Vt$52^Ã=4t4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRV4يW/#O u݃|$0xG-Wt$8N] ^_[]USWV\$8T$0t$,11|$GUSRV3يW/#O u݃|$0xG-Wt$8\ ^_[]SWV|$(L$$\$ 1Ѝt$FW/#NuxF-VQ\^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$PU ƃ^_[]WV t$RVQ t|$P3GuV^_9Hw @sÃtP=USWVPt$|$4V<$=4uԇTh=3 #Vt$ P]Eu 348JMp;53| 03^_[]VWj .^_[]ËL$T$O1#PPhh/# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu4^_[]WVt$|$ zt!2Ph/#Ph/#O1#PPhh/# ^_WV|$t$ t%WVra7ft=3 03 j Qu jF^_fUSWV\$l$=4u<؉%t1UX1GWP?[PW1WPPUVd[1 jj1=31Ƀ=4HPVWEK Åt!W61 |$t8jh/#'D$ tP;D$ 00 D$ 89t V0 ^_[]Vt$tP;60 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQn ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u aD$E ʀ[} 4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø&fL$tt"u$ 33HI 3I4ʋTUSWVD$T$ 354|1Gll\G9uTD^_[]SWVD$L$534|F|\\|N B^_[á3~Ph54Q4 USWV 3; 44th!t 1G31K;)1G1I4:tl!GtˉP7-  3jQJƣ434~PhV3 !t\l^_[]USWVPL$\$As 311H$(u31@$14<#|tZ44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$41H; t$z|#=3|O1;Ll |C9u^_[]USWV 3~.411F1l9޻r G9u1@^_[]USWVL$T$9~1@+54A1G1֋l9߻rB9u^_[]ËT$3!х1A9Hh&*4=\40&t&P 4h}&4h &2h`& 2h&$2USWV \$444|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$&=4EQ-s4C$ىË $Fw$P&#Fw}$&X!уj WRPBBtDt L=4!153h#P%1sTu~-$PuYQA tLу|=RP螽1 $1=447f1=3u ÊCCs|,v, l,uȡ(3!ƒtظ:,u53资j W53QTу 354n9|$ V5353蛅PtmƉV' +1+5Q ic+Ɖ!уRPUV4=4H8 4H=4wA53kP豄 !уRPaٹ 4 3VQRPn!g 353,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/153Mj WP j W1P9?"@|4O1#9 4t 4O1# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I54Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^52~V5p41=\4tȉt 240A(3^5$2'SWVQNj4ع49r Ѝ4WVS ;4;^_[VQ!уu$x 3H9}FV!уtt^^Ð14444WV|$ =(3t54tZ=3ta=3|<1W!уtRP虆Ws@G3H9|vu4覍54^_USWV 22D$L$!ȃ2D$2D$ 1H2222=3=(3t4$=3|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$3H9|u $u^_[]Ã^_[]鍌^_[]T4K|$th4m=4t1=44j jh/#"V΋At P/! FVC^h4SWVt$>t_w W ߅u1F FF1H4444^_[h4SWVQ1u(\$|$4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-4Vt;xH|p$x Hȅu^_SWV|$t$u;4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^4U1tHt$ !t Q9y}1I(t(t$=L4tT$$1=4uȅt^_[]h44=L4tUWVjW7!t"j]jRPWV je^_]Ã=4u 444d 4Vj5<2t24jVx 1F=L4u=4u@11N^USWV(U ]1Nt$ t$tr:tm14PSi( L41 4t)1V54h4 L44ttxq @34 L4t =4tj)L4u=4t494J\$tP1ػ&!Ѓ1ojh/#D$Pj@t$>SD$$PL$Qt$Tt$V>4$u:4 4!ƒt&9L$L$|D$;4D$4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d4T$X/ t$1 t$ % \$(T$_CtN4$jjD$xP$Pt$4t$54542$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$v Vm T$1H#E t0E t L$PL$THD$$e^_[]Ã=L4u?h4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ 3L$3L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$3}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8303t$[ t$ O }tEL$L$H1USWV8=44544D$$8u=4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}4 4ȉT$!Ѓtsu!9t$ƄuY454;t$T$$|@Ut$ 9D$ЉʋD$4$P3@Eh4h4}!P3 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># 4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=44!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$4 4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 4D$4D$$4D$ 4e^_[]1JЋ4$|$9ωL$}@D$ P3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=4 USWVt$h4tH>tC\$1EjU1GGGUSxL4G=4-54t~'V` u403^_[]W8 USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)54jjSt$DPV5454s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9 t$VW舐^_[]WVjPh$%4h:1#% t ht4h$%4Hrh2#Q}u t4x4x4PhhP x1Ɖ5t4hB1#hW6hN1#VW b5x4h1#o^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@$4Ph4VKUSWV T$(\$$t$ 1`2PURS)ˉ<à uVhk$t$|$u u)u%u!1ɃtsQl2PhM2#[t Dh:3#AP^_[]SWV \$ hShk1## uP]th2#O ^_[誕xEhSh1#o# 4$t t$j VFh'3#뙿 hl W 52t$S jW|$WOJ[9uR1Vt$/4$tjzSh2#OV[WV|$ 52j/Vt@jWhR#QV/^_1@$4PjFÊD$d'3J d'3;t'3~{у ts \'3Q\'3jPh$4h0#" th$4h^"P6t:j52P? f=2u5P"49h\'3Q h$4h{1#USWVt$81GWh9"5"4É 1-$4hn SHD$h"4SD$UM Wht%45"4蹊 tLtFPFuf=2P"4tjQP~ Pcj9ot$4l$0j'D$T$1D$EHM~EHMUڃÃ=$4uf=|2u0Iڃ% tM 1f=|2@ ЈD$P D$ƒ t|f=|2Qq f=|2uf=ܳ2tT$j \$Ct,j Cu\$T$f=|2x댉\$ 넻 $f=2tD$ @D$ PhP1#ڃf=2$45l2jW5P"4 $4 $4 u61=4$4#$ |29uj觽5$t h2#JKj耽ڀ tf=|2u j ttFPFujÉUt$jbf=2t'+\$|$f=|2T1#t1#WSP jht%45"4| h"4jj+(^_[]USWVP\$D$jP5P"4 f=21=$45l2肼jD$P5P"4M Wd9=$4ttػ1FU Ph1#KtMVhp45P"4- =$45l2 VD$P5P"4ن W9=$4u^_[]WVjPh$%4h1#% t ^_ht4h$%4Hrh3#PIы t4u x4Q[h^"PtAf=2x41#t1#PQhWWh1#V \Wh{1#Lht j7$4USWV$d'3J d'3;t'3у  \'3Q\'3t$hVhk1# 1GWh9"5"4 WSWjh"4Sj Wht%45"4 蠍x>j轔Ɖ׉UB~*9u$h\'3QEh'3#G11f=2tjl)RPh1# jht%45"44 1h"4VW WVWj^_[]j5P"4WP1SjsSWiVVh1#S USWV$d'3J d'3;t'3у  \'3Q\'3t$hVhk1# 1GWh9"5"4& WSWjh"4Sj Wht%45"4( x>jݒƉ׉U@~*9u$h\'3QEh'3#E11f=2tj茒)RPh1# jht%45"4T 1h"4VW WVWj^_[]1W5P"4j5P"4 S_WjWSzVVh1#W*USWVPh43#D1GWj=Wj29etDƅtZW?9uh:3#|D1VjVj ^_[]h'3Wjh#誾h2#Z1SjSV-2j/Ut@SQU$ h'3WVh#Nh2#WWVPjh $5"4 f=̳2t%52>t="4V7PVW| 1FVh""5"4e |$VW5"4葀 ?nu52h2#Y ^_VPjPVh.2# t="4u.5 2V/yVh42# h<3#CP^Vt$j5"4膀VtVhH2# h?3#BEjWV5,2t)>t$=P"4V"PVWg~ jmdj{VhVhV2# V2t$2jh$5"4~ ų2u2$ų2%2t$2t$2f=̳2t52t$$52f=<2}#tF>"Pn2t$22%42t$2j2t$$2f=2}#tF>"P^WV,|$8V5P"4LhF>"W^t! $#"4 $ "4"41GVW5P"4~ h"4Wjn8^_WV,t$8W5P"4hF>"V1Ʌ#G OWj5P"48^_V1Vh{t 5P"4 jGbVhzt 5P"4 ^S\$1u(jP}[ESWV|$\$1FtCWPt1^_[fUSWVl$$1%4x%4HЃ sX 4HЉ5/5x%4jVx%4%45%4H"4%4=1H"45%4j:h &t$ t 2j:h@7&t$ t 2j:h~"t$ޫ t 2j:h6#t$轫 t 2j:hl%t$蜫 t ̳2j:h.=#t${ t ܳ2j:hS#t$Z t 2j:hC#t$9 t 2j:h'd%t$ t <2j:h#%t$ t <2j:h]"t$֪ t |2j:h$t$赪 t 2j:h e#t$蔪 tL"4j:h#t$v t 2=%4u %42=%4u %42%4tPh",%4tPh]"%4tPh 7&%4tPh.%h%4hY9#t$o u %4h%4h2#t$J u %4h%4h"t$% u %4 5x%45!4 !4t%j,VftA1ɉ5x%4 !4^_Vh(9# Vh@9#h8#j赗ttu$Vh8#{h8#h8#ejfSWV t$ |$6c6+$!4Q(!4,!4}0!4#h_9#Px4!4VW8=L"41hT"4S "4T"4%"4%"4%"4f"4 "4"4f"4"4h"4jS6 h"4٬h"4̬h"4迬ht j :#94!4t9#Phk$@w"4 x |AEjj5P"4o xPj5P"4o h9#j耻u he9#j譕1hy9#VW vtHЃ rt+vh9#] 8!4ō HЉu+t$$4t P7 Vمƣ$42h"Vots4$4h=#VStahX#V?tShc%V-teh%Vt1'3VhJ:#W3 Wz4$4$11ɺ20 ߈$4Bu^_[ñ1WV,|$8V5P"4脸WV xWVPx#NF=L"4t L$f=2t D$#$d$d$ wfD$ f=<2t $Vj5P"4x8^_h"4jjd SVPf=̳2tjOt$R 20utztD$=4!4„u20u1f=22몈D$< t< u>jV5P"4z f=2t|$ "tO1#P-`u 2 <2tu 2tt A8u1f=2t .3DAt x.3DAD$jV5P"4 f=2D$P/hT"4jj USWVt$D$ $1="4hw jD$1CSjhT"4SW Vhk$h"4+&tWD$ h"4jj t$jQUjF="4uD$ 1;$ȃ^_[]Ët$$4$'3H '3~'3H '3h'3GeȋL$ < U;t$ KD$ V1FVj5"4h"+Vh"4|%SWVP2\$ x2t%,!429u Gt+t' u9tpD$jP5P"4 Yـƀ_r0$4^?t@آ1$42$4 0$41$4h0$4hk$aPW1^_[P'3H '3~'3H '3$'3t1Ƀ=4$4!YXD$_r0$4^?<t@ 1$42$4 0$41$40$4SWVT$L$D$=4$4ut1<18$41F9uRQPYe y8thzR%v^_[h<:#USL$ \$1B1t 9tA8u[VL$0#4tSA :#8t6u(^@\VPt0$4)ƃuf^?݈@0#4^VD$Ph$:#=x2x2,!4Ft2_r0$4^?<t@ 1$42$4 0$41$4h0$4h):#=_r0$4^?<t@ 1$42$4 0$41$4F t*vPh0$4h-:#,!4~ v 7^ÐWV1Ft%4VW5"4c VW5"4d ^_USWVt$jV5"4d  uD$41؍oD<jV5"4vd D$< t r֍,f=̳2t$4t P u̳2D$y1D$h#P$4tD$y̳2D$nD$jP5"4b^_[]1f=22USWV1GWjWj: VWVj"4fCP"4CfC 1l$jjS{c ~}D$tvjht%45"4;c ~]t%4Bt8StGWuG1GWt%4U5"4a WUl$5"4b 1f=22D$hU5P"4b j Ɖ,<=4$4  A9rWD$Pj4a f=̳2$4tyf=2~g|$_r5,2Pt. $4YSQ;Y~ڃ tZG9r QRl$!y-8u!PWjl$UV Eh@ jf=̳2t$4t PjfSWV2t32^tPtF tFFu҉5 2h:#hWh^"WtRVhW t4=8!4tWh:#j WZtWV%%2^_[USWV|$h+,%W証j Wj=W訜t@C@uSh%WYu S6ÉXj?WYt0tO@t8JS;?!tOYt@t ItWh:#~5=2t,2Ft = @t t~vuك=%4~h"2"%4^_[]SWV΋%4C!w\C%4؋ d'3Qd'3; t'3h\'3j %4 \'3Q\'3 X%4#|>W9أ%4NI$@&WhM#|%4@%4N Q1f~ @%4d'3H d'3t;t'3lh\'3j!l%4v Wh:# `WhM#%4@%4N tEPP]%4V\'3H \'3!6hk$%4#|%4h" ^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n:#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh%SƸuW 1@WL8ljR1^_[SWV21t8ϻ2WP|t!CtWPgt Cuމ^_[USWV׉A tS^؃H$`&n tWUtjPu U觻 WIuF tQfB t Pth:#*N 1?!9~ t~ N 9tF N^_[]h:#fSWV,1f=2t h;#+|$Shf@5P"4 $tR(|(PV5P"4`Y $j0V蒕ufjOh&4tjKh&4lu@Uhxt 5P"4脫 Uhyt 5P"4p OEh<#11@^_[]USWV D$h jD$%4|$h%4us5ܲ2词jW5P"4~X j蔍l$ÈD$V{t1:ul$B9u|$tjj萿D$t$j|1 ^_[]VP1Vhxt 5P"4j j<Vhyt 5P"4L j5P"4cj<j5P"4bjh{<#5P"4PV <#<0t<3th<#Qh<#D1FV(<Phf@5P"4販 jh<#5P"4U V;j5P"4dbjhxt 5P"4o 5P"4X^jh"5P"4U h<#%4jh%4fUSWV $ ugh\jh8&4 1HH&4&4h2=#9t 1=#d'4:=#hP=#$td'4$ hh=#US@ ƃw$& 8&4׃B<<8jL$QP_ $9bL'4P'4 9&4냀 8&4w<<d'4` 8&4T 8&4H-<<hB#U|ſ=#&hB#U&xVWU9 u<7t;upC 8&4KD5tX<=Eh%Uwƃt=tU2xU'nD$d0@<=uEajD$PU  L$9! t , K8&4hB#V|,<0$ $ <<=#5<<O'4VP'4t=G$tjVP$ 8&4X'4\'4 9&4}=@&4rh%UvUPh!B#4 pjh=#VhmC# Wh\B#&UVshB#h'&j8zWh:B#QWhzB# <<Phz=#jyu*8&4 t5!3)~1҅ S|@hC#hC#hq h B#hA#hh^C#hTC#hKh!?#N <&4u8D$Pu h=#9$=#8&4 <&4y!ǃu hA>#=#&t!ϋ <&41Ph=# &u s<&40h=# s<&40h=#|AWh>#b.t%the>#E|$ DT'4$ $ 4hW uW$ 4he"ō$UhPk tʼn-D&4=8&4`'4hPU8Q H&4uzR%t}#P5D&4h>#hL&4P衝u5D&4h>#j@&4uG=T'4ty@&4'4='4tV'4h8&4Q@&4u7J$ @&4z$u+h8&4Pu,@&405D&4h>#:u5D&4h># =<&4uhb?#hI"h0Yhj$$ t!P &4u$ thz?#h&4P蔜u$ th?#X#&4=tD <&4Au$ th?#P=@5&4nP&4$ D&48&45D&4h@#@&4tpp 0h@# 8&4uG&4z@#ttj@##&4@#@tO1#QPhO@# T'4tPh@#m8&4uu+ <&40Au*h@#N <&4 @# <&4@#"h8&4u Vh@# #T&4=u#5H&4Nu5D&4h@#gL5H&4Nu5D&4hA#&4tPNu5&4h2A#]j$ th?#lUSWVt[ׅtf΋&t#&tVPtt%]uWVhC# jX<&4^_[]hC#hB#hhC#hB#hh!?#裰讵PPPhC#h'3,<&4t@t h8&4ЃjD$t@0hkA#G1h\A#hQA#hh!?#(D$t@0hA#1h\A#hA#hh!?#D$t@0hA#1h\A#hA#hh!?#輯USWVhB#1&,&Qhc5%h'3&t*tu6h'3jjhB#h'3jjhB#h'3jjhB#踈B#tH#FKrh'3j 0^_[]USWV'39u1Ht$Vhht@P莝 V$PPftхu! $hH9tu&v hWI#hI#1^_[]hPv hI#h\A#hI#h hE#hI#hhE#hI#hh`E#YUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ Pר D$VUPx s DD$st$s 8D$ s <D$tf4$l$4UT&t_uh>H#h,%hk$h'3 T&h"h'3 uh'3j sX&D$l$4$sf@8tD4$t$xVL@SdPSV \$$Vt$SPK1D$0D$,D$(D$$d$sD$4j@HP&e st$st$hH#t$hH#t$hH#t$ hH#ut$thH#dL$9X&t uQhH# T&hI#3|$4tD$4PhI#|$ gvVD$PUD 16D$8uT$Bg)QPR theH#1@^_[]USWVӉ͋t$V 1Htkt$t$VSUDtGU>@t$t$VWUD9uVSW t'W4 藩 W 1H^_[]W USWV$$$|G8-t !3$D$ 1FD$hJ#WS q it 1&29t9At&9IuJuiu3$tHPhI$ AtPqh J#5 늡<<A뀃Dtou&t$ mt$d<<$W$uQ 1t$hWV蝤 jSVz $FWPPW uh%VhiPZ u hN#jdW>T$&2l$D$G_HrY7S菻hjD$*Pѣ ft$fD$CL$fA37ShjD$&P董 ft$fD$f\$ $T$0 T$T7hjRZ SQ`Zft$fD$fD$PSU܀ $T$l$GD$x|$ hhjD$$Pޢ \$ $ shN#*shO#s hXf|$rL$IQ#fw &L$T$ t$"VRQPhQ#ghN#hN#j?`D$f=212hjD$$P謟 fD$|$<2fD$ $T$2hk$H$p&L$f|$Q#tQ#PD$=ufD$L$IL$}1|$D$L$ t.314/Drt#E9uT$ЃDPhQ#~|$ujjPPQ jt$t$ Vat VhiW u hvS#D$(|$ u,$PD$D$,$|$ 1hSW蝝 GG?t$>hSD$$Po G$0hSWR jl$UWs whQ#h\'3UyWh:it$V uO j.h\'3!yjG蟠Wh:iV͈ u Cwv8)|$S#S#P$rkLPD$$PQ"z $<1|$VhR#t$kL4t4&hKR#hbR#48~1D=PG9uhn#_4 D$4!4"4#4$4%PSWRQt$hxR#4(hR#444,40k<SWPRQPhR#4`hS#hBS#4\t hQS#t hVS#ho#v4d6|$1A t$t&u/7t$t nu Qh[S#&FL9Mt$ $t$qV<5P$t$RV5h2"諜PhM#h'3+ jUSWV։1hUS# jWSwp sUPPM t'Sh9iP tV4Ĕ^_[]h%hN#jRZUSWV׉1hVU褙 jSUo }VPPM tAUh:iPo uGPhzQ#B1FS3Đ^_[]h%jYVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1PhQ#;^WVhuR#(f>r1D~PhG& GH9|j]^_WVhuR#f>r91D>Ph"˿ 9} j:ԾG9|hn#蚿^_WV$fGjRWcn WhiV t Đ^_hS#jgXfUSWVu }6hO1#j轧 hS#VWHc Hw$&'4'4ԃBu|1PP5<<tA '4불'4'4'4'4'4'4너'4'4sjh\'3 j_'4S3=!3='4u.1L$A AAAQj j 1 ='4'4'4'4'4'4'31O=t'4J$3tch#Vt^='4ukjjV/ ƅD$ PVn|D$(!=<\$yB  '3u1PPV{/ Ɖx\$'4j'3=t'45'4PL$Q. ƅ~E1'4VPS- i)u5'45'4t$. ƿy5'4hk$&>'4'31O=\$t$9ȉQp/L$5'4u ύD$ PS {5'4r*VL} '4VhT#'4'4'4'4'4V.3hk$H='43V.3hT#%ˋ$B65'49PhS#h'3膽 1@'4J$;'3t=h#W+t1[#='4u^"PW誽;? \$'3\$='4 1$ӋFHN~ HVRƒ ='4u u u1G1='4up='4u< u7 ='4>hO1#hT#h\'3k h'3@t>$@$PhS#h\'3Aڃ h'3@ t_  ='4d'3H d'3;t'3h\'3j$a  ='4xd'3H d'3;t'3h\'3j^ :='4,d'3H d'3;t'3h\'3jM豾ڃ\'3H \'3$\'3H \'3^d'3H d'3!;t'3h\'3jIQ \'3H \'3I \'3H \'3Md'3H d'3%;t'3h\'3j-ڃu!\'3H \'3-.3DPuWd'3H d'3;t'3~ƒ t\'3H \'3h\'3R}ڃd'3H d'3";t'3h\'3j^Bڃuv\'3H \'3^?tЃ@Ӌ d'3Qd'3; t'3~ ȃ t \'3Q\'3Vh\'3Pμ=F @t5'4hk$z8'4f h'3@ui'3\$t V!('3%'3Whk$38'41;`h\'3u'4e^_[]h 9"jNOhJ$fUSWV$$0hO1#j蚞 11E1D$D$D$D$$׉jh 2h6T#$VHNQ~Hw@$&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j<<$ىY1ɉPXuG !3$T:-u"j9uzuI !3 u !3)t u <$u|$uM1ۋD$Ã<$D$ ptD$ $4u9>WbuTWh|T#D$u5t뢍D$PWu!WhT#MhGT#jM$1 |$ $jSV  u h%P1u28V#1CHHf wy$\&|$uhUÅu뼋ss PVhe"Y |$u.jSU! ss 艜 PVhe"" 1F $tCPpQ|$t KP;AmPsT$Z|$Oshk$41F7h%jK躍PPhT#h'39jfUSWV$$61hO1#U1 -+4-+4-+4-+41ChU#VWV e'H wu$&+4-+4-+4Ńo'fil ,4뙃prv,4oa+4,4+4%+4-+4-+47+4-+4-+4+4 +4,4,4,4,4,4,4u !3)ǃ=,4+4u-tX1Ƀ=+4=+4tL$H=+4=+4=+4=+4tʉT$4+[,4j[,4P[t$lVUhH2F 9rUhU#\hH2EH2 @2QT$/u>t$|9A@2A @2I2vy/th"U#hWU#jHt$ D2DhU j5=+4u$PhH2 $PhH2C u@Ƌ8uT\=,4u=+4t@+4 +4t3D$ P6} 1#$=@txUhH2D$ P6 u6hk$jH#D$=@u+4 ,41ۉ  t1ۀ|$/uhH2hU#.t9U2Dr|/u (IHr IH9/touɉt$P諥 ,4USWVT$juQ PAD$1t$CHfw?$&ss PVt$ he"袾 PshU#萾>|$(5D2C,H2)=|5TShH2hU#T t$V1Ga{DuO|$u C(D$?Cj/D$ Pyt L$)@L$D$h#QX{T$CS(L$)ʀ</t ~/t/FD$щT$H2)rPhH2hV#t$PV. L$@2@2=I2vx/u H@2=+4tD$PhH20 D$PhH2T$KP3Qt$31 u@T$(3Qt$$3q u.shH2h#V# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH2hIV#~ 1Gt$#KPqt$1BD$ $&=+4L$ QP T$ +4 ,4sHtbffM $<4Q$<4T$ $,4t$/D$ !=@8fush}V#萻jSt$ V0 1G)=+4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=,4t$tjQ\$<4H $<4< ,4tICPphH2 4shV#藺D$ PhH2+1u=,4thH2sh]" V Åc1G1諅8uV0 e^_[]7hk$h%jNBhV#hV#h6!hhH2hW#hW#h?hV#~fWVt$$D$(H0JH(x,z H4x8J z@/uD$PVsX#X$hSWr1 WG?t?$ VPh@%hW藙D$PW'X#t VQD$PWÅ@<5WVh/PV>gt@\$L$/PWgt@L$ Q\$Shu)D$ )=|\$=0<5u=4<5h\'3NWhX#h'3X '3H '3~'3H '3h'3rÉ؃t9 t4'3H '3~'3H '3h'3Vrƒ߃Y=(<5u#D$=@uWFW~u8=@<5u WVG ,<5 PWQVQtW#1ۀ=D<5$E<5VPWhX#֘h'3jj hX#H9D$t$QVPN Ƅ fDŽ$.$$PQ\$4$9|$ t#t$WPN$ D$Ƅ fDŽ$.$PQU$3$$3$ $3$$3$  WVhX#膨 fD$L$TTPQeËD$L$TTPQeUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP\e^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPd^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPd^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP*d^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQPc^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^c^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQPc^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQPb^_[]USWV |$87^hO1#j} jSt7D$Phht@jX uD$tL2P<5T<5X<5>u \<5t$41۽hY#WV"8 HσG$,&X<51`<51P<5<5<5T<51`<5X<5d<5h<5x<5낃w<5<5^<5O<5@|<51H<5"<5<5@1P<5<5<5p<5t<5<5|<5<5 \<5=l<5t l<5d<5<5<51V<5G<5<51C+d<51`<5X<5h<5T<5l<5`<51X<5d<51@<5d<51`<5X<5h<5T<5<5<5P<51M<5<5rH<5ct<5p<5J1P<5<5<54h<51`<5X<5d<5T<5!3D$=T<5u=h<5u =`<5th/#0tPL2=l<5u l<5<5 d<5L$$ ȉD$<5 x<5<5 H<5L$D$ ы<5 T$ L$u1 T$ =<5t ŋ$u|$u|$ t+uh<5j<5 <5=<5H<5tL$t*t,uw kL$t;t=u^ R Kh =t<5u==p<5 t/4 ( ! =t<5u=p<56 t <5)θ =X<5u/= =h<5u! =d<5u=`<5! t <5t1AT2U4L<5 ^_[]iPhY#h'3G jUSWV΋\$=<5 t1PSRH ~jP1ɉ=<5tWX L݉t$=|<5D$WxÉL$ CHHf$L&ks vŅtщ|$W‹L$@D$9ʉT$@l$ UʼnD$<9L$<=<5t/h#sl D$TPT$ 9щL$ 1|$P,J  à t$P~ Ct$ P~=<5t +Cl$TUP~UTZ ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=<5tD$|t$ |$ n<5ʃQPRWkT$RPhL"jV*VD$|=<5t$ |$ tHVUUUȉD$|$D$<$$SWh $VUƅU$t$hz&VU装U$=<5tDŽ$Mt$4t$ d'3J d'3;t'3~у t \'3Q\'3Guh\'3Q虄=<5tXD>d'3J d'3;t'3~!у t \'3Q\'3Gu7h\'3Q8L$D$ ρÃ<5T$9<5}`;L$}XD>d'3J d'3;t'3~!у t \'3Q\'3Guh\'3Q袃d'3H d'3;t'3h\'3j w\'3H \'3 1D>d'3J d'3;t'3~!у t \'3Q\'3Guh\'3Qd'3H d'3;t'3h\'3j \'3H \'3 e^_[]SWV΃=<5t vrhV%c1TVO^_[SWV΃=<5t vhV%1TV^_[Ã=<5tATPqh@%:| ÃTQhk$(|Í` f w5$h&d'3H d'3;t'3h\'3j@I/d'3H d'3;t'3h\'3j*d'3H d'3;t'3h\'3j=kd'3H d'3;t'3h\'3j%Dd'3H d'3w;t'3oh\'3j|!d'3H d'3g;t'3_h\'3j/1@á\'3H \'3@\'3H \'3=֡\'3H \'3%á\'3H \'3|밡\'3H \'3/1á\'3H \'3*USWVl$(}=<5tE G=<5t=<5t(DGx<51 <5Í4^69L2} ^_[]{E ;\2~*P5<5OF tM \2<5<54FMt%$Q  Qt $ B$Iu$ L2șƉșD$$t$D$ D$|$1ۋt$=<5t( <5 U tt$ ;4$}Z;D$}El$)šd'3H d'3;t'3h\'3j ~\'3H \'3 MuC;\$rd'3H d'3~\'3H \'3 h\'3j ~D$@D$;D$ ^_[]j;LUSWVt$~=<5tF G=<5t=<5t(Gx<51 <5Í,C L2-9} ^_[][Gșljș|$$.1E  E;|$|6d'3H d'3~\'3H \'3 h\'3j }1V =<5t(41;$}D$)ád'3H d'3;t'3h\'3j +}\'3H \'3 KuGm=d'3H d'3~\'3H \'3 h\'3j |^_[]USWV|$=<5t_ C1ۃ=<5t=<5t(C=x<571F  Fd'3H d'3;t'3h\'3j,<|\'3H \'3, +N,d'3Pd'3; L2} 0;t'3(h\'3j {;~&\'3H \'3 "\'3H \'3 h\'3j {1W =<5t(4_ŋvd'3H d'3~\'3H \'3 h\'3j K{^_[]fSWV|$<5W t pSP~6 t81PWV Vhk$tVF ^_[hZ#WhU#j USWV$UB 4(F$$1 |$1 9$)덄$PSUD$PX tXǃt-tat$[ ?tL$T$d$.?T$O$E1 $ ;,,3r9vL$?T$$$^_[]SWV ΉRQS[X 1t4u t|uHth\'3PjS"t VI[ lj ^_[fUSWV$$3=1hO1#W[ Wd%$ D$D$ hZ%SVL mu05<<٬tChP蕫$WD 뼃pu D$ 뭃u !3,uk5<<h|T#j #D$=@u.$VtPk 9r*thZ#j|WP:g ty/t AƄ/@L$M$D$SE|/uH9tx/@tj/S><ޅt@V L$rShZ#01A $'@PVt$  ٍ$Ct1@$Mg4$lfIPPh[#h'3vqjLf<5USWV։π=<5ujVtt~VWct9K8uR\$@SVgt{SWY9Whk$1ۀ=<5VWh]"hn VWhk# w=<5u=jW tuWhZ#H#D$H=@V=<5/jVsD$@PVjWsuD$1Pt$LD$2x O1#tD?%D$1Pt$\X1Pt$`[ZVPSt$D$BPhZ#h'3o#D$H=u}1PPW t$HhV \$D$<5<5V.CVh[#1C؍e^_[]ÉVh-W#h'3o '3H '3~'3H '3h'3YEÃtH tC '3I '3~'3P'3h'3E '3 tuÃ߉1ۃYM@Vhk$'$<5SN- <5t$|$SPt$  Å11S5<5t$ 9x߉=<5t{\$(t$,l$( 4Y&$$L$$D$ l$ |$T$ fT$l$\$l$T$<5RQPVSt$(t$(hAX#h'3m$5<55<5t$  Å6|$W\$St$uVh1jSS5`2g)!ƒu@8f=5-x=55t=5 a1H 22==5Gt =}r t~=x5x5q˃u#=t5tPWUVh ~jWUVh tw߿(=x5u x5~~=2|218^_[]111RSWV։ωS2D$t,t\$W34$Ut$Ictjt$R#1@jt$ e#1PW4$t$jSVVx^_[hd# hd#he#jVP=`2x=5 5t}==5ut=5tD5HQP~'Q &hf51=5=5$Pj h55h\#55ld 55= =5uKh=55`2 u4#$=5=u"x=5 t=5u5=5 =5=2w=5t2~ jP5`22~jQPO 5 5t4==5u+55hx"V555`2==5u =5tP1=5=55t2 5 5t'=5tG5HQP~Q hf5Pj xf55tZ55h\#.uC55 55 u 55jhQP,RPh\#Vb1V555hf5^USWV=2\'3t'3D$WO+=5 =5 u1@1ɉ$L$=52\$5555he#hS^<$t$W5555,$h9F#RPWh)e#hV]$VShc#hW]}WPW}tf=A5t]t$50f55,f5he#hV_]$VhA5hc#hW?]W&PWjj 2u_5hf5<$t$WjV/+$h$RPWh)e#hS\$S]Vhc#hP\5D$=2Ohf5D$ e#D$5555VSP\$5555VSPc\5 5 554$t$VPQb*$h9F#RPVh)e#hS\$S]$QL$Qt$Wt$$hc#hP[$t$VPVj "$PW55he"t$p_e^_[]V~==5u(=|2~h~V5`2 |2~^V=51==5uE1jVV5`2A!xRP5`2 2 y8h]#0jd 1N^Ã==5uh']#jI&1==5u555x5hY]#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|2==5t$t$5`2 ƃu*~3=5;5x5tc5x5tU=5L~ =5?5|2x52h]#j, 1k752h]#0j^_USWVP5|2|$l$1ۡ`2$WUt$ ƅ~)tދD$9u=5=5!|2=5Hs-68 uc1h]#Vh5|2:~\%tS1jPP5`2x})RP5`2/ yPbX68tDN68t:D68t0Ty:468t *68u |2168Eu |2xt =51=5==5uh^#j腥`tx>5Ht)t h^#52h]#jL 1%h[^#j552h8^#0j^_[]USWV1N==5=|2 2uh^#j٤=5<u=5-=5sg=5=51jWW5`2CxXͽuWURP-])jWU5`2yQu t#=5@=5=|2:h^#Ff@Phm5`2 x|2h"_#j1^_[]USWV \$$|$ l$(1uu5|2=51jVV5`2)x\D$ljT$Ӄ==5D$x=5t=59L$ujRP5`2x+D$T$EU,==5u#X3hV_#0j |21N ^_[]USWV~=|2$(~$$~=5t)h_#j蔢I1u)1ɍ|$h~W5`2 0|$fGWhm5`2 fD$D$Whm5`2 \$h~S5`2  $h~S5`2 GfD$D$Whm5`2/ |2t1<$uzfD$D$Whm5`2 f $ x511F$$~jQUR8ы$ʉD$ ʋ$$~) h(`#b1F|?1jPP5`2xg)y11=2|!h_#11Fs1o0hEd#RjRP5`2=1yK0h`#.0h%d#"0h_#0hmd# 0hd#0jB 1N5|2~^_[]fD$D$ D$Shm5`2 yJ0t$hX`#:0t$hd#0j٠SWV Vh5j y/h}`#0j袠 jVj y/h`#0jv 1N==5=5==5=\5u55h`#趟==5hl2W[!hd2WE!o =5aX`#t0a# 2 a#tQa#QWPA S8 2{a#t""P55ha#ha#ha#hb#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5=55=5hfb#sWhGb#T55ha#Aha#4ha#'hb#<=\5thb#j{52hb#55hb#ҝh c#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@hWc# hc#h6c#Y55hb#Fh c#9sWy\Whc#=5|255h9b#5 ^_[hb#М=5t P" W=5t =51=5|2hvc#j|52mtt$11Hfhh=5Fth=54A51+h@e#0j臜 1Ht$+h]e#0jX 1HVt$VUu+Vhqe#0j*^\SWV|$$W膫ƃu[G+1~tHNtt 9 tu/+PWt#D$=@t *1N|^_[USWV1F5PH{5P kjEƉ+df5Hw> 5SPhA5Q@ Pf5$ Tf5L$QPhA5\hA5CjuhA5[jhA5^uH=A5/u+-Bu"A5P PhA5A5P9 h\'3WVhA5M<h'3@ubPf5Xf5 Tf5 \f5QP.t 5P(jh5j@ xsZ1e^_[]2)he#0jՙ USWV (2x&,2kL29|׋yM1II1lf51PQÅy19}WDu=2hg#j.hhlf5OÅy1ۉ9|(2x(,2kLShlf52y݅u=2tehg#j迗lf51E$sVhmf5lf5PX )؍lf51Eh h#ji1IkFL25Shlf5#1ɉ^_[]USWV D$5xGD$kf5$1F1lf5SQ291C5hlf5hA5P$ 5Qu*D$PUhlf5Q8 lf5tu=2hg#j耖t$hmf5hlf55 $W1CttUtB:x9u=2tFhng#j,Whlf5Q19uh%g#j1H ^_[]hKg#thA5Q<t hf51hg#USWV1C5PH5P yjXƉ׃=5t/52-t%hf#0j4 e=5t Rrx7t$t45P(jh5j4 lzbV1ۉ؍e^_[]Ít$\$D$df5Hw5 5VPhA5Q@ Pf5D$ Tf5L$ hA5kWehA5duy=5tShA5t^5 5tShA5hA5UjhA5Xt@hA5EmPf5Xf5 Tf5 \f5QP=A5/u+?<u"A5PPhA5A5PK 5 5tShA5  5tp5|NPWt$hA5)6Q=55D$L;f5D$P f5PhA585e5t@t=5u Pl=2t1df5Hr@tZ tUhA5l'9D$X;f5D$\f5?uD$PhA5$Ã|$=5ut$hA5Å5VShA5P@ =5uShA5/!؃=5\$C=56D$5HQPQ 5=5D$L;f5D$P f5Pf5Xf5 Tf5 \f5QPDy hA5j=5\$^=5Q5HQPQ D$L;f5D$P f5D$X;f5D$\f5OPj J5D$uPf5D$ Tf5L$ QPpe5x5255Pf5Xf5 Tf5 \f5QPhA5ji\$=D$L;f5D$P f5Pj I5USWVj/hA5Z1UhA57t>5A5h=5U /tOGh=5WUhA5hf#jjO1N,K|/t1NuhA5hf#jj^_[]SWV=501F 5t9t71he#jێmQHb5P R=5t i<5x t `m#5 5t#55he#55D 5ujhA5^t(Pf5Xf5 Tf5 \f5QPu1=5thA5hxuthA5ly5P(ljgSW, xa5 5t&=5t55hx"251G*ƃuejh5j諲 ^_[USWV $5xu d?*1F5P,5@0D$ jD$T$=5jShA59]jhA5Q$=5thA5~ghA5+thA52ddf5 w's1PP5Y5膲 $jhA5Pƀ=A5/u+4u"A5PrPhA5A5P =5t4$hA5Z' 5t:5|Pt$t$hA5s.PhA505hf5hA5T$t8=5=55HQP~dQ c5L$Qt$A5SPD ƉPS?&=5tc=5tZ5HQP~3Q 2Pj D5PhA5%dPj sD5D$L$ʃ|QP  Tf5Pf5ʃ|QPxnhA5*1C@TPhA5Z%F5Y5h}f#0jhA58chA5)t 5P4 jh5jޮ =5tn)11Fe^_[]þA5PV$Vb뙉PhA5$뇃=5t cxIx5PHx11@USWV $$h 55S9 = u$ /,4ŏ4/t EƄ4/FED$P55ؘ#D$=@`1Gxv%xmlxd=5t exRhA5!(ttjh5je Gm'155he#j 1GĐ ^_[]555hf#0j҈55h:f#뻸 )D$ )D$$hA5 X5 5tV1=A5/A5t$PU ;D$vhA5h\f#jN _D$PSEA5WT&W^jhA5Kt'hA5K`hA5&'VShA5NR xơ5 5tD$PhA5\I=5t55hA5+5hf5=5tEhA5C=55D$D;f5D$H f5hA5{df5Ht 1PP5Y54 $jhA5#Pt$hA5 WhA5D$P;f5D$Tf57wD$ PhA5;5tk=5tbD$D;f5D$H f5NhA5hA5^^D$D;f5D$H f5D$P;f5D$Tf55Y5h}f#0j蕅PA5WWWhA5!PhA5=5e=5X5HQP~ Q Pj >5 D$D;f5D$H f5Ufp5pj5t5u 5@t5=~| h~Ph8h#thPhih#j蜃1Hãx525=5y x155 p5t5ʉ5 5p5pj5=2u=t5t4=~| h~Phh#thPhh#j1H5=5 y xp5x555155p5pj5~2x5USWV=5thh#j艂1I^_[]Ã=t5x52ut51IxՋ=5+=5|$\$52UVSW:)9|11UV$)݃p5|J5 25~H5x5P55;5r֋ p5 2551)ȉQPx[p5Ɖ55 2ȣ5)=55 x515521h'i#jWV1N=2=2uhYi#jy155525p5Z12~9} G{u'Phi#j~ xI1=5=5525p5~ p5 555 51^_ËD$L$5)ʉ5QPRA USWVu ]1D$ D$ D$5 5)ȉ9؉| 5)։ x5QPVSL8)ЍT$RPQ 1ID$L$ )5 5|~ 55)ЅqxUtX 55D$9ؿ|‰5)ظ|D$L$ 1H1@D$D$e^_[]V1=5525p5~# p5 55 55V1xC=5t/x&5555525p5~51 51H^V5;p5v*55)QjP  5552^USWVt$5 5ƒ|]; 55}O1hj#W}=5=5$-p52 ( 59)1 -p51ۡ21PUK;2tS155Sp5 259)QP륉5 5Nj-p5S55U +52)US55p5 )VQS 55Htt51O1^_[]É-5USWVP\$1~cl$5$55<$)"523x3ǡ5$559|WUV( 55)11H^_[]USWVPD$~Z\$ 5 $55ŋ<$)Dž~95$559|WVS 55)D$^_[]ËD$)USWV\$ l$؃|~5D$=5t$)#524x\ơ5D$=519|VQWD$ g =5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=5t7P$Ty# $ h\#0j.{$|r 51N5)ȅ52  59غ|PQ$ ~|)à 5 5ظ| uXP$$3D$8$3L$4 $ hi#jUy hx$ hi#j5y Lv $ hi#0j z'Q $ h\#0jy111o^_[]USWV$$x$|$$D$x-D$PQt"4$hj#0jny L$|L$1$p0L$15 5)ȅ\$^ 59|4$ST$ RT$RPQ$P~R|$ =5 5tP;CJ 5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=5t% u!$9$t4$h:j#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=5$4t1PWpy#h\#0jQw1HD$sD$$P$<24$tsVhj#0jw $l$ l$\$ 525p5W lj\$11ËD$ 9D$D$D$p5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1525p5$<r ljޅz11 ͉$03x$3|$ uRD$$P$8$3D$\$3L$X $0<$\$t*Whj#<$Whj#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]$0hj#0j8u1K<$w<$W$4hdj#0j uUSWV|$7t6|>/u/1N=5MWhk#js 5.|$tjh W V $=55_Shk#VP&$HƅE<$8$S x<Shk#P$%$gHywK0=5t55$hk#Vjs155$ $Qhqk#0js1N^_[É`USWV|$?/tGj/PƳUWu/Fj/VƅuhW=5t$$W jW+y3UW蕂u%D$ PW)jUPWV/Fj/V1ۅA4t*PW蹁t1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pkyu~hWhk#0j r$tDP6Fy:$hk#0jq$ 1$5^_USWVD$Et$$^߅tPʗyWhk#0jpq=5t<$8$W 1 5tt)$($u7=5uj@5P255!UW2 2t%1PPL$H$X$T$W$tJSWCy!SWhk#0jpWD$U 1$5^_[]WV1uA|$ t$t$W| t(55rWhGm#0jp1N^_Vt$#D$ PVSt%55)Vhem#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PV%tVhm#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WV-t6!8Nu} u&WVuVhm#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV}t%#D$=@uVhk#jm 1HjW |^_[USWV׉L$]D$PS}t6St$ڕth0wwS tՃ} tL1@_1=5uTG3D$ 3L$ uKG3D$O 3L$ u9t$hn#jUl 1St$hNn#Vj6m1He^_[]ø#D$=@u%he%SLtS0S,A} D"Sh=n#0jl댋D$$u1@Ë $jPUWV}wPV5|1@xN=5t1A$$3L$ $3$ u*0$3L$,$3T$ uVhl#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $&55hBp#uu=5tlD$PU7{uZD$ !=uHhWUR ƄD$PWzuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$ 4$U蛒L$ t uu$UFD$y)Q8=5us<$8$U xZL$ A$t$UhLl#0j3j1H=5t2<$8$U Uhk#Wji1ɡ5tt1Ƀ$ !($t($t$$55h\#jUL"xN1=5=2=2Uhl#Uhul#j7h 1OD$PUxx=1$ ?#D$ PU1@=5u;L$ ($/#t$hl#0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PWw1x1K=5t މ|^_[]ø#D$=@u5he%W71EtXWyĉl#$t W<y55uk#WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5p5l5 h5d5L$T$tI AQP* DUVP 9t_L$ xZjPUQ\ҋT$0y@oEP Džt<$\$MQVPǯ D$8+$T$0)+|$$>hm#jJe*t$8hm#{t$8hm#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh5S踉 y%m#m#\$ SV0je^_[Vt$ xFPՋ=5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(2 ~H111Ã1T |A9uV$P$( ǀ$1111틴$(3x$3|$ uUP$(xLX$3D$8T$3L$4 uF1VVV$(xE$($\hm#h\#.hm#j%c #f$(hn#0jc1N|(^_[]V=5t5=5t5=5t@5=5uh 5t01x&=5tDyhhn#jhb1N^WV5tP(w1551N5t 5tqA5uj1'3H '3~'3H '3h'3tN;42u1tB 59G= |+5xx5 PW1t-58j55h5 n 5&1^_SWV|$tR?tMj tSƋ\$W軪H~ </u>ۉ^F=5t%5p!hn#j`1Hhn#55551^_[á5t@=5t5=5u0=5t'D$$u5tjP55 WV=5tB55t;11G~u)uhn#jA`6hi#h'3 vu^_USWV =5u%51N5u5}$ $ $L$Pu5t#HHf w=$&ph\o##"pho#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p 5 5qhpo#0 ph$o#p j_e=5t\@PL$QL$ Qpp p09Bx85jjt$t$t$t$ph@o#p j[_ 51N1 $&LJ$Ƅ  LJ$LJ$=5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 5 VqP貧  5VqP葧 55h\#n1u5@e^_[]fUSWVT\$tl$h=5P($T$L$X$1V8$%V<$O1#O1#t4$tVjQjRD$Pho#S $u2@$%  RPho#Uhi#^|$x$ho#SEPD$Pho%Sm$Hs Uho#u# Uh]"S7 S~X^_[]Sj "USWV@L$E\$CD$PS2{3j[9p#|o#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($WVSho#t[d^_[SWVt$F=u1H|$Ptt6t)G\$QjPSr^VSȄGu܃^_[Ã^_[鬄USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V5~1F1u5ho#j9W^ÐSWVL$D$t$|$<<5t5tt\^_[鏣}\1KZ5teSP+ti:tdx:!39}j <<@!3sPVWӮ hV5:-u/5È5n55`S6hp#!3=S6h'p#h'3 ?^_[f1Ã=5u1á50hq#jV 5t"H 5p0hq#h'3E 55hBp#u_sUSWVd|$|j/7K5t@l$x5hBp#P65Bp#1C5\5D$ D$1D$$jh2hs#WUHЃJw$&;t$$@$0&<<=5묡2t 252r2t c2P=2t#\$5! <<kt5 t5=5tq#=5P%255<<R2t 22\$5t=52e55L=52=5.5 Pt$ * NL$ << 5$LF=52=52=52=525<<5=5S$5q5<<[Z 2@K 28<<8-u x=5D$ =x5u 5522=5p#5255<<WO 5\5s$5d2U5x5?=51@D$ )2 L$ ƒ ʺ'3t\'3 !35ƒu 9u , l$D$kL255 51"1$jh82hr#WUS/~HЃJS$&42ƍHw$&$5뫅!<<=52\5|=5S$m5@X5ˀC51=5p#"5 <<@Ƀl~mtKotRpd5SatDeJ1A 5 5 2 2 2"25 2@{pe<<=5SH53 << 551ɉ5<<"]55<<L$h jLjh2Q5bl 5<<Vh"[VO245 5@5<< i@5=55=5P%55<<9i <<E t5N545 $! << }555<< =5@5 2%=25\'3 0akG1A11|$<$t5D$tGNutNj]]h^t#S1t[ht#SuE55j55S^ 1AL$y#$]15<$D$h#SZl$\$th^"SDžu '31 ðt5ht#S u35S I 1urL$tP؅uAJjht#Sˆ uP5D$t t PH CPىQ/ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h#S!t Wd=|5<$l$S|$;5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u 5ܼ2=rnFr0s9-!3D5PM!39}j4NxP!3@!32!39 1VV4b x!3@!39| QhNr#j?H 1FPhr#V(H Vj5<<h8r#hSs#jHjD5<<hr#hhr#5<<hdr#jG '3Vhzr#q4%52WV 5ܼ2WV Vhջ$q5<<h8r#0hr#jjG!jmht#jCGt$hs#jjP$t,(XN8@tUjP$yFD$8Uh^t#W1D$h.D$1$h#Uth^"U`Džu J'3tkðtAht#Stjht#S{ tj1ujSðuh#U,t Wo=|5Uht#l$}$l$ht#W]tjWB\$rt D$W2|$ td^_[]á=5t8uhB":=5t8u=5B"Uhat#j E USWV|$V%UWO*UVNJ00ht$跩tAtZ/UV*UW488ht$vut$hq#0jxE1H1^_[]á5t H 5h'3hw#vnjWV'31FWVhht#聧WVhhNu#mWVhh%v#YWVhhw#EV,USWVPˉjPQ誼 փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9QQ$1>tj,VÅtj=Vtmj tdAE0H@5=5t t5st5uh?s#j6B1O^_[]hSs#h|s#hSs#j B4$ ɋD$L$01&WV55hs#h'39 t(οs#Ph"$h'3 !uء'3H '3~'3H '3 h'3j Y^_SWVPωPQ-t4Ƌ$| tC$S虶 t'ǍCPVWc DG |5 |51^_[USWV$t%t_݊M\tS8uEEhmx#j@Ej UEƃjSVe t3l$hUVP蘨WUhx#j\@S3 $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=5tZ5HVV4$Y Whx#ji? 1H^_[]VV' hx# 5 51V4$ Whx#USWV\$tK;tFjO tLNjl$1pScG woD$G955t%5x!h#y#j>1Nh8y#=5=5^_[]WV55t;11GFu)uhey#j^>6hi#h'3 vu^_USWV51 l$$=5Kt(=5t!9t)@tB9uKKt8<5CS Dž$hy#j=z$uEP}t?NjCt /C;WC |/uHC C$#hy#j2=Ct/C1N^_[]USWV|$LJ$5tOwCu kPUC |/uPV3{ t2[u1=5O=5=5 2$=5tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=5tGtlD$@1G8D$@1D$\1GEt$ h4{#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhN{#j59tNjE|$tDD$@t:$t$PVh{#h'3AVhq{#h'3, $t+Et$h PV~ 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh{#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 75'3WVVjiuD$L$ L$$Vj VjiuD$L$ L$$VjVjiuD$L$ L$$VjΒVjsiuD$L$ L$$Vj襒h|#踆 5155 5P 5t$,NFF FF |$WVj y|$ujWj WVj y|$ujWj WVjv y|$ujWj^ WVjJ y|$ujWj2 TWVj y|$ujWj (D$,WVj   WVj 0=2t"VzÃt C|/tSK 5t}ǃtCPVW  5D/h=5fh( j2HwN$&ʚth |#0jq1 5e^_[]h{#jY0h{#覕-==5u4!=2u2Ҧt5h{#j}Vt$1@55+|#tP|#QP/5t P1=5tVU jfUSWVt$=(5t38$/>3i=)‹1@?9 tR=,5t3<$/>3i=)‹1@9 tR 051QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=(5ujh= (5#t\u#uGW tjxGj jW; 聡 />3i=)Ë (5,t 98t#@u $j蹢 t!8h $1(Wh|#j9- h|#hl|#j!-^_[]USWVP|$1N=,5ujh= ,5#t\u#uGWҚ tjxGj jW> />3i=)Ë ,5,t 98t#@u $j輡 t!8h $1(Wh}#j<, h=}#h|#j$,^_[]USWVt$totij/V訬1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉha}#j+1H^_[]1j٠ ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj`S CS>tKt^?tYڃCKt6C;C C})VWh~#j*Sp h}#C=05t$45X Vhy}#jW* 4Vh}#05451Wh~#j** S hB~#}VQh}#j*USWVPϊۉ$ts.311JDhu.e[YAuۉ4$Åt>V2s,FN4A1R豘113Wr1J 4$$&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACS輚V!1҃ډЃ^_[]fV1=85u*jh c 85uhy~#j1(1N^USWV 851Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åujڜ Ël$EPf $$$KCs{ D$C $C1^_[]Ët$ h 3PUq  1$$CHC1FwCE3谬 S觬 S蜬 h~#j&1NwUSWV85t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDh#jY 1^_[]USWVD5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjД J1ɉHT$, $$$P HN HF F t$1 H;@u D5-L5H5H5-L5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@H5=L5l$T$s}ډD$0! umщjt[L5=H5 tIj轓 t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=P5u*jh=Ĝ P5uh#j1N^WVP5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(8 t^t$T\tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<WY h*#jj ^_[]USWV P51Kt$/>3i=)‹/uPVDžj$͐ tWWZtN$$QVQ4y8~V Q(y,~VIlNF T5F5T53Whu#!Whu#j VԠ Vh^#j ^_WV5T5t~1FT5=5u~ t v6蚫2 2tWWvvvv 6踫=2t v6ά6B V9 5T5u^_jhÀ=X5u1WVL$T$t$ X511H<>u5Guu%P=\5tX511@^_V|$ |et$>t\jh@p#PW t 2=2t#hŁ#j|j 21H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#Su3ht#Wu!2u9`5Džu91FWSh#Voht#h#h4#V WShb#jL1N^_[USWV\$hSb1N|$1h$UW蘤 O$LJ4$<rD Shh5hd5   Php5hl5  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ'` 7谛 1D$ereRPQ_ ^_[USWV $ $Hw.$4& e| Rh#{=`5x1ۃd|Rh0#Q1l$ hVU赡 $ jdPU$,X_ $$$Hrjtr$@ L$ D /f@ 0 wh#h#hւ#h#$F1 $F2 jdPV^ fF0 $j j0PР 5 5t,5T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0UK $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0Uݟ $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0Ul $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R~ t$ hN#$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U菝 $ t%hk#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh@p#WN t1H^_jh#WN u(=\5ut5ut5h#jjUSWVl$hUh1N\$1h$WSY K$ǃ4$Yt"Yh PQY Ǎ A/G<rH )Uhh5hd5o   Php5hl5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPԲyEtQQP  ƅ(8$VP记yElQQP˳ 1D$@$$$$$ȃJ-σwY$X&<2ǃ$)$Qgtxu=%-u~t6h^"VDžu'Z0+ PVh^#jH'31FUW<t5Ë$rt$Vhq#j$_Ft1N1'3t W ^_[]fVjhP"&xKh9"P菈5t)h^"Vx51u;55轋Vd'=5thP"h-#j 1H1^WVPD$$|$t 5t$5 5t"=5th'3j 5'355hԳ"W 4$VWj Wj  ^_P5t$L$T$ $RQP< 55hXSWV|$1N|55t,\$OPWS$ t;j Sqa1t^_[SWVPD$ $|$t 5|$t$5 5t"=5th\'3j 5'355hԳ"S 4$WSi ~V褛 Ph R$h'3ٴ h'3j Z ^_[fUSWV} u7$hO1#jɚ \$1hh$WVNV LtPt߃95!3D$h#Qƀ8/hI#Vvush{#Vdua$PV tKD$Phe% t4$3D$ $3L$ u$3D$$3L$ t1PPCƅu j02Vh\'3eh'3@ujKh 9"jJʋPhM#h'3J j USWV$$6hO1#jF 1Ɉ 5 51Ch^#VUT e~%q~3كrtރvt_x5ŃV.PtrكRtwftAi55뒃Wt6duq5z5l55W5I5;u!39|=5u 1Ĉ^_[] D$h8 j $D$,$SD I9v9/u؃@]9v8/@tj/S{t@À;.uCt<.u{t0\$u h#տC\$5EHu]j$8u 5Pjpm5a$8tӋD$t$ VWR  5tRtD$Wr"=5u詊8ts蟊8?ti蕊8t_Whk$/HtjO PWhe" +D$@uD5u;Whۆ#軾5;;=5uWڀ=5utV/tD$%=@t/==5u uWW$Z 5 5х ˉ4=5u Ő=5t@jPt$ u hh#7P u-8V NjGHHf wO$&=5WOwP"{jWV GG \=5uWOwP:GHftIfgft9G =5u P2 PW}G  GwX58=5uG ?tow 賔 PUhe"L c=5uO1zuSwt)5t 蓇8t1艇8?t'8ut/whk$,5V' Dž6=5u =5t5wwh%jCww Г PVhe"jCrPh#h'3 jȡ5USWV΀=5uLVhx#h'3迬 h'3_'3H '3'3H '301C=5l$$#E=jR贯$8D$Pu*=5uvVh#w1Zh'3vƉt9 t4'3H '3~'3H '3h'36ƒ1ۃYÉ؃^_[]ÍD$x O1#tD?%1Pu荔1PuVPWSD$Ph#h'3bUSWVAӉ΅:#K1jhV  $ǍD$PWg.D$3CL$3 D$(3CL$$3K #D$ =D$W1PPPWl D$$h PQ葀 KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW D$L$D$)T$T$ 9D$t;$SVG5Vhk$*))调5Vhk$)W1@e^_[]Wu1PPPWk uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW D$L$D$)T$T$ 9D$t1&W@1PPPWk h j$P~ KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW D$L$D$)T$ T$9D$tuWj1PPPWij Th j$P*~ CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW[ ;D$t$$P$!PE L$)L$L$L$ |$D$ hW|1PPPW{i fCXK\D$L$ȃ|or \$9ËD$| S$PWD 9D$)؋L$D$ظL$|Wn1USWV\$l$UEtMƊAuA)k')5j)UXGG SEG5<5 5t^_[]Ã=5t^_[]USWV\$tKƊAuA)k')Ƌ,51Gt?uS[qtmt&uSBqu45jVJ1^_[]ËD$t @ъ@uA)k')5WVt$ >tVG t|$u G?5wPt wEt WG&uGP`5WVP@T `58^|~u$PPh#~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5X5^_ÊVF|uܹո ѹ Ǹ É)B$:@B&uVPQhf#NfUSWV|$,t$(S=P5jLVJt:xIuxNt@jLPj VJ1tE@j PlJ)=P55T55X5"1,=\5uƉSϱ^_[]ùۇ#V=\5)u ^5T5Qh#nWVO1#|$ |$wL2 P2 5>t'F 5Q5N@>vuڋ7 5Q5t躲 @뭅訲+L2@Pů5(5VrƉRPhk$Z# 1 ^_USWV8׉ˋ `5d5D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhL"jV蟘jVt$ % USWV Ջ\$$St$$tƉ׃=\5%up1҉  ډD$$=\5&uU1ۉ D$`5 d5ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$X&  u !ڃ SQWV襝99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWV eƉ׉^_[߹L#]#@#wSWVP=(5h5(5Q(Ɖ=(5=2ttxt>u7&t1ۉSPV\ Ɖt9u$8t*s8u+$t@& t$@u^_[ùj#%USWVPՋ\$St$gƉ׃=\5uKh$`5 d5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա\5HwSjP ljա\5uND$`5 d5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH`5 d5N"ىWP1Eكra$"ى=\5#É\5݅~h\5 `52É׃'1H`5 d5NLىWP1 1`5 d5NىWPÉ\5L`5 d5NىWPe$É׍Eكw\5|$4t;~l-\5b1A1Ǎt$WShL"jVjV5`50't1I1@1l$QPhL"jU赒jU6 ؉^_[]ù#T#J.#@USWV֋] $t$ơ`5 d5L$ D$T$uPV֋=\5Ww,&8&}uPW ֋=\5ȃ}tً$VPt$ ֍Gw&;E Qȉe^_[]fUSWVf2$1h#B=etuj50\$hl5VSZS(U (@PJál5)QPSH l5)١5pQ~V'PSY$>jh #a#ƅu)h# >-u~u5p5u5l5$>e%t<.u 1.D8t/ua$Phe% tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Shh$軺t/hh$診u58Ltj58j75l5uj=l5522f`5l52HQPP2Q 522@u1[h#]g0t Ph-#Ch #9SWVW!WPKu2\$V迠rg8"u6WWPtV螟l5V胠^_[Åu.g0s Phc#jl5tjPh#l h8#fUSWVD$ 2fa1Ƀ|$‰tpыLhe#SX$th"SXu 1t$.4NJ]taM\uNEU\rw$&\0u!11ЃwxAunjt$>2HQPP 2Q t$.PN    ȉš2HQPP 2Q<$t*2HQPP[ 2Q 52 2Hu 1^_[]ÁfHhw#jf|5u~aL$ 5jPV=5t 5K1550ppp VPj 955t =2ujVaVb^jpPT$=5u 5D$ $1APV55t1It$aLVPL$T$ D$$PD$5jWVP|$t$D$$c4$ WWV׉Ρ\2t P29ty u hP2C =55u bPhԳ"hd2P =5t55hԳ"hd2/ t*t$ Whd26 x4h4%hd2xVo Phk$hd2 2HQPP 2Q hd2o ^_SWV|$t$\$bSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$Cb4$w^WVt$ |$#bWY^_PT$D$ $1IP>XËT$1It$)Vf&T$ L$9upu'0fuQh_&j h55@^15555WV|$ |t|$wL2 P2 5>t'F 5Q5薜N@>vuڋ7 5Q5t j @515J+L2@Pgơ5PV 5^_USWV\$0t$,|$W5(5jVi j膶=<2thƉ؃$1t7=2u.D$0t f $uQVi=5u"Wj"=<2u11EiW賙u 5D$0u^_[]jUSWVL$,|$(206̓V$$&Uw1ۀ=2_=5Mjw1ۀ=21=5$=5jwH1ۀ=2=5=5uQ=05tjw1ۀ=2=5=5t  u8V胘1tu 51l=05t\UW_j\$0SWh a=05t0WD$,E=05tt$,WK_=05tt$,WE\$,SW=05tUW=05tUWyPh# hP2Ek=05tswww. 5@jw1=55 jwa=5t 51VVŖL$,=x5t =v2t 5tu u^_[]PjUSWV@|$T5|5D$$w=.2tttn$55(5P$Pqh#dGtj P52 Kȅuh.#452l$jU th5|555j<$t&4$h5#52|$5\$X5-|5j w7D$ 5u=5tSw55|5jB 5u=5t]<$t&4$'h?#52@^_[]j5|58USWV\$;s3=.2{$55(5POPh#stj V52 vh #tu h#b2HQPPZ2Q 52l$5ttu .|tF1ۃjU|Sl$SPi~ tuQV/|5Ju 5u=5tjs:UsV5 5u=5ttJ=.2tA{t;$55(5PP(h#52^_[]SWV|$5jw1=2t 555^_[Ë\$15u/? 5ut΅tSw555t"u85H 5K5jw=2tru+5H 551 1@655+USWV1=2t55|$0D$P`m[thUS- =5tiD$5,$\$4>G(5=.2 $5PQ Pgh]"Zw O2HQPPG2Q=u2HQPP2Q 52juw I Sw55=2uZ5t"u*5H 595m"u5H 5 5 555D$P ^_[]USWV|$0t$V袏@O (5jPw+ _1=51{t'G(5$pWXWuuޡ5[tZtT1=5uI=2u@l$41; u{C(5Us t=5u =2tʋ-5-5V ^_[]USWV\$K1t@ 5PSwƋk1OuD$}t 1{PuV_y uR 5u=5t~ jW1|$x4$jt$jux Wa<$t$RmE{t Vv1 V{5 5u=5tA^_[]Åx WT0` PhG#USWV$$D$1t$ 5D$$5D$D5D$Ht$055$P55E(5L$XIEtH1F\$Xljtw蔹uG(5hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG(5w.tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P8$D$XtH$r4$ ȅu$1ɉL$@=2t=5u|$ ~ $@D$@D$ )$=.2$55(5PP$l$41dz=u)2HQPP2Q9}j=W#Ɖt>u2HQPP2QFPpU 1Ո`1t$XtOË$t)2HQPPO2Qv É΅u$u t(PV52 مt ȋN΅uء2HQPP2Q 52W|$ +t$4~jht&Wq u|$$ƅuf|$" L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$6 fD$D$" f=05t*fsD$=T t= u ft$}u$D$@f%u D$5jUqD$,ED$D$tD$L$` =~2u f|$t$Ut$4$s t@5|$D$D$`t$dQD$,F L$5=5tYD$t;=5u5=5t.t$`jt$hyL$D$Hs*|$" toD$ t$,;u5.u D$ 1@t$,o5=5  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]5D$(55 <NjD$ |5 D$(5=55Y1PPWG O1ɅȉD$PPV5\$pf5D$ H5$5155 5L$( 5L$L5D$D$hPZ 5u=5t$jVҝ0|5D$ 5|5|$t&D$1f|$tH 55$5h t$8n5H 5=t$L$QPy 55t$9D$(5D$D5D$H5D$L5h5膚5t$pD$ |5|$Pt j 5u=5t=5u 155D$@z$jW|5D$ =|5h!t$8H55t$Ut$8>oWt$Ut$8pD$ffD$0fD$8D$L$D$u#|22x22@L$D$5D$pSD$l|5D$ 1D$T$PWyt+5D$|$D$5=|5D$$ 59t;D$=X) t=6 u)5D$(15D$TL$$PQ t$u |$ uD$0ufD$D$451f|$ˆQPW$5$551@4<!3D$52f`4$t$T$$L$t5D$ |5w2P22d2|$Tt!D$(55D$tD$p5D$D$tFD$t D$f|$t$lQ5=5t|$" t j|D$u2F x2)N2|$@tht$Dh+#& $P^_[]h\#55t$1=5ȍPu =5u"D$4thB p;ȅu~55t$ t$,Pt$=5uS'h#h55t$p|$Pt jNt$hLD$(5D$D5D$H5D$L5D$ |5jPUF0 5u=5tVR Phm#x5u5jyD5t51cDWVt$tr|$w$P&j Wv M $@Fvu;Ftj WP( $jpV ыF @v 빃^_V t$t8>u3Ft,p蓨tF 5QjRp ^SWVQt1OS jjPM t6>F1"jjP# tvq^^_[USWV|$41GGG =2l$0\$S}5AjUfjUPh uA5=5t 4$1CSt$WSU\$t$$w 5u=5tS=}^_[]h\#VP5u1PPVPjh2 tF$P`{5t.1QQVPjh2t5@=PATH558 5 2 2^á5SVhO1#ޔ58uj1^[1ۈ22蠎55thB v655A 5SSQPV5á5ËD$ 55PËD$@5 5155Vt$ |$|v܉Ph#1@ 59~1Ҁ8cB5 51^WV155Vȓ590t\W'{50PjPH55555@5jw55JW {5^_USWV$5$j/W=t@D$PW D$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVuD$ %=`uVyjWS ƅuWhj%Wh# Whۆ#L$5x 5V|$|D$ p 5555uu~9} ~ 55^11@1USWV4hO1#|$$WvT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hƋ#52](14^_[]UWV׉΋ 5uj'k< 511D$ T$l$ HY&D$ $,$<$\$ D$#D$Fa?6u0uFjhQ$W %W|80uHx.t x0@te^_]fUSWV|$7j/Vu#$jVP uaK$$WV4C> Pu 1@Ɖ$m=5ud$$UVuG=8t8=8t.=8 uPV藽t =Vvju$P OfSƒrtt~ 57PSCPVhe"jSWVt$|$t$VW <t <^_[Ã|$u0xjWC6u55V!jUSWVPD$tnt$ t%1;t <:t9tGt$,89-P2}v,; L2t,WSQL$ .L$ |9/u 1xAA/D$PL$QU5E9u,;E-5L$Et <:tEL$<:t1ED$(Q $+ L2AQ:t^_[]USWV$1C1D$ 1D$D$D$\$h#nHw5$|&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 59A593t$$1CjWtV@wM$&|$t&|$ t4t=02x'@ |$u5H 58u5PVD$ PW9D$ft $|$t $|$tftjWt jP:4뇉4|$ÿ5/tPEȃw?$&|$u/|$ u&u |$tf<u t$Um묃X5r52,2$@th#]1@$$$$^_[]SWVt$55t5Hftfu9502| P. 9p}Ëu̓X5r 5t^_[Ã=5t^_[USWV$G$$&o5EjWS PqM䃼$$twh#VhH#GPhk$`5wPQ_ 5u=5t hR#yD$PlhX#_/th6#Lh?#?GPhk$ t*2HQPP2Q*2HQPPV2Q ^_[]ÃPWh\#SWV|$tWȊ Bu%iC)ʾ!)!53tFWP(tc6|$tT5WPnƉf@@ WPZP 5u=5t u1X5^_[5X5Q+  5u =56USWV$$$j/$turfEE^59tthz#VVt $j$q1Ʌt@@t`tm$umtisD$ P$ExfE$K958+585$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VmG5tAPh{#{t$t-'55h#{t>/u19}-9j$$PM ƅvvD$ PV̳x3D$(!D$ =u8=5$Nu$38t38t 3D$}o$E$\$|$$t$t'52jS\P$haC&VfEo$T$pƋ$$5|$ÍD$ uj$HfxT$ ufBuω7 5u=5t ׅt"G GfEG EG fEGE fEEĜ^_[]5T$ Éuj$fxE$ufBj 5tbiV@C+L2PujVtij$t3fxu*SVm$=5V$h#SWVP$&1t8|$,&L$8u%tWPG#L$ t us^_[SWVP4&1t3|$<&L$8uWP"L$ t us^_[V4&t%<&jPf@NHu^V5 02trft fuxB =X5r^USWVP\$=51N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh{#wt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWV55>t+fuwW(% ߉?u׃X5r 5t^_[Ã=5t^_[WV|$D$ 5jP+@ft*fu vfFGF GF GF 5t^_Ã=5t^_WV t$D$L$ 5fO 2fOPGWVU 5t ^_Ã=5t ^_jt$itfxup%1USWV t$811G$1D$h#<ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP5:KB5*#$1\$ D$4$߅u U@=0&t,]4&0&8uUPpujU*ƃ<$t0vhi#4$5H 5(t|h#j vtuh#vhi#*584$t2HQPP2Q l4$t%Uhi#Ph,#+h# ,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$&D$j/UjUdU~+08 Ph":uhh#:YuhN#Bu hd#7t.Uhi#+5 t$|$tJHhy#t$5H 5(ouh#^$V돡5D$ FjUD$PK P.dN<$uO1#|$t9#Ph2#Shi#t$ct$1 ^_[]h##ctO1#RVh֌#Vh#1PPt$  5L2@PbUSWV|$D$\$=2t\5H `5 L2 d5 P2 51ɉ h5 x5H (5Sp5tH 5~d5d5dH d5d5+L2Pb5|5u%Vjap 55s|5UVW5-55|5x=tE|50va55΅u!Idd552V'5|5t O5G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t5t D$2 5D$d5+L2D$?~uЃtRWT$4$ D$1@D$ wy< 5H 5fd5e$!PVVoT$0/>u!y@u=D$ D$\5$5H 5Rd5Q=\5und5+ L2;L$~[xuUHd5Q5H 5d55H 5d5$ |$D$5ЉD$$ 5H 5d5aT$,H d5>~=u|$ D$ RV"T$4| u(55H 5~#d5%`T$,H d5 X~`T$,H d5$9Ut$ T$4d5+L2jPHPT$8 !`T$,H d5>5H 5~d5 _T$,H d58 (5_T$,H d5(5_T$,H d5$^_T$,H d5D$$ 4|$tu^_[]USWVt$,\$(=x5t5t$D$ 2&j8\XNF5D$ h51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=555u(Q9PY5NQPS55 5 5u=5tP59t31Ʌt AuQP "u=57vA 56^_Vt$t"50v55΅u^V5h5t156P 5h5 5uۃ=5t莻1x5h5^USWVt$(PYd5+L2PXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 5Q5*[O@랃tPgY^_[]Ã=5u Z5L28t!Pv tx P!Yu$h #ljPXGËD$,tÊ&$< t< s4< w*5H 5~d5RZH d55H 5~d5(ZH d5Gw/u}/uEP[ USWV,D$DD$L$@9A|$$D$t1&‰T$D$D%D$ j=L$QKD$pD$$L$(<$ L$ u:|$L$D$ PQV1ڋ\$L$ H5T$)11Gd5+L2D$D$<$u \$H l%t$l$UPRT$LQT$L$ t,1t}y;@ڋL$ u\5d5+L2=2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =5t1C L$@11ۃ9|$t$ |$Wt$T$RV; WqL$(/<$ }D$1|@uD$5H 5~ d5ՍQd5BWd5MPd5EK1ۋl$$]|$ D$EÊ&$< u.5H 5~d5 VT$H d55H 5~d5 VT$H d5]EuKl$ u% d5L2)d5 5\$\$L$ D$E< w.5H 5~d5 VT$H d55H 5~d5 UT$H d5]Eu1L$ }D$n $Ip$<&|$t5H 5~Td5R1G>L$u0L$ QV1>t5d5U7d5ۋ\$uh$U\$H d5=d5+=L2t$ t$(St$ WVdud5=L2d5)=5S1Gd5+L2t$PS  <$t[1@Ftuրut܋ `5 `5̀tuŠQ1ۀ؉Hu,^_[]ÉRPhƍ#d[)Ѓ5(5hލ#F׊t!#u(HL$IQWP5(5h#D$ƃHQWP5(5h#USWV5d5+L2D$5h5D$ l5D$$p5D$(t5D$,x5D$`5-T2T2|$0WhQ+L2PjPD$ P$WWpQD$,t5D$(p5D$ L$$ l5h5D$x5`5-T2D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 5u=5tJhWt$ y 8t5HD$EEt< uD$C낉$L$}1A95} nRL$ƅ~N$ 5 FK1:5H 5Q FK1Ƀ=5 R1ɉƋ$|$t&$< t$< s< w 5F$ 5F5D$ x PD$t P D$tPi=5$u+L2jPt$$ 5d5 5u=5t˰^_[]USWV D$4L$@-d55L2l$)hP#D$5H 5~d5PH d5=L2UEWD$ PNd5+L2PM5(5W=ljӍD$ PNL2 d5d5) 5 5 iPd5SWhL"jPd5xt$GF9Iu|$"tjVU0 d5A d55)5D$ ^_[]SWVt$|$\$x5t#9Xu 9p ux2j0L x5h5x5x5Xxp ^_[WV=x5t$ 95p5~?=h55?PE =h5 5u׃=5t赮h5x5t?9p|58P x58 5u=5tn x5u9q~)q$95l5~ x5x5h55p5^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) #V,ts9touOt`w9tY&tM9sWT$uF9t;&t-\$09s BF9saԋ$t$d[$t$ǍT$t$D$Pg tPt$ 11ɉǍD$09‹t$r \$4;t$t$|$ mb 8|$TĀ u 8Gu tMtGOGʰ[t$|$ \$0|$Tt;uCK8 1t?tG1@18^_[]SWVP|$t$@t<*tt`5H 5~d5WBH d55255d51d5^_[ÃЃ wj PV 8ű$<=tuw~;555b5D$55ØD$D$‰؃AD$$Z|$ T$L$T$|$,&$< u*5H 5~d5AH d55H 5~$H $ d5Qd5 @d5 $Q$ Pd5$eØt2d5 $Q$ Pd5$eØt2H d55H 5~$H $ d5Qd5 1>d5 $Q$ Pd5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G5P5=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡄ59tH9u V%8/t Fe%QD$;55tF/}tEEGXـxs@<$uokt$ٶtdǀx .u.uN jWt$G t8tG@u@/UPWV55=5tt$ՓtWE/Q 5߀xruX@8tB@9tD$P55x55,Ą^_[]ËD$1Ʌt AuQPFWV|$ Wr@P7WP j7p 55^_USWV\$D$|nOʼnmIWP)|$SUÉpsx 7u߅u҉3D$^_[]SWVt$(\$$W7C `5L2d5P25x5js5H 5~d5k9H d5d5+L2P{6jVP W7^_[USWVt$FPhQ1#2HQPP謥2|$Q1ۃ|11E4賶E9uSh_#衩2HQPPR2Q|=1C4轤2HQPP2QC9u1^_[]hA#rhA#h5H 5~5H 5#=~u5H 5USWVP82H 5t+u y5H 5~xhP2Ӥhd2Ƥ 5182~PX5hSp跑 {e8t_82xL8#>WjW8 !Pjj  h#n82p582@1ҋ5  5@@P t 1+5582{tXAˋ-5M 5~ @لt5أ5=2t$55D$訢52JD$5H 50~^_[]ø55155hc#USWV=82w 5^t)kUi~D(< t< u <2Hc F5F5F 5G $9t Vt  5t^_[]Ã=5t^_[]V 51~^Ë82r t ~6u1@1z5 5SWV\$t$|$5 82y tje1 82I  82A$A 5H 5H 5H XtK =555 5t^_[Ã=5t^_[WV$5jWՎƍD$PV]uT#D$ =uD1PPPV u2jPVI u <$ELF1PPPV uZVI9t:$Ph 5u=5tCĀ^_Wh}#蟓Vhǎ#茓VWh#xVΎWh#dVt$5hm V?jjV= |$ t82H~Q=82pxuh/ 82A15542 5t^Ã=5t^Z82tL$T$9PuHuá5 82A 5A5A42Aj8/ 82@1ɉH H$H82WVt$|$ 5|$t=5Wޯ55542 5t^_Ã=5t^_锑V5825Fx PFtP ~ u82V 82H 5H 5H 5@42 5t^Ã=5t^ 82Vt$ 829t5tPu^hߎ#B=825t-Ã|$t=825u5~P#82@fWV|$ 9=5=5@2t PډjhP"*@2MP@2hq Pu5@2蒕5B9t jj1VjƕVj軕Vj谕 59tQjA15P5@2贔S0$ h芍 59tQj5P5@2[5@2襈@21VjVjVjܔ=5@1VtV跍@2Fuh#肛2^_t0E hPhe#U0& h?0 hPhA#蹎@2;D$u D$@2hO1# E5SWV=5jQEƋPhk$|-1GPh, $؞G;|ۡ2HQPPz2Q 臝5@2蓒tJ5V[V 5u=5t/^_[h#菍h#腍0 hPhe#fVt$ hO1#C^USWVhO1#C=551FjPlj+5i5rO@QPh#艝 |,Ph, $cE;|ۡ2HQPP2Q W58tH 5@(1^_[]h#;h#1USWV\$n;%u(sV8V08H#KSw8#dS8 5M55At#~i9:0#I {5#4$D$D$=5C1tQ~H$8?uEt$PuUt$ 7t #tl#K\$ueZ*t%tS-tU+EА#D2x+;5}#55it #\$1|$ t5^_[]áD2t 5iߐ#뚽ߐ#SU2USWV5)i5rO=D29u=D2)5~9ut Ku ]t]tu`ǁTtCiu3itit0 5D2^_[]SWVt$5~X1tttG9uމjQ艹u\19}q~5@tu ƆH 5t^_[Ã=5t^_[+55i5rO@PhǏ#g+55i5rO@Ph#LP Ph#8WV11Fh)#>kt!Zu忀ރlt puԉпɁu5tg8tbPhk$Gm=2u =2u@5tA52jPvW:5H 5@ujGW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh%W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th6"jD$P ] 5)i5rOC-D2+9tti-;)t RPh#jl$ U蝖\$D$Pk$t+,D$0hƑ#jShS\$:ŋCt:tBuM ,%Phˑ#jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?S蝢l$ ō,@)QPhԑ#0 h]%jQ芕 ݍ,PXWD$P赐݃FD$ ݋\$GHO WH EuݍCWPj$u/1M|t؁Ph, $Wx N1MM|FGHO WzH GHOl$  WVH|1GHO W2H ~T$KW衐D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@22(9t%5@2PV貇$=5~y\$t$1=5tEt*t t.<$u u/S0=5u WE;-5| $^_[]0 hjPhe#:USWVD$4\$,tl$0|$WUS ƃuk8=x5t555D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o5D$ 5$iD$ 9T$tcu tQ=5t 1=2uL$,uP9tPtu 2P 5u=5t^_[]Vt$59tP džƆ1z 5t^Ã=5t^#WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h-#W5t$ntpu5D$D$D$t 58D$t(1PPS IjS!A=5u|$ 15-5~6@ 5D$u}t!AH Et1jPƅt=u ED$u >u G t$Eu5t Dt111D$uD$5L$L$t$D$\$l$|$ 5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$5C$jU9 L$tc|$tNuJD$1rȋi4hQ1#jD$(Pl$D$D$L$D$u UD$\$l$t0~Ot)D$5y\$l$D$tUD$tMjPSx ?jVDžtjuSW =2u V| hŃ퀉0^_[]h1#A{ShN#6{Shd#+{USWVP1$1C11hp#~1it"gu$ڃjt puЉ̉( 5t yjPƅt,1t5)i5rO@Ph#4H$t#tH~1i0 tPh%11G^_[]Ã~1i4h5#蹊2HQP~G ;| Z %PRG ;| 2Z;|lht#yh#yV1=5ujt$ Ot1+^V1=5t. 5~$A51F:uI}^V=2tO=5tFD$t+ 5i5rOA1ɋ2u0VQh#R.^USWV=5u655~%=5Ft WN5l$5~"55HI}5tfiPƋ-5=5iPUV膶 ~ ;uKuU l$hnƋ=555i 1҉AJw)׉=5 5u=5tw5fdž=2151B|iP 5u=5tv^_[]SWV\$|$yƅtt.VSt$W\$<$D$ #^_['0 Ph#vUSWV|$ 5tW`W4~*155|5\5V:V~55l$t$t%t =2ttttk0hWjWjt uumul1VDqVh#%VptOh#%h}#uۉVjuV5@2^ztTWj{Wj{t*=2t!WjzWjzWjzu5^_[]0~ h|Phe#'uUSWVt$ l$|$1ۃ=5t/t*=2t!ttSV u5<2tEL$ji4DDt QP ^_[]WVD$t$ N 5=2u=22t=5jP=5~5>f@..@.^_WVt$ q5NJujVj 瀾tW5@2x<u%+5i5rO9D2t ijVt=tu  ρπtt=ttu ju VG 5u=5tr^_z0K hPhe#rSVD$L$ =2t1ۅ SPj> ^[Ët$1҅tހu1=5u25u) 5~5:tzt Iuh#~51@SWVt$$1@=5|$(1@$"$&Wh#bjvu h_#hD?%tjjvjv 1~ h#21@^tjs%;th=#hpt$jvh%1Wvh0#1Wvh5#WvhA#jvu h_#xh#kjvm~ t+u h_#GhE#:jv <u h_#hL#P#Rjvu h_#hX#7h]"v hf1#jvhW#jvu h_#h!%%;h]#kFp]hf1#P~tF1SwJh#.Sw 1> c#th#P uhm#hm$vhr#v}#'1#1###1#N9tQhQ1#jWWSxuF x%PhQ1#jVVjv S h#51^_[h:#h:#jvUSWV fD$ 5 5l$ 1D$U$u1!" $ &]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻NA&!$}D$##} u#$%)4$<$zT$tvӃuxu;Hx@u8/UD$PV{Ox D$pL$t 1D$tD$p1ɋ5955tH1 8t:tGt89=P2Z 9=P2~55L2WPV >?#<=5 V": fiDle cDhangD ged߉Vv2HQPPv2Q D$pL$t 55E;-51-5D$PĔ^_[]fUSWV<1Uj[D$hhh UPjb dm9u 苯9ÈP5j Uhd T5j cX5hO1#U h#<2,$Uh\5rt$T|$P|5\5}55t.fD$PVWVW(=P5 Àu@{=2n$h#5ttQu 5 5<$B=25=5(ȃu65|555$5uk=5u72HQPPBt2Q hd2tD$P5=5tg$$=P5u>h #~8&t1Ph#QPP[V$=2u2 P5t N=P5uEt$(Vh'# t8t$PBTPV$(5=2t =5tj&luD$P5u/jM=2tFh""rhd2Ss*1ɀ=2ˆQPi=2u=5t42(555_p$$#uSWVD$8t^5jP<`ƅx jVK 5u=5t&ex"1=2t=.2t.21G ^_[11=2t 21jLV3V:=2tt.2u2^_[ USWV|$(V11C=x5tCn1=2u4t0j52qjhd2q2P =<2t.te=2u\1Ƀ=5 5jPi1;tW1R=2uIu=2t7=2t.h+#pEVu%$uDV#^_[]Vt$5jVk^x1jP| 5u=5tWcj^Vh}#ct1Ã|$|D$pPmmft$ thH#act$t$辷 thH#BcWV|$ W@P説 tWPx^_hH# cSWV|$P29~b95؃PP tr H2 L2P2H2 5u=5t 'bP255L2>L2)P2 5u=5ta^_[hH#ObD$t L2) P2L2j hU#j![ D$ H2 L2H P2H 5H 5H5ËD$5H 5P 5u =5FaVt$5H2;t H2P蔻 FL2FP2F 5 5t^Ã=5t^`USWVP2<k5-L25H25t|F9uuH2PV耵  H2H2+ P2 5L2=P25tG90uC H2 L2H+HH x@WSUP 5L2=P2 5t^_[]Ã=5t^_[]`hH#i`D$5L2)P2 5u =5_V5P2T2x'|V5L2Po N555L2P255L2^V5P2+55sP2)55L2^ËD$ L2) P2 P2L2+D$ȣ5USWV(L$@D$D$@t-΍i11P}wDGÉ,$Eu1ۋD$P3 5u=5t^Y58tl.3DPuu5WƅtӁSVZV脳  5u=5tX?ӁSRtZUhՒ#iO11F1Ӏ0ҍƒ=rAuمPL1rD$r1@xDw@@uDx@D1 uD$r1@uDw@uDx@D1u$r1@uw@ux@L$T$PQRhŒ#i52oe 21Ath4#d1@ ^_[]Whے##X芼0[ PWh#XWh#WUSWV(f11CD$hF#AR t!HuStau׉\$σʃŻ&C9t;[ uVhV#W1N5ɉL$|$xtD$ h"Q虭te\$ 1 waO11ہ̉ځ Љ ۉӊ€A ru1G11Tt$@1ۄnD$ xjWhjZ9ىƉߋD$ \$ D$ |$&C L$QP`CsP\$3h#f\$ utt$|$ t$|$t$1N11 uh"f+D$@ jPWt$ZƉRPh#qf 1 Ph3%YfgD$x @ #t$C\$SP`|$D$ tMt L$L$|$t D$D$|$FSP~unjNX5]uT$tT$|$T$|$1I1Ѹ1 uhړ#e FjPWRXRPhk$ce 52a 21Ath#`1@e^_[]t$hj#oTh3"eT̸0 Ph#KTt$h}#=T褸0u Ph##TfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WV觠 t9t9u1u^_Vh:#SVhO#tSL$A1@҃Ѓ wAu1SWV\$1tZSptMPhp%Ss 1Ft5Wh0#Ss t"uhF>"S t Ѓ s^_[S(1ɅfVt$ |$F5(2Ɓ62u2j5 5u 2 =2=2u't#j'tjt22<u=2u 2=2u25=2ut 8-u2(62u 726272uހ=25u:u655H 55jP#555 5t/t_9tZA55Qt 55ȣ558t 5Ax@u5 5^{h#QUSWVt$5H 5-t+C11C<-t1Eu{-1Eb USWV1\$@<uPƋtPEu1ۉ]h55=5555^_[]SWVP\$t$t2uh"%Vޤ1C$"hX#^Z4%(02u*626#42RQPhp#^H#uȡ2HQPPtZ2Q (02t"62}#tF>"QPhw#h^ u.$(02tPVtu6#VPh#rM<$u#52t(852uƁ62u숟62h#1 _2t$]2t(852uƆ62u ^2@uă^_[V(D$ T$429tu6#RPh#FLt#52t(852uƆ62u숁62^WVt$ ~t)~tP uv ^_USWV jA 5t_y 8-uUD$$515P  5y8-@P1F Pơ5)55=5~-5Ft7! 51Nࡴ51ɋu5 5=5[J1F55P)ƅ599St5 55lj4$މt$\$)1*C/559rL$ 9v!\$ۋ4$ P; 5w4$ 9vQ9w5 5u=5t[IWv1 ^_[]h˕#Ih#Ihf#Ihx#ISWVT$ 5tstm8u'1z:trrD8uAÀ~:u"9u 5Q5 tf 51ɉ 5D55>1t6?-u1t+O^5-uta551^_[Ph=#HPhP#H|$u1PjPPge5jw58t PI 5u=5tG1ËD$Ѓ w#j jPR u55ËL$~ND$tH  5=5u 555h5h5Qpph#GUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11GjhO1#h#Y J|$:uUD$8@?jPh#Y ^jUh#Y 1|$D$0)@<Ph #hd2V jh#f1?\$D$01@11T$4*l$PhQ1#j UVhUh6#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph#K1L$0L$4@Uj EfVD$ <21qqA1Ʌ 50PQ<2p ]t u 1%<2<2@j* <2 u^qqh,#EPD$5/$aQXUSWV'ơ<2@tu'tƃ <2 x,$@D$t.$xZ$18uWPߚtG4&uD$tKjD$p*t6NjpVaWPV4 E$ht<2@^_[]USWV<2@|$u <2A1p811+ǃu<Hs C)uj X@Åt"j jtMHXE pXƉōGs1Gt,u|$uq<2@@|$Fu6|$uD<2@ <2Ap8 u踭|$u<2@^_[]jjX <2ASWVƻt u j cpxʡ<2@^_[USWV<2kE1͋ <2x t*5,PqN<2@ C1Ƀ8Qs s j@<2HOH O oKy K9t?U1CSp< &Sh&P= <2HO@ G e<2!^_[]WV@t$P <2A uyW^ wWh.#4&ha#j"Q WhF#j"PQW^uL$Lx4&h#Vho#jPQWUSWV<2@1u 1=2tMtݡ<2@xuUj Y@j@ÉGpj,aC+t<2@tj(pƉ^_[]h^#<2t$p0h#?USWV<2@$ u<2@$EŃCߡ<2@$X&$ <2APUj 6á<21Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjBljF j0G5jGt<2xJjG B u0<2x,u%@&t@/@&uhq#jÀ=2tjjj` <2H0+H8O U <2p0j*@ <2QPI H pGu5<2~ h4h%v:m|$F<2xujD$ <2Hu <2H L$ qx0j\@<2HKH K {@;u.<2x }<2x|$ T@0GjG <2@t(HS u <2@<2x\$\$jy <2HK @0Cku<2x ux,uh4h%p蔑j@@21ɉH H <2Q0PCAHrAAtejC9t jW\G @:<2@ u<2@$EŃ!ߡ<2@E<$t!t;tj <XÉ{؃^_[]/ uS\$|$<2X0jx@ <2QPI H X t\$|$D$C <2APsVL <2jj 5jj,jj#jj jjh4h%jjjjWV<2x$G Hs<2jpW$ uq<2p(x,u~ <2At8 u @A8 @tHA~րxru\tuՀhƗ#<2p0+p8j@ <2QPI H pG .P"t<2@F <2t1^_jjVt$&9u^jVVL$1&tA1B1t A&u^uVt$j@ <2QPI H p^USWV |$$tD$ D$$D$l$E1$<2xc <2x0$t $j(ƃF <2QVI N ~ut. <2I&tAt=t A&u1c<2H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 <2A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j<2 $+H8N~L$NL$$N @0FEPqj/v5luG42 <2+A8FF<2@4 ^_[]jjjjh#L$1&tAt=t A&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;X5}X;T5~PT5I;-u{tBuG<2x0+x8j@ <2QPI H xF^_[F h#lUSWV|$42D$̛=u ?vl$$5L2P25G$|$ t u 菛 t19uDp $ tC9u?,$ u42<2HH }AMt9t u>u:<$ t=uY$)jWPX |$l$$uS\uN5H 5\FÚ u%5H 5 F42#á5H 5ƈF tq=v42W=t hp& u42<2HH 5H 5>=L2)FV<2x42+D$^_[]USWV$$1҉T$ T$$D$(542<2r0=&t1$|$ fw|$1/fFn D$j8fNL2 P2 5=&u ƒ=5‹nD>  $&=&u f|>z 542Bס<2=&Xf|>LCD>fT$ 豘T!uhЃo茘0N,s05,/L>=&fu 5Bn׍MN|$ @01fD T.fTT.fTT.fTD&fD1AL$!(ljƒ(M 5FD 5BvNO|$?@81ɃfD T7fTD&DfDfD>  = 5\G'T$ t$>Hff 5T$ Bf|>D>u6t$ӈ nMn 5}f|>  5BFfL D$$D$f|>tD>t 5Bf|>u D>v 5BW 5B*Ã{t & 5}E+=L2 5E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $肇 nMnD.=&u 5 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD&fD 5T$ B1AL$ I) NjFfL 5B) 42<2@8xt 5 5$8W Nf|F\=`4" $"}f|  5T$ BFu6$ȅ Ft$HFu蘖D$$D$ Poſ1۹$&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD&fDu6t $资 FHF 5B}= t]\t 'u t =u 42<21Ƀxɉ 5$6 5T$ 'uF|& 5F$Ҕ&$< u 5T$ BT$ 5 c蒔,t$@  42<2xD5?&L$ .3DAD$D$ |$}~&f|t 5 5B\& u 5BNf|t 5B1@D$ 5 5B݉ý {"XŃ', D$0$Z nt$T$ Mn 5B1@D$t$C5$4#U 蔏` Ń< ?\uj\ 0 \$1 HЃ w&Hw ÃHÃéOu M 5vNO|$}@81BfD T7fTT7fTT7fTD&fD荑L$ uk%=I =5 D$ wF 5P?ˀ 5@ww 5 x?ɀtw 5@ 5W?ˀul 5GXT$ W 5x ?ʀtw 5E 5O?ʀ 5Gw7 5x?ʀtw 5E 5O ?ʀtw 5G 5A?ʀtw 5A 5H?ˀ)*5 5D$D$$5 1z&t.5H 5LjGq &u\KЃ w45H 5}LjG; ÃЃ D$ u t 5׃Z 5H 5)=Gt/ up}tk5J 5#@ǽh#tE%t@Ń:bD$D$$&a¸U1#,W9u袍1|$Nf|uf|t Ms@ L29T$ vNK؃|$ؾ@11fT T3fTT3|3|t3ft1BfTft|&fq fq ƋT$ 5H 5~5H 5 袉ËFD\$D$$&2`Q1&)G 5x?ʀtw 5E 5O?ʀtw 5G 5A ?ʀtw 5A 5H?ʀtw 5@ 5A?ˀa2 5AD$ ??5H 5~2G:5H 5~$_1cݿ:B ˿ˆB1=&nD=&G=&tf|cf|.35H 5Z5L2Gf|uNT$ ؃t 4$t$:ŀ>ts4$flT$ )B<2L$H,L$H $衾<2pM tΉ$x Nu<2xĨ^_[]1HE;X5} ;T5~T5>uxkjy1$&tu>tyu6EBE9E0E"EEEA }<2h$ Ή$w Nu=tuS$#$#42 <2A0$"#u$#b$P#V$5#J$#>$#2V <2xt@@ ^Ãx t#5$@)<2@ @8 42H05H 5~5H 50sƃ~0:=F $t& t=uG럃F~t\u^׃ 42@42 <2A0yt5 K5$S(*;|u0d|<2@=t*蒆4$D$D$&Kuۡ<2@1v u42<2HH @1@Q&<2@-<2@<2@&tQ;ub<2@ 軅<2@蠅<2@<2@ o<2@u\u? u642<2@81Ƀxɉ 5P& jjh@" 颁Vȋ <2y8~0 5Q5謹@ <2Q8rq8^USWV\ӉΡ<2@D$ 1,$|5D$&+L2D$$UP5$~Sʼn$S5L2PW l$|$tD$$|5 5u=5tw42D$-L2P25<2x t*5PL%<2@ hǃ[~!\u9Wǃ[C tJ$Q u"42<2HH s`un=ub\tX`tS42 <2QQ NDt""u$5H 5~E\E \@ŋ 5A5ȷ@5H 5襷EL2@|$t~P贴t$jPU D$pŋȅut$ j艴E<2xtH@1D$42D$jNǡ42D$Kt5 <2At$ D$AEx<2@t$ Ex P29ًl$脵 P29~=L25t1SUWU )55Up $ 5t\$=5\$t  <2T$ Q|5Nf|u%Du 5Q5@Vt$+t$ 5Q5ܵ@~.F5B5ȅ踵AJ։ȃՃ\^_[]á<2L$H0hl#WF<$t 4$o /<2@D$|5jP-jj#jjVtQao N^V <2O1#ytA55t7t u(5`5542P55#^USWVt$,|$0l$UDz5P2̱1BW;L2u(Va2G59w& 5WVSR U覲^_[]Áw: t9v$P5 5h tã 5$5랾#뤾Ϙ#USWVT$L$ -|5蚂Ɗ.25D$1|$0<2D$|$ljW<tJD$<2.2VQ-|5D$55O1#jU;\$t$l$=|51F55D$0<2$V\$S zVh&P <2A |$t|$t=2u #@݅u:T$1rIJ$JB .2VVRM -L2=<2D$.2t$OD$|5D$5؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 51t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 5tu(Mxju PQ.Ex P8 Uk uF^_[]USWVl$ t$\$|$t|h@VSH VSHDžt9u 9t S 9u95H2}5H2^_[]Åyu0荂 PVSh#9W WVSh##USWVt$ |$\$l$j茭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!j8@ 5$5M|$];X5};T5~T5Eu9] u 5tX9X55t-pt 9^t6SLF9t Sx  51tF9Yt? 5tHt 9Y jjS  PkD$($@t 9XjS 1x55  b5 T59|AQjSQ  ǃt;=H2~=H2x jjW+  j詫$JBXxp 5|$u=5tu5t$(WUN mC3s1O ntuK55jS  DžDr8t r8ujjSm  Džr0 PShL#I\$t 2x2|$t 2x2^_[]j [ PShI#or0 51tT$9Qt uÉVt$55j V u 5|Qj V u8FPj V u$j j V ujj Vs t;H2~H2^hS#V WV|$ t;G;5|.GPSƋG9tVPWwsw^_WV L2 A L21F |71FPWW y w;H2~H2Pgfff  5^_USWV$$$~5 8k$&n  5t9i V 5tQt 9j b Y<(O8=2tNnjU:ƍD$PVR#D$ =nhh]n$SUoƅtjV?!SjV/ $/nhh nhh U ƅV;5H2~5H2|'u" 29uu-jjW 9t1jPWV 5uQ=5tH A1jPWUy v n0{ PWVPW 5t Ā^_[]Ã=5tĀ^_[] hh j V{ PWUh# in0:{ PWhƙ# j1F55@nV0S PUh^# $n8V n85nj0 PUh# USWVP@xa|$\$;H2~H2oU&= VUS 1jSS t!t$r$^_[]h\#4$R1EUjjUjyjUUojUjdjSj YjVwt$ g SkVD$555PV]5V}b  5t^Ã=5t^1=5SWV55t4|$t^tCx PjV6u^_[SWV|$ H29|ȋt$|9}9| H29tV3jjVW 9u^_[#lW Sx PVh:#WV5 |;X5| p5t$ Pj Vh y2k8t k8u>5 jjV4 ;H2~=H29t Vu^_Vj 苣tL$ T$5 50 5PH^á 5tT$ 59Pt uP`  USWV$|$<\$81D$ $D$1F54<5!3h{#WS2 !1tbW%Vq tV蔽1 1^Vt$t)V1u!VhQ1#j h$5蘆$5כ#^WVt$ |$t FHN V& H 1GWPhk$V ?t uVh""  FHN V H G@u^_USWVl$ \$ut&h%uoU>hH$WRUh#WhF#WTth<"WTt D$1p@|MD$K}h%WjTt8D$D$hכ# j521CKD$D$u}h# v11 t=t8<05u.u hܛ#v VaPh4%  GF@uh""A F@uu=05tk1uu莩ND$E11P@É|$t<05tW405hi#Ah#<05t405 h#{SfPh@# Eluh#52 Cu|$tE1F-5D$t P贘1<05D$t405U D$05t jS< 5u=5t2Et h""11<05t:058u.u h#aVLPh4%   GF@uh""/F@ut h""1<05t?058t3h#405VPh@#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=05t61B=5tbu^1Ƀ~7t@tuH1=24 05t1Ҁ9ƒ (u1=2B1ɉσu1B451t)9t`tbփub1^։PjS] $u=2d1@ָ PSZt^u45u jS蚸1D$ D$D$$K?r {] 1@ jPjJ ^_[À=2u=5u =2=21@V505>t8t6R 05r05 5t^Ã=5t^SWVt$u 051ۃÿ05t6058t+5SP 5u=5t45=05ru^_[,^_[V1=05u#051A:t2>u 05r^WV|$ [005u"t$=5tg=t5u^5WuS =85tӃ<05t>058t2t-x5x5=2tu=5uu[0^_WV|$t$ 45uWVj45<rjVnXuƆ45^_á5=05t1Åt8uUSWVt51Gx5Qu952u V^_52t$WVt$ Nfu5FNtF t0fu^~5 ?NQPޏF N)N5v衏F FF 5u=5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'V)t~th#V<k>t!hp&V輫1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVhp&Qj'V't)19<>^_hP2ohd2bUSWVD$~@|$l$1SWU" t T8tF r)~1H^_[]ËD$)D$5\2tPI 1\2T2 5u =5>PD$L$ T$$RQP XVPt$t$V tt$ P4$aI ^h#QPD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+(5+5Pqq h$#jh5Yu5SWVP5&C PVw u,$$wCGσCGCuhd5VhE#8 u*$ X5X5\5`5^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUvv t61^_[]ËD$t8SV qƋ\5`u`5$AG \5P#tI#$#tQ%`5㟉\5t$D$$# ^[WV<5|51$|$PW-t $D$PL$LT$H=|5PQR 5|5$<^_USWVL$T$tHtA|$9t91&Írjt/9t+1&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U VcƋ $A$~ C@ $Q$f=t @UPjWVp ^_[]SVhW#WV<5|55$|$jWu"D$LL$H=|55PQ5|5$5<^_USWVD$ èu|$=^2uÍD$PQW Ƌ@5Nt$݁ uF @SPуF`u vD F~tuF1Ɏ! s%t É^~5t5u5t jK~ 5uk=5tb[r2jXxL$H @ $  $#`uWC `u WC fy^_[]vv ho# D$@!|$$~L$( t 9-uD$@-=5u0@=5tc@=5tf@=2ti@=2tl@=P5tp@=2ts@jPh#,WVt$|$ 5tw蝅VP? 5t^_Ã=5t^_CWVt$ t|$Wv 6u^_USWVP\$5jƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR賄SP}j=SZS苄UPu< ؉G@582582hX2P% ~ F1gjt$D5uQG L$<=u55H52UjS $81F FF5D5~555 5u=5tw^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ 5t8Q12<08uF=u =ut j=RF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVl51tr:1҃Љu5r׍P节ƻl5Nj+t7Mȃu%EttUЃuEmŃ5r^_[]SWVl5>tLGu% uw ? Gu#W> @tw詁Gg;u5r^_[2SWV|$tfh#WWO9uWhk$V't*tUj'Wt8)WPh# h# Gh#Wh=%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh$tUh$>=uD2HQP~ j( P 2j)n~=uGuth#EU2HQPP2Q ^_[]USWVP5u 5 h5T$ t$\$l51<$?tIOt !T$ ttуt݋ 59|QPYT$(5% 5)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP]"I1>?f u%PVO1u%#L$1PV調1t1Ʌȃ|^_1@Ow$p&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$^ t$D 19{USWVӉϋu05fx@$&$PW/1ۅD$PVr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW`1ۅD$PVH$L$$t$<|$@11$;D$D9t$ aZ$PW1ۅBD$PVѼ,$3D$ $3L$ $$3L$3D$1 dVW.1ۅTVWu.1ۅfVWe.VWQ.1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]&8Q9-u1tQyt8ytBÄth#QY-&t1h) jjh&Qh) jjh&h) jj h&RSWËD$L$  )VL$D$ 2)u AJ)^USWVP:j PV~k lj:8t":ځ8"u 11E9s:$9t( .3@DQ@uuN9t ڃ^_[]Vh#Vh#USWV׉)Zt 9Fup  ^^9uM1PP~ōP rPU~ LH;NuSc/ #~^_[]ÐUSWVt$(hO1#jE D$,^H $x?-Ok-u)sstdluu~xwGWGÅu".3DHt'1Ʌ Svكh#h.3DH\ƃ~ƀtVtVKVhϞ#jރ $h7&S4*1Ʌt:SEu+$891V52V|-$K$8ʉT$h%W)1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.|%|" $4Pho% 1@D$l$t jW+7j D$PU ljӋD$9t-ف8ur1u 68tQ"xO1#UPh/# 1@D$\$ $4h #1@D$F \$ t$|Phi#jg5PPPPhh#522jDWVPΉj WQ 9u=у|=}^_Vh#jhQhF#j52jWV@5555HK=>t)j=WthW>uPhQ1#j@VWjVh># Vh2hb" #VWh6# U#tQ%VQh# j,hC#hK#q VWh#bL^_L=5t 155?<25155595tj=5u2P22d22tP* 2Vjҵ155><25595X2t`2@8@u jR5jDt5uƀt5@u 5u=5t^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$&$&Vw vVw d_ t"Vst Vw?w,N@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u&E$$&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t*& Ã|$& USWVPu }45852f`|j%v\m O1@ 0<5D$,@5|$@t$(q%v>%L$ ht#V<*u C h4#S̄1N .u{*u{ 1HD$Ch4#S蘄1HD$  t$CD$'C`L$&~QF0 $&. D$׋L$ jj D$tfL$tjWt$QPhX5TFu$&<5l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhX5.<5L$ Q0A|$<5H <5T$ l$=85uM|$L$ jL D$tbL$l$tf|$ L$D$$X5bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$X5L$\$L$$X8G<50<5E ƋL$ cjl |$D$VPt$w<5<5<5<51  <5 <5Wt$*|$$X5 \$$5T5t P$" VP T5҉D$xF\$wZ$H&a=&t1"u@"*\\t#'u0'btnv fre\qFuZ.3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V5D5T$t P T$D5H5t P T$15H55L5Љ\$H\tF5L5X])P0tXM\$u/^t-u#F5L5벸^tic\$>T$ j5L5F5L5{ .31:DYt 7GuF5L5\$DF5L5ȋ\$+1L$ jlD$t1L$t5WQg5L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hX5 PRQt$QP  55FP~ H5 VjxP% 7sH5T$t t$L$ t PVRQhD5莁MT$L$ t1PRQhD5o.VWhX51PQ*t$P PQhD5? tD5P5T$z \trB<]*<0tu$& ?$d&."'#Eu uSh# 45 4$.3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#l45\),ҋ4$u|$ uWh֠#<45 ^_[]WVP<50tp<5$1ɉQPV[R Nj .3g#DQt$c#r& <5+ @5VQP 451^_SVˡP5H P5 u:2Prp~r0 P{2Q 밅uP5)2HQPPD2Q^[SWVP<50t"<5<'t<"u1B^_[11f"1ɉQPVg  lj+t:<-t6 .3DAu)<5+@5VPh.# 45 $ڃ^_[SWVӉQǃArVh#A45GPVhX5 D$U5V5ƇW5^_[USWVP׉1PPPr ,>U6@PUQV x$tG9tC<5+@5VPhB#調<5+@5VPh7#L 45$^_[]WV9t"΀:t9<5+@59t\VPhB#Z<5+@5Phء#/D8!8"uD=<5+=@5j"- PVWh#RPh# 45^_USWV\$$8l$}hVE j jh&U<ƅu!hVE j jh&U<ƅH h]#uFj PV4 8u$8u؃^_[Vhk$j>WVh1#jUSWV f65 6ƒ 65 6€ш 65x 655h2=#wt h#_t8ƿ@&#PVtG uVh#j' $$1ɉḩ#SUR P6$&5kj j5<<|3 ƃu8"555v <<f5Wj j5<<3 ƃ _%5j j5<<2 ƃu8"G555551A5<<5<<h~"Vtch#VK55B55/5#8"tD55  9u5rCjhH#5<<h-##Vh#5<<h# 5<<h#ju hf# 5t 1ҁ‰56փ955u<95u2695u#69 2t 255=5u\1ɅQdh# !3=5t)ͅt=5ut 1jhh5P4 $yh5hk$j设=5u1D$(Pt$wu#D$0=u 551N1$h& $$h">"t$h#Qh@%hV#VPFth9"P $Phk$~55 $=5=5p5B=h^"t4't1@$$Phmdt$ hh#h|tWaWh# $=5u 5 =5u 5 4$h5 T5 $$1 uWhPh5 15555tjVh5 h5\ $RhS5h5VW0 55VWF5 WGl$t$D$ 1ɉHHD$UD$ Pjɓ ADžy#8#BjVyx߉DžV:Rx9ujUju 1|$nh^"$P$<hjh5 ^ Wnt $h#!h\'3p'3H '3~'3H '38h'3^ljt9 t4'3H '3~'3H '3h'3ƒ߃NyjUja h~"Ԣ15\'3h5VW4. 55VWj3 h5dtd($Phk$u$PA1@PjUjϑ GP)Phj#V#tǍ$PWho%VUD$uh E"Z$PbAQ$jPhR#QQfƃu WR V=WVθ#L&PVt uVh#j諸G 55G5G5O16t^_^_WV΃=6 6t>5t49t0##9t~"9t~"QPh#/ 5566^_SWVX#4&0&VSh_#h'3I!/"ujVPjj"PQ thª#p/1Q1&$ =uh} jj"t$ ?1$4_SF"u4$3 1@^WVκ u1H3 r1P^_V΀=5u6=5t񺗁 t41t)Ph50h5hedAV xk^Ã=5u񺗁 Jt=5t75t.h5hedAVp th5hrdAVY t=5ujh#jZh#jUSWVPύAPjh±#h\'3Gw4&h#Ph#h\'3X \'3w(h#VB w,h#V1 w0h#V  w8h#V w4h#V W4O<W8#9tQh#h#h\'3O1#OHtQPh%#h\'3O1#OJtQPh/#h\'3O1#OLtQPh9#h\'3kO1#ONtQPhC#h\'3JO1#OPtQPhM#h\'3*O1#OTtQPhV#h\'3 <$f$1۽a\'3Pjjh#wVh_#\'3PwVhg#\'3PGtm*L$,jhb#)*L$0F59‰4$sRPh#) V`>ÈJ9|6{u;[tVPWhݩ#)D$(ffL$(D$ 1ۉa)D$u!)tPt$h!#M)L$4 <)ǘ΋I<9vt$hN#$)$N<.”T$9vt$ht#($D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#( D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( 55t$(L$QhV[(  D$ 1h#VtG<$hB#VrH4(1>tYj:WbD$AL$\$hB#S*H,1tD$h&Wtkh $Wh#W\D$Ph6#WW D$q;5ef5ujh&l$!U胬 l$&1tUP QF&r܉1hD$ Pj <$Wh#&D$ D$t$ <$}trÉD$hi"Uj t:ht"UX t/hy"UF t$UWh#+& F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh#%D$ D$T5FʼnD$uf55l$u D$l$l$h$Wh<%Whb#Wh#Wh#Wx h#Wbh$}"WLTh#W6h#W hͳ#W Uh"Wkhѳ#Wh۳#Wh#Wh#W<w ~W|$Wh## T1<$P5jD$<$rt$Whֲ## D$f5@<$WhE##5f5jUh5jUh5 <$t$ht$0V# J21jD$ Pj< D$ 5뜉1jD$ Pj D$$5q1jD$ Pj uuD$05J1jD$ Pj uND$(5#1jD$ Pj u'D$451jD$ Pj^ tt$W|$Who#P"D$,51hD$ Pj uD$f@51hD$ Pj uD$fB5a1hD$ Pj ^D$fD511hD$ Pj .D$fF51jD$ Pjc D$H51jD$ Pj8 D$L5; 5sr"jW|$WhB#W|$Wh"#΍L$$ t$5|$6L$$ L$5t$6rhB#V Al$}}&1ۋ>t.W0Lt t uPUW Á<&r D$.3MDHu D$"91hD$ Pj t4$h#D$ \$"r)Ut$h{# h#D$1ۋD$5ND$5WX4(t$|t%hB#V? L$1Ҁ<tʉT$D$< w'<$$&L$ L$5<$tL$$L$ L$5|$6cL$$t D$|$6L$516FL$<$C fF|$6L$! L$5|$6t8L$$ D$|$6tL$511A<$D$ h51D$ ȁ(^_[]4$hc#D$ WVPθWEV5|5f5h5 f5=5u=5u#$}h5hgdV 1h5hfdV y8t 8uv$=5u(PhmdVn xX52hq} k1=5u$h5hgdV2 y ڭ#1G^_ùɭ#h#e 뙃=2tt$ t$ t$ z 11HVD$ t$=5thPh5 ^D$L$01Vt,uVh#-t"uVh2#Vhk$Vh#Vh#^h6hmd52& USWV8 $RPh h5Q_6 5v|Pt$hJ# lj D$T$1D$ XƉ 11 ‹l$$6 6595hWD$P $;D$O1#=5t =}t=}uЉD$$r#=5tȋ 5=WEVuT$tf95rD$Pftt=5%4$t$Uh#s D$t=VEW=5$t=VEW4$t$UVh{#&=5|4$t$UVh#=5$D$PSt$Ut$Vh#=5u $h5S\'3V 55SVI SGSt$VhVWݾ 5D$ L$D$11t4$h## 8^_[]USWV T$ $11F1Ń=5|Uh# QPWD$Pt$_9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=5tUPh#, Ɖ ^_[]Ã=5tUh#=5tUhİ#ċL$T$tPh511@Ph/#ئt"j QPv u8"t1H51Yh?#jʟPh^#菦t"j QP- u8"t1H51Yhn#j聟SWV։ϋ\$+5tItEu51tGtB5$669w15 1tth5QA1@^_[Vh#j趞L$1=5T$ PG1ɅɉWV6~( WRPh5Q| 69u ^_h8#uQVh^#jlPQVh#j-USWVPӉ΋l$|$uj WV Eu["9"t:M";L$ w,O>t" t9t.3DJ@t1^_[]WV1t>΀9t7hB#V賙<t#ƍFhB#P51|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Whٴ#Whc#1۹6؃^_[]ËL$9/up05D$\$A/jPU u$D$ $5D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#)6!Whc#61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhm#7D$$Th#Sut]"&WPWS誌 '> uۀ$U-$T14&D$XPW tpC"uD$TPh#c$T$끹ӻ#&j" $eFMu SQЃ {Sh#h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h#~/$PQh #R~$ $u ~ˍ|$@WV?9t"b&J~PH k$H&1OJH w@$p& LY&B(D$ D$$l$ CtGtngtbcB8D$D$l$cLY&ɋB(D$(D$,l$(BLY&ɋB(D$8D$<l$8LY&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Phݼ#h#~USWV|$t$t$h="V Gw4@&h]"PhD"V GPShO"VGPSh["VVjjh &袡GXtVjj hh"艡GXtVjjhs"pGXtVjjhx"WVj w(h"VK w,h"V: w0h"V) w8h"V w4hх"V w$#a0QSh"$S<.Ǡ!w4&h"Ph"S  w$&5h"_<t$uM55hO1#RPQh""555WRPQhȆ"Sm7hO1#h"SX "55RPQhچ"S4M8tDƔF1Ph"S F;Eu 1<1A71Au01<  $jj@PD$P9D$ Phk$C9u<$u4d'3H d'3~\'3H \'3 h\'3j o1^_[]h#j膂fUSWV $ $ D$-@1666666$666t$ h#US; c~!P$4& 6˃PtdT]=<<?1AJ5<<66뒹 .<<6hO1#n 6b 6D$6T$:@=6l<<D$ Tnt uBxou D$ 1Ɉ 6h%Vt6hO1#`ء<<$j:W#C-6tWuߵtm6S c$ \W6t6t 6!39$ 1ɉL$tVh$P返 tj/U謳u Uhf"hc5%h$ UxVOnDžuVmDž7h$PO ƋohZ#Wt(h]"W说th#W蝴pV 1QQ$ 4PU7L$9C9$ $ 9tUllj?,$u1QhD$PQV h6hzd@PI tq$ PhedAW/ WX|$ W{D8$9",$&uW{X6,$h h 56P Ġ ^_[]hM#j}$Phk$j~Vh#j}hL;"h9"ʍD$ Phc# D$ Pht#j}D$ Ph#롍D$ Ph#땍L$ Q4&h#USWV։ϋl$j V葘 U膘 CCCOK G^_[]h&Ph#h'3jbUSWVP׉΋tASyWy4$4(VS Wh*$Vt$ Pg W É^_[]USWV|$1_hZ#S˱t$h]"S蹱th#S觱u\6toU3英t[u=6t .=6t%6toU3Tt [u^_[]USWV$D$|$6O1#tW3 t CÅush$t$ uD$+/%D$ 6t L$ mt L$ ^$D$ D$h $$ t$hA+%hV$0|$D$4$L$h%Q 1G@΍K9|,SP Ŋt><-u(GD$tj=Vt>FD$ GDJ#th%D$Pu|$1F1B,$֋$$$,$D6tPO1#tX"P$h# xF1Ë$4h4%C9uj St2ƅ|$t t$該 4$螲 tA710h#bb|$t t$t 4$i ^_[]ÍD$jPVd$ x!L$ȃtuuh[#a묁tlPZ PUhe" 끉 6utD$P$uW$P$u9$|hWVN t Ƅ|D$PV91ۋD$ !=`= بtLV d0h$P Džu6h6hk$1 Vh$P蓦 DžD$PW[8Vho#Wh~#ue^_[]Ë$3D$($3L$$ u6Vhh6 t9Ǎ$PW7x#$= uVhƿ#{Vh#pWh#eUEM JR蜫tHPQh# t$t$h#hh#6#6]á@$6tjЃj WV001Gj0h&WK =D$6jj<0^_SWV01GW1WS jSʶ0^_[USWV1H$6L$6H$6P$6T$6P$61@D$ $1[4([DžW$ t7h$P詇 Ɖl$Pŋ$ tUt$h!#$ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQU t,ƍD$Phzd@V聝 t$VLSan .3‰D$H9rHDQtD$=P$6t*wt$SVb u D$<tQ?1Gj S蒌 GL$G 1ɉO GOT$6G8=T$6X$6\$w tUvZtt6j踌 U- Ft$ F t$ FD$FGF0wVh3#h'3 rUh#d_$ }L$ AL$ 15P$6tyvh#L~ twh4%5?j G6Í$Phk$X؁^_[]h#h#܋X$6Ћ$ t9‹-P$6҉T$։鋔$ t$ t $9|ȉ$mNu\$P$6t 9Ct,PhE#*$P:u$ȃt1{ $ t#Qw wwhT#$ȃt*t&t!Pw wwhm#h'3< OtHOKtL$6G8=L$6 t$wk w` WW C\$6H \$6{ t t X$6 X$6I X$6;D$\$9P$6MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$P|\$tqH$6c8O1#t $h#Ph#h'35H$6.>""tH#Pv vvh#h'3|6@\$SWV։ϋY Wss ss҃ \$6t~j *Wss ssԅuA \$6^_[ÐWV1t$|$ ɉ @4uDȉXȉX\ȉ\ȉ]D=DD PQ40C40<8C<8D@CD@LHCLHTPiCTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40B40<8B<8D@BD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7BVw wBV FwwAVFwwAVF^_USWV\$l$EffEffCEffCEffCu uAS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu@SCuu@SCu$u @S$C EDȉCDu,u(y@S,C(E@ȉC@u4u0]@S4C0EHȉCHuFT~U uD$FX$VhȉD$FXȉ$Vhʃ$~#,1ًˉ\@;$|ꁻ\TL$~1ȉE9|P$1 GfPf F@9|] 1ҋ\Tˉ\T1,Yff,XCuB uָ hPQO ȉ^_[]fVL$11wʉ^USWV$ $tl$;LABLhSU tD$f@1ɺ,$uwщfPʅtL$SʉQS ʉQ SffQ@f;CuUfҸtP=r fAf‹ $D'<u|$1^_[]USWVM ]ED$ \$#t!؃ut$VqLT$}R_Ƹ9rGhjPڢ LABLGˉ_ ffGGVt$P y uuO;12wȉfOe^_[]SWVt$|$VW"6pp Ctpp 8uC 1K1 tCuCss막RQtCtpp \8u%C 1K1 t$Cuss5CH P^_[SWV|$\$t$t$U5ƉX xXxSW=5HNp^_[USWV$C@C0 C4uEs${(P&6P!Ӊ! ݋$tωQPWV#)׉s${(C %6i4PssJ+ t)k$C(=0&6CK%6tbUQP %6~E1ɋpʉTffT=%6ufDft=(&6tf9|@ K$S()‰K$1ЉS(YC,m;H=(&6t f=(&619rVPD$PI =%6ufD$C8SS=%6u=%6u=(&6ufD$$AI%6tbUQP ǣ%6@$A,)VL$QPnI G h 5%65,%6QI 5%65,%6=(&6t,%6PP5,%60%6u$1;C$C(@C؁^_[]Ph#ʦUSWV Ρ%6X4Y AI%6tbSQP ţ%6~,=P&6tiF(1~$V,9l$MDу=(&6 $T$fn,A=(&6n,fn,F(~$|9}}Uo1>dh#VŋFN%6tbSQP %6x P&6~,=(&6tffOfGG@ Չn,~$N()ǃ~$N(=P&69<$D$hP-P&6>N,ș)N,)n$F(teh#V$FN%6tbSQP %6HT$<L=(&6tAf=(&6t4f.<$ ^_[]$6P&6F,)F$N($fOt@ $6븋D$L$t$ QPQPUSWV$$$ $$$(h$SV\1j +D$SVWUhP@؃r_L&695H&6rPSV Pt7=(&6tf%"=@t_-#WQh8%d Wh3#T^_[]USWVP|$\$s s@=(&6tf9uR &6t=$6t=&6tj:D$1PPPs sQs s6Od$63C `$63K u 2&=(&6tf%"=@t_-#QhB#胣s s/)SUhP#p $6u =&6t:yj phg#$6th#-=$6uh}#u=&6(&6t7t;f5$6D$ &6jh<#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=(&6tf=(&6tGf"@t_-#Ph#/SVz.=$6t)1=&6L L h#h#{$p$l tRQf@ d$6`$6 1VW 2L$@D$DD$ t$|$ &6pt95(&6tʋ &65(&6T$Htt tɉL$LL$QPh#=$6uh#5152PPPjd$6`$6  52RPjjt:%6=$6h#D$L$ d$6`$65d$6=`$6 tYjj=&6H(&6tt,fI=(&6tftfI=(&6tfIfHVW51d$6`$69$6t-j  d$6`$6 djjQP d$6`$6 AQP=(&6tf%=@5d$65`$68,$t$R=L&6H&6 t# Fjj WSJ99ݹÉrFND$P9|$P$d닔$hjj RS9 )ˀ0^N9wh#訞h#Jtf5d$6`$6152WWWjd$6`$6 CRP52jj_h#h #1$61P^_[]Ë$d#`$6 d$6$tҍt$PtV$lSUQP4$SU fH1G@u5d$65`$6h#SUu.$l#$pth#5d$65`$6SUq5d$65`$6H=&6(&6fA=(&6fh#$6h-#h""jj5d$65`$6D$DD$3L t$\$ VS@@PD$PQVSf@5d$65`$6tfA=(&6tfA$l$p!fHG5d$65`$6mf@5d$65`$6SU5SUhU# t$p$phl# =$6j USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ%6@4 1WjPQWWRS 9=(&6f2 P&6ff2=(&6twf2 P&6ff2=(&6tjf22f 2=%6t2ȃ=(&6t]D$ Yf2 P&6f2f2 P&6f2f22f 2=%6t27D$ G UV=&6l$$tApQt=(&6tRP)A(=(&6t1ҋ %6I4-%6teQRP %6xtt$V/11jWp: =P&6=(&6tf=P&6f2%6;x4})}jh2W: =P&6E %6A49rE =(&6t<$fGj \$l$u6_=(&6tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=(&6tfUVfXW|$$Wf@t$$W=&6H(&6tt,fA=(&6tftfA=(&6tfAfH ^_[]UUSWV$$1Q L&6H&69;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=&6pt$ =(&6t ɋ=&6(&6L$xtt tɋ=&65(&61L$|1ɅDT t$t RP,&5P&6UVRP艀 tE{[|$t}SW%ljUVSWL)SW%lj_{[ |$t]SW%ljUVSW)SW%lj?UVSW)Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV &61ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =(&6t SW$ %6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ =&6<$\$T$|$(t$,DpLtL|Dx=(&6RS#TtDp%6D$0X0vv#RP#VFvvm# RS\#VFt|tx|$8B#D$T$Rl$$D(D,=(&6tFB\pTt%6B0FN FNDxD$L|׉L$L$؉D(MU =(&6t]RQ" %6I0VP"U EMhɡ%6@0 ȃ=(&6t3ȃ=(&6EhD,t($%6@0MU EhEhD,=&6L$ tL$D$D$=%6,$\$ 1QOP\$  t19}#8@#pLp0l$$ %6ɋD$taVt$P9 %6x4ƍ$5P&6pSf %6@0fPt$t$ %6x5P&6SpQf P&6=(&6tf؋P&6f2%6B09}+^jh2S2 P&6%6B0N9rF =&6tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL %6taPt$t$$ %6x=&6t$,|$(DxL|DpLt1҉TxT|FN=%6<$09(&6QP! )RP VF^vv )RPL$(D,D(D,EM =(&6\$QP %6I0)RPU EEhhȋ5%6N0 )ȃ=(&6t^ȋ5%6T)FN^FV )S\$L$4$*5%6V0)EM Ehh )ЋL$Ev8QS $61Ą^_[]Éjh2p^0 $Ph#k=$6th #ch#ۻF & %6@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fw ^nFD$hF$D$pFD$lF&6pt =(&6tɡ&6=(&6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=(&6tf)9F=(&6\$tAf)=(&6t4f=(&6t'fL$=(&6fVT$Rt)f~T$JR>>fD>=%6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=$6=&6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=$6t Vt$t$Ut$h#蒨1Ƀȃ^_[]1A=$6t1=&6<$\$ HfUSWV $8$4}tE1ɉM4M019 &6‹DT 9 (&6tRPMM$U(E$f M$E$U( u ^_[]%=uLI%6(9‰|ǃ=$6t<|u=&6tFNFh1 t&6tD$hVP] |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =(&6t RPO %6I0VQRP"։D$D$ ЉT$t %6=&6Q8k=&6L$$tL$D$ =(&6t QP %6#8t@DQL!!IT u‹$8U t#DT tE=(&6t!RPjD t(=(&6t1҉EU}@U=}@|$$6EM QPQPh$3WWh#聇h9##uQ{u u %6y0ƃ=&6(&6t:tMPW?UUlCD$T$NQt PW_~V ~V h #&6%6@ 뛋5%6F8E -&6T$$tT$D$ =(&6t RPv0 I)؉$ʉT$t*DT tZ=(&6t RP$8D t6=(&6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W$6E$8I QPQPh$3UUh#薅h9#8$<t7%6Ht)$|$-&6Cq qƃ=&6t0FV=(&6|$$tJRPu)RPg4FV =(&6|$$t&RPE)RP7)FV )FV h #&6%6@ USWV|$ \$tL&69H&6al$6 h$6 ‹-%6t9ˉrux9ˉ\$؉jL$QWP:ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס%6t`v0WUH %6%6pxjV|$(WS m)Љ h$6l$6=&6jVPSl %6A^_[]WSh#%6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$%6p0vv[ $G %6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP219rÃ=,&6$t$ \$ti=&6t,ۉ~A1_t4!T\$F9uۉ~1O ɋW @9uG W5&6茲t$ D$x, %6;Xt|$#=&6t JًL B tmt$v vh#hWםWVt=&6t$$B1ɉL $6t$ $$Bt$ B C%6;Xt`R5&6贱T$\$1ۃ=&6t%JًT tN=(&6t#RPBt/=(&6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb$6L$AI QPQPh$7WYWh#h9#xT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=&6t+FV=(&6tGRP+D$RP1FV =(&6t*RP+D$RPw+D$ډFV +D$ډFV h #&6%6@ 1@$5USWV\$41F~3|$0l$,|!<&6 8&69|)S9у} ȃ^_[]Éދ%6K89}=$6tOI.A!1‰9)=$6l$,|$0t!t$4PWUhG#>%6PVWUhNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=$6!$l$|$ T|$0tN# $ND$T$RPWUho#" %6<$\Ttq!qIVPt$ Sh#њ$@l$19=$6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh#a%6t$Sh#D1Al$,|$0USWVD$,\$( |$6x$6փσ5x$6=|$611 J $69$66 $6$6p$69$6@D$ $6=%6\$jD$ PL$QT$Rց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =$6$6t$68$6T$t$6‹D$ȉ$6$6$6WUS5$65&6谬=$&6l$$-$6+l$(=&6|$`5$61VV=(&6tf%=tjvdv`X VdF`vlvhD VlFht4* TCut4 TCuG9a=$6t< %6(1$6SS=(&6tf%=u1=%6u(x$CS =(&6t RPq9Ƹs& ɉ @u ɉ @uG9wt$t$t$5$65&6衬$61Ƀ=&6 p$6^_[]PSh#awUSWVl$|$%6jVUW+b 1ƒ $6$6l$6h$6=x$6-|$6=$6-$6$69$68#{H1ۃ=&6(=$6-$61$6$6ډ$6t@$6 -$6=$6Wh $6t^_[]UWh(#TvhM#Jv$6t PXg $6USWV l$ =&61ɅDT =(&6t RPu %6Y0މD$ʃQSRVa wÉD$4t,PDV 1ơ%6$%6QPt$0t$0h`$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ %6; %6u3P5%6%` =%6t-%6%6d %6%6Q%64 ^_[]ht#\tSWV|$t$%6%6QPWV$_tH 1P1 t^_[WVh# tV%6tR %6~%%646e ;5%6s%6Pd 5%6d 1%6%6^SWV\$t$s sǃuG=(&6tfL$%"=@t_-#RQho%t s s=$6tfh,#l`&6d&6{@t1H1PPQQsHsDs sq SW=&6t6hh&6WUH -h#荠u7=$6{놹 p&6s s%6H $6^_[WV|$t$ WVh#裑 CL&695H&60WVh#i=$6t7=&6pt=(&6tPJQ t 0h$'=&6pt=(&6tPh&=(&6tfPh#ِ=$6tqPhԳ"轐1Ƀ=&6DT =(&6t RPRPh#臐 =&6tF(F=(&6tjP|tPh#R^_SWVD$H8=(&6t3P PP0p4u'11C9}QBRQp $&6(&6ttut5%6U5t%6C }U tU tShR#|i1t$1F3L L$hN D$dFQPǡ&6pt =(&6tɡ&6=(&6$L$Httuˡ&6=(&6\$LdtXu D$DVWg=&6thh&6W< p&6󥡤%6X t$ht$h蜨|$Dt!1H1PPQQt$\t$\t$(t$(苬 `&6d&6<$%6jt$pt$pQŁ}U uu\ ,E %6LD9h P5,%6 5%65,%6=(&6t,%6PP5,%60%6hX%6Ix%6P^_[]USWV\$0T$,t$(%6HPډ t.=(&6tf=(&6&61ɉ$D\$ۉT$u t P*%6<$R01L$41́@T$%61+J0#L$,#l$091۸ T$9и|0<$L$(DpTt|$RPl$ l$9}16L$11ۋL$F)߉ӉŃw9}߃F<$T$tYL$(|$uSRP GD(|$u1҉ 1 %6q0RP] $D$(DT|$u1҉  %6q0RP% $Fjt$SUPӃ=&6D$|$ t6 $iSPWt$OT|=(&6t6WRP׉& $iSPWt$OT=(&6t1L$ tYSl$ Ut$QT$臇D$$`%6p0Wt$_ $N1D$4 $%6p01^_[]t$ t$ht#(cUSWV@M&61TD =(&6tPRkD$,T$(D$(T$,5%6F0D$EtH@t)PQ'D$T$@htȉD$5%6D$L$|$D$|$D$NP\$,D$(É1 t1ҹ 9|kލL$0á%6@0 T$D$=&6D$0T$T$4=(&6t RPgMDpTt\$9Ѓ}11@D$|$ ]D$1\$|$G)T$L$֋T$|$w9É}Ӊ\$|$D$ G|$|$u=&6T$t'L$=(&6t!RPD$DT=(&6t1 t>=&6RMT$=(&6HRPO9L$0ơ%6@0 T$D$=&6D$0T$T$4=(&6t$$t RPMt$t$$=(&6tȋMD(%6@0T$,‹t$(΃=&6(&6t+tMVRuVFt$t$ o7KVRYMQ AD$:MQqD$T$AQ!EL$DT=(&6t1ҋ %6q0RP| ƋL$ jWSQsKӃ=&6D$ t7~SPt$t$$OKNjT=(&6t RP|$)~SPt$t$$K=(&6tȋ|$1҉\$$ t/f %6q0RPُ xËD$L$ L$0|á%6@0 T$ʋL$ȃ=&6L$0T$D$t!D$4=(&6t)PQD$ T$8=(&6t@ɉL$ D$ =$6t h#X=&6t h#Xh#X/=$6u h#WX=$6u h8#W3=$6u hY#W6=$6u h~#W<=%6t=$6u h#WT %6|$Y8֋T$  SP5\&65X&65d&65`&6h#Wd,$kdы%6@DWSQPAD$T$iщډWSURAjj RPoyRPt$t$t$t$t$VD$Ph#t$=$6 %6+H&6 L&6`&6 d&6`&6 d&6 tQPh#%t =$6-%6KC)s, X&6-\&6Ջs4HS8\$ ډD$$+8&6$T$<&6 $ $ډ Љ X&6\&6tRQh$#ms =%6t8h9#Ws5%6tvvh`#:s 6j Lr=%6t8hg#s5%6tvvh#r 6j r15%65%65%695&6tmj %6405,%6h QVi 5%6Vƍ=(&6t,%6PPҞ5,%6z0%6=&6t $6j %6y,t+%61TtRD %6 %6F;q,r%6PC %6= &6t =&6th#S,61=&6=$6u h#S=&6t h#SGRtgD$PhV%2u1D$t)L$ jQPhV%h+/%Qt-=$6u h#S  ^_[]1USWV%6D$45%6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B @&6l$9؉|5%6|$0G;~,$LHN4H~KT$މ)1@ @&69׋T$9|5%61҉t$L1F, \&6X&6d&6`&69S,SދD$4HxL$HD$81ۋjV %6ׁ\Tډ\$tQ!QЃQ SPhX%6A%65t%6|$D$Xt1NPSWUG2ʼnFظ|߃\$ <$w4F&6<$t LX FuWBsT$ `&6d&6$@=(&6tfL$fAf|$l$$j 7& hX %6%6T$ =$6t| $=(&6t RPRPh#l=$6gq$ʋT=(&6t RP{WURPVhN#)d($DX=(&6tPhv#d$6h#Eh_#brT$ '|$@@u' T$t$SUt$A h&6t$D$, F=&6=%6$@=(&6tffu$@=(&6tfft}SU{$@=(&6t?f=(&6t/ȃ=(&6 $ApfAAt$f=(&6t $ApfAA $AtfA1ɉ (6 (6 '6 '6l$T\$X&6pt4$9 (&6t ʡ&6 (&6$tt4$tʡ&6 (&61ɉ$dtX$t $D$LPt$衹=&6=&6t=$6u,$$@\=(&6tȅSUh#C h#(p~SUؾ19 (&6t1ɉH\H`HdHhHl$f!B=&6,$(E\=(&6tȅƄ$E\=(&6tȋ %6I0H111҉,$L$ D$t ߋ %6Y8Om\=(&6t͋ %6#8߉@DYL!!ÊIT u,$\$lD`Td t<=(&6t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9%6H4 D$|$׉D$|$=&6t݋AQ=(&6t-RP!Eh=(&6tȋt$|$1҉11 ˉl$$WVRPSUh#uA=$6th_#mh#m|$t;SU蕼ƃ=&6D$|t1$=(&6t RPcFV$6=(&6tȉFhܽ$|$jj$$$$SU z $A`Id=(&6tEQP $plph1$D=(&6tWUPVh(#  $AhQl D\$C5%6;^,T$$L$ '6'6׃ƃ='65'6 %69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-%6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H) ƋD$9\$(s+l$ Uh#>jTSWUt$@h#h#m=jWsUSWV |$ ow@u Xw VUp D$t|VUh#w w'6 '6ʃǃ'6='6|$ |:w whE#= =$6h_#mjG $D$|$tjVU¾ @&6<)1CVUhm#D$,p p*(6 (6ʃǃ(6=(6 j  hp %6tH%6 %69tDy1Y1 t 9u,X&6\&6$|$ ,%6%6Q1I1 ы|$ t%6$G0W4L$Aڃ]D$ p phh#J< =$6t)hS#B1C+$6h#;h_#h1Ct ؃ ^_[]$6jpj:QfUSWVP$T$1B@B)0 %6(6%6x,11=l&6t>Q:%6x,$kd1PWSQhl#h'3[l&6%61ۃVU聶tzljl$ t$&6pt=(&6tʡ&6 (&61ɉT$HtttȉD$LVUz8tD$PWbu(C%6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$(6ŅtTM1ًU1 u3VShm#w w(6HPUMpX(6 %69tmu1 %6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $&h#F9h#eh#ejj聴=&6(&6f@=(&6fh#8h#aeU1hPVPVҜ1Bh#8h##et21VWhVWVW莜1 tah#+7$6h_#du<tf@=(&6tf @f=%6tjjxfh\: j5%65%6T$1B@Bo: -%6%6  $l&6$Wt>E6+5%6=%6kdPWVQh#h'3Wl&6uF$h6#vv 躑 P&6A1ڍF$h#cvv 6ǃ=&6F$ (&6&jP1 P&6I F NQPQPhSt=&6F$ P&6t%QjPSh#hJ#>6#$6QjPSh#hJ#36=$6th#+=$61F$P&6 I1)щN$uh}#b-vv *ǃ=&6F$ (&6$Wt jP1҉GW1҉GW }hjD$\P, =&6(&6D$tt7fD$T@jv$-fD$T@jv$}fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=&6$tD$\=(&6tL$Lu$D$PD$PD$XPyl&6;,$/$6$W=0&6v0&65%6;4$]|$T{$AhjW) -&6=(&6tt0fD$T@js$~&tPfD$T@js$dFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=&6$|$TtD$\=(&6tD$L$|$TtD$\D$PD$PW٧;4$=%6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h#ss QPTh#$^t~s sqf@fNCKK CQPh#ss oOCK =$6thp#ss QPCKh#QPss fN $6;<$=%6%64~^1ۋ/uu p]]8u9rۋ=%6/CK tS  StQP HKX9rjj轄`^_[]$6j"ejEPh#/L$D$@, +A,USWV $0 n8$=&6ui=%6t`E=(&6tȅtNE=(&6t$;H&6L&6s&E=(&6tjPo@E$F0N4 utEhe%P)$0 F=(&6tȍL$A=%6AAhhe%Q %6 (&6tD$D$L$L$D$h#v v薉 E=(&6tfM9v%}EPh#.#h#0[4/E=(&6f)=(&6f=(&6fEtf=(&6t΋$0 AI 1 h#QP辈 h#Z$0 F=(&6tȉE$#PlZEL$fAWQU $)fEPUVt =(&6tfD$fXWPUT $0 G0W4w wmfH$X$6$0 =%6t>}t8h#v v贇 h#Yu EB$6F0N411G9 v vGD$@=(&6tȍL$A=%6AAhh#Q (&6 %6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=(&6t2f)=(&6t%ffD$=(&6ff(&6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=(&6tfPjU&" D$fEutEh#Pl$L$Aq $0 JR ωtljh>#RQUW݅l$EMك9v%}EPhZ#*#hK#mWD$$0 T$ 3F0V4=$6hc#}ڃD$=(&6t΋D$p@ =%6X}$0 ~h&#v vڄ Eh#VJ$6BK#$0 1GPVtXD$T$ F0V4=$6hc#|ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV/ D$fXSPU E$t'$0 G0W4jPAifH1G9$0 .1L$AA EL$fARQU $EtMw\}.uVV4~0|Juh# } .u8h#v v% Eh#U4$F0V4=(&6tȋ L&69H&6s5h#juv v݂h#T4$=%6E=(&6tȃu}uE=(&6tȃtb}u\FN U=(&6tʋ4$h#jRQPX=(&6t}Eh#T1 (&6EtjP|gC$0 A4y0#$0 t=$6#=&6JR u=(&6tPjVRQ菁h#_SƋE=(&6tjP1Ƀ=(&6t f(&61ہ@€@t f (&6fG$64$Crv $0 A4y0AI U=(&6tʋ4$h#jRQP褀h#tR$6zE=(&6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=(&6l$\$tȋM=(&6t1퍜$UQUPhScSh#$"Ph# %9-$6thX#xl$\$ h#vQƃl$\$$0 A4y0| AI KC=%6taEO9tU$0 AI U=(&6th-#jRQP%GEh#Pu $ $6fO4$E  ^_[]ËM PSh<#"ȃ=(&6tUSWVT %6%6,=l&6t>)"=%6kdPWVQhr#h'3Dl&6}ww cO W $T$ WGO ƀÄ:1=$6t4= &6t+=&6t"uGO 1F9ƺw1 tbQPc8uS=h&6xJ1v6KNj@ $GD$wOG tQPb8u E;-h&6|E;-h&6=4$h#b"h#ORv6话11|$D$HNL$D$D$D$$D$D$ d D$TD$D&6pt =(&6t ɡ&6-(&6L$Ltt tȉ݉D$PD$PRmu h#!D$TPv6t$t$~tyD$ ? v6ΜL$QPt4t$t$af@jw wt$t$~t d$6`$61JQPBafp%69)T^_[]fUSWVT1ۍT$1B3L %6x,@=l&6t;%6p,kd1PVSQh#h'3Al&6%6 %6<\$11ۃVU衛VUi`$t$l$ &6pt<=(&6tϋ &6(&61҉|$Ltt<8tϋ &6(&61҉|$PdtX 8Džtɋ$L$HQ$&xtCVUztV=$6VUh #^1=&6L L tOjhi#s%6tuQ1y1 t6 u_VUUdtl=$6tHVUh5# =7jh]#$PxyQ %6P jh<#D$P C%6L$;JWD$ PN` ujSt$V.ch 5%65,%6 5%65,%6NT=(&6t,%6PPZe5,%6aA0%6hX%6Xx%6 ^_[]USWV=%6%6D$ 1VjZ$VS Ct=$6|$FX$=$6th#)=$6uh#Ftndž$%6h 5%65,%6 5%65,%6S=(&6t,%6PP$d5,%6+@0%6FX$~9#~ #L$|t$$J N`JуRҍ;F0vt$h#$B=$6t$teVh#\$D$O4$~?K`O &h#D=$6y1ɋD$@Bȋ@4ư#sLV5%6x 5D$ %6%6h 5%65,%6 5%65,%6Q=(&6t,%6PP$b5,%6+>0%6&6tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5,%60%6%6h#h# ud%6ǀh P5,%6覔 5%65,%6,=(&6t,%6PP >5,%60%6%6@ <:P^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhV%mUQ=.6uR<sJ.61\$|11 ʍT$ ٰBPVQ&a D>/|)Ot$L$6.62.6$!D$h8J.6$ D$tB?JL$h)PRQ`SWVD$t$ L&695H&6r==%6 %6jSPVY)޹294v t^_[PVh#GWV|$ wu$H&1XD$@uPw w Phk$.=$6th#&h#t ^_Ph#躽l&6USWV$\TM@$ 5uh`h`VPQ_ =$6t h#k=$&61ۃL뀃=(&6t\,L$UPQj DPP~$\, (&6L$L$UPQ8 |$u $PPD1LDffLD@9u=(&6t8PP\(&6L$UQPޑ t"PP\L$UQP踑  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h#,USWV\$t$=%6!ߋ,t9Xt6@u|$t&j莛t1ɉH HHXh1^_[]h#ĺVD$ L$5%6#p9tыR9u @^USWVt$|$VW/%6!t7^Fu+11 33 1u{ %6tqt$0|$,\$(l$$T$.6t9PtjRQ .6(Xxp L$ .6t9HtjQ5%6 .6(Xxp ^_[]WV %61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$&$1Aȋ$sY9U&<&Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$X&4  <Qh#h#船D$P`wZL$ D$$h&1B(ɀ!1Rh#h#SD$H`wPD$T$ $x&1C%   [Qh #h#襸SD$H`wND$T$ $&1C%  [Qh#h#:USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWEmƅuWh"jl$$<$4D$Phd@UT tg1OVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh$t$ 1 Sh("U< CPh9"Uڢ C PhE"UȢ CPhW"U趢 CPhk"U褢 $@D$t Pl 1-Uhzd@$<W t1 VhedAW hjUȪ D$ P$4d.D$, 9L$l L$9u0$S11:8tx$0hϗ"ySb$11҉ $ƅ*ŰP j PUg ^_[]$0h"jRjUSWV01ۍD$,ShPSu 1NtAljSPSWuW'D uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSO-$1NHD$ D$(%=@= j/Sxr)ك$0PSQh##hRD$jP"Lǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS+1@$D$hh SA ƅ%D$ PVLD$3D$ 3|$$  D$uH$0PS$8$P$TRPV} VB D$4@D$1$Vh9#jSJVjS@ ƅxc1GD$ PhFV  ª8u;VA Wh9#jSjjS@ Gy 航D$t P <$t t$R1Ox VBA e^_[]D$(%= tn=@u$0Sh+#hP^SƉ\$1@$D$:\$ D$ PS)B$D$jS? }tSXtN$PhF|@V辑 x4D$t PU$$JhF Vx$USWVP1hUU= ƉRP*9-(&6t1@fC}+PUUS'G %6;A0u $ytWVD^_[]Ë\$-%65(&6SUqRPX$@ `%6ؔؐh P5,%6N 5%65,%67=(&6t,%6PPC5,%6J0%6[USWVt$(~Ohol(&6tUQ<Չ 1=&6L$$t| tWV<Ɖt$$H$á%6@05(&6QPWVsUC cMhml=(&6tUQH<Ջt$( }%6@0ˉ9Éʉ\$4$rQPUt$tLPDTGlOh|$ wL$,=(&6tȋ|$%61ɉShg#(=$6th# h#t$" %6QP%$T$1RQQD$PaAá%6;X0t$~~1Ƀ=&6T$DT =(&6|$t RP7L$ pL$QSRPfBǍP覇.6$|$1D$D$t1)ÉعF@jPD`r9w<$r$l$T1C @<$9uG<$;|$}%6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡ%6@0)ȃ`T$1ۡ.6ـ#h#蒦=$6th#h# ع`֋,$L$t1ɉȉD$ օt$ tH %6i0T$,RQUt$> %6;A0l$,} $L$l$l$,%6@0D$Mt$ |1TT1PD$T$ ʃ=(&6t RP4L$(ωQM D$H 9tet$C9\$t$$h#D $64$F4$;t$SD$`1$60^_[]ËL$ ʋ %6f9u ShI#ԤD$`,t$$hy#蜤j  %6Ph#sUSWVT$L$D$0(D$ X=(&6tSU3ʼnӉ OD$$%6@09ʼn} t$t$5D$PSUt$< %6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5(&6t9RPt$ƉT$ 2t$1ӋT$1 t<$G RQ2D11 u5\$$9t ;D$t`GPD$ GPWTt RP2$<$G L$;L$t9ta щʼn$;D$t`1hM#^_[]USWV %6$%6x0UWt$0t$0<Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PRu< .6T$4$1B srl$,$ ȈU1wX=(&6t %6!9GX=(&6tȋL$,1Phz#ʡ .6L$ $  hd#詡=$6th#h#t$D$OPWTP1GTGP^_[]$61USWV|$,;#t@#%61@$%6sll$%6t%6 L$ =ƍD$1PQQV{9 %6;A0-T$zu D$`1]l$z$Ń1EGpD$h2 D$ Pt$ u&xMt(T$h2 D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh#=$6th#h#qt3s ss3st$Vn[E;,$u$6$t"Phy#`jδUSWV0\$T|$HOX=(&6t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG(&6҉L$D$td$PQ<.É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ袃C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"h[#,Ph#O4$VIVh#h#h h#譆h\#hI#h h?#h.#hWVt$ F,t@.6th{#F,Pt1~,>d9~8uv0V^_h#h#h h#"D$x,u@Pt P h#h#h h#WV΋I01t*N8~2IN8tPQP ṔN0G;~4vɃ~8u^_h#hp#h, h#舅h#hp#h2 USWVEH1BT$x,1hp1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vSe^_[]h#h#hF h#諄USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h #hK#hK h#蛃USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h#h#h` h#h#ha h#USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h#h#hq h#h#hs h#(USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h #h#h~ h#fUSWV\$$|$ l$t$.6t5&6SWUh#|USWV5&671^_[]USWV\$$|$ l$t$.6t5&6SWUh#0USWV5&6C1^_[]V=$6th#2j5.6Gtah*#赌h_#WtS.6xL~61 .6 s"@Pt4hJ#蜪 .6.6F;pL|^5.6vj迡.6t'x,tP.6P.6á.6t x,tt$t$t$t$P1WVt$|$ VWJ=&6dtX=(&6ts,%6`uau33 u1@1^_WV $6t1 .6 %61!`u/aʀs2hlpx1Phw#Ph#h_#蓷Jh#%6 ǀdƀah P5,%6+ 5%65,%6=(&6t,%6PP5,%60%6%6!1111QWRPjh.6hh#h_#赶lh# %6 ǀdh P5,%6* 5%65,%6=(&6t,%6PP 5,%6'0%6 %6dPs+aʀu Ph#Ph#)h_#˵h#!%6ǀdƀah P5,%6) 5%65,%6-=(&6t,%6PP95,%6@0%6^_jUSWV1L$ AL$HAL$@AL$<L$ l 'L$A h 'Ad 'A` '}u ]hb#WVJ k~lt$tu4D$PS,buD$HPS]# D$ PS%t9PD$DPD$DPD$,PS(uh$2jƉe^_[]95!3ujh` 'D$Pئ u1PPD$Pjd95!3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQ RPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQt ]S_rt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$PhQ1#hVf^D$@w ww7VPh>#S 1h#+h#WfUSWV1L$(AL$$t$@L$ D$ }] h#WSfF aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9!3u~]#D1غ$Phzd@ f tN|$$tOh<2j[t$ 7st$@+s1Oe^_[]h<2j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$ fttruG$95!3u4jU,jU,jU, uh[#"hl2j " Àuhx#U 1O^_[]Åt&$jv Er VUكtt$ <u&$jw r WU~tJ 1u$jq q VUJbh#Lh#Bh#8SWVL$t%T$1H1<213&F9u1^_[USWVT$D$\$1f 1Ʌ\ S $FVP1$^Tjh` 'Sn l$k,S(C K$)̓$$|BShk$hD$PNUt$s$s D$ Phu#$C K$jSjUt$QP$d l$EhVPE$9.1C]2UWh#S$$1Kt$t$h#Pftt$t$h5#UGPcSWVPt$|$\$$(n0zPS ^_[PD$tu-PhԳ"蟑D$ L$ $QP < j 蠐XUSWV \$$|$ hj\ƋD$(D$,(D$0,D$4$D$80D$<4t1jhVPWV <QPO($#D=$؃u E:j n1uaWh# QhWV& h#h#V7t PS h#VVa1 ^_[]ËM)z G1SQWD$P\9|RPhW#Vy|$$tRPUQWhs#V؋T$RPV # 8D$11WWPW1@PjPV؃$jS $jQUWL$誓 t$h(#V kUhd@6S tYMɉh#rRhd@S t4O tGʋM$8hL$h#h#jV tH h#VG1Ʌ A I$ 9؉$jQPVZPL$T$ D$$jPXUSWV Ӊ΋l$ jURQtn=Uuq1tu@ yyu݅tj ud1PPh.#Vih#V%tUSh#V;W^\tUShA#V |UShh#V1@PWPjPUSVa D$@\$4$1= uD$ Pt$h^#t$  $|(1RVRUPQhz#t$] $\$SPjPjt$ t$jjW X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP&DE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q : H @AQ@A$Q @QHALh`#SkUh#h#USWVP\$|$tus$W" $m"$jGNtQ1@PVSjPt$8t$8W E1u>4$h#W VTSh#W4$h#W 1H^_[]UWV} uOʃ<<|RQPh#VJPR'x& $T$W1ٹ|$5<<h# 5<<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjh` 'V 1OujV5<<>uW?,VQ>~Ih#Q1$VQ7 t1Ph#Qx 1O^_SWVP|$1N?u;j S5<<Ջ 8u1u5<<h"t$ ^_[WV|$1N?t5<<t 1t^_h#t$USWV 1O1;B։ˍD$ j P5<<菍 уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5<<h%x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`S~ljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,Mjh` 't$$ tjVt$$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh#VIz1t^_[]1;BB  Fjh` 'P~ 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0h.#W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph8#Q 1HUSWVt$|$ t)l$\$$jWUSm tWUShu#1ha#V*l$(\$$jWUS: tWUSh#V1H^_[]Ã|jWUSP11USWV\$1s3h%5<< t^1W|':JtuWh#t$ 1N'' Ch%j Džu^_[]WV|$ '|'Wh#{u^_USWV t$@\$~D$DF D$HF$ۋ|$@tFj(j>jŋT$0L$4HD$8ED$ t$t$t$$Wt$VW1h#VEPh#t$@V USWV͋D$,jPRQt$08WEVuWEVusH(L$҉l$ $T$tx11ۀt3ʼn t$19޾|݉Ƌl$ $9u-h#UWMh#UU1@1ۃ|SWh#Ug$D$j$SW0D$T$f|$$à1|;#rPh#j@h/6^b/6'PWh#UPWUT$@ toN8jHQt$VP"$H(K$t$11+D$t$9L$w‹t$V n$SV(n,l$ $G9%4$4^_[]V1ND$~t!t#u%0t,u Ph#t$ ^WVL$ vAw$P'11H$('tuh|$t$ #r?Qh#j@h/6`/6*81 *#'PWh1#V1 ^_ÐUSWVPt$h^"t$$V u295!3u*t$VljjVwthl#h2j ^_[]jVJjV9 jV(jVt;ƅ tDE h$1݋@ 1 t:;Ph#V; G t0ƅ uh#t,uLjj2h#V1Mt +Ai UPtσ tu'SWtjjtjV1u1UjUUV@ t|jUUVtu1hUPD$ 8 $fǀUUSWP41@Pt$jUPUUV PVt'h#Vh#h3#hE#VUSWV΃tuwm"W"W"m"jp Rp pt$,t$,V Et1PV&t*SWh#VN1(RhP#VWhb#Wh}#V 1H^_[]USWV Ӊt$$t$$RQT1Ot, D$m"$W"! D$W"$m"8$s p ՉT$~ Eh @EMKM$E OEHMLEu UED$0Vt+t$t$h#V1%ShP#V 4$h#V 1O ^_[]ÐUSWV4\$Pl$LT$H1 F0#h/#SU tPVW4 u9-!3ujh+VWLh2j'4^_[]ËD$ l 'H h 'H d 'H ` 'fUSWVX1L$ AL$A\$HCL$ u} D$hx#VW bt(t?qt0PSD$PD$,Pu\ulD$PuD$9=!3uHD$|$|Yu/tJL$T$xupt 81ϋX1 t$@uh2jƉe^_[]Ét$ t$Lt$Lt$t$0t$0}W!1NtƉT$4D$\$ D$ D$D$$$WbtCD$@PWOjh` 'D$LP\ tXj$t$t$ ((D$0T$,W;L$T$4t9_t0uh#uZShA#WF \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQr_L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh#P%1D$Bh# D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh#u1fUSWVPM(,|$8O] D$1h#uS sujsWVVuutqD$9!31t$Pd'3H d'3;t'3h\'3j V\'3H \'3 \$'d'3H d'3;t'3h\'3j U\'3H \'3 FtHPh7#ON1v6v C d'3H d'3~a\'3H \'3 ]h5"fON1v6v  d'3H d'3 \'3H \'3 h\'3j U^ Shk$P|$3W \$ShQ1#P$ S SWuhh&W  Wh=#N~u(hD/6hQ1#hS= Shh#N)Shh#oND$PhQ1#hS }Sh#CNh#6N$f~ jj hO1#RPj|$7W xWhk$M"$f~ RPhT"M d'3H d'3~\'3H \'3 h\'3j S|$G8jm$Sj$P蟴Sh#sMh$fMG0O4 tQPh$PPhS$3}qh\'3j SFHsF 8-uJF $1҉QQ$$PhQ1#hS{Sh#LvG1##h-.% VL h # V~L hX$qWTD$0#D$tD$)#1ot$w7] V*Lw w VLd'3H d'3;t'3h\'3j Q\'3H \'3 \$d'3H d'3;t'3h\'3j Q\'3H \'3 GtPh%$K h7"uKd'3H d'3;t'3h\'3j  t hI$]Hh#PH 1A AAt$QhQ1#hVVhS$hw$h$GĔh$G|$uhusuqVh$oh.#Guuulh$$tO1#PRhi-%rGĜ;8jmWj$VzVhQ1#hWWhT$8GĐ^_[]USWV΋\$$|$ ʉl$͍L$jj hO1#UPjQ̓ yD$SWVh$F|$tUh R$Fj E ^_[]USWVDt$`l$\\$XT$1 l 'G h 'Gd 'G` 'B0$h$VU Tt$t7ltytdPD$PS uNtWSu1HVt2jh` 'W1G t9-!3uWhBD$PS ht2jͽh&1D^_[]ËD$L$Q P QPIHÐUSWV(]1L$L$AL$A} uh$SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV`uh2je^_[]Ãluh&<1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=!3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H `/6H \/6@X/6 T/6hT/619`/6F\/6FX/6FT/6F^Vt$|$uD$ hd/60p/6FDl/6F@h/6F 1O1PVD 0h$h$S VD h4$St$D ֋D$+D$ L$,D$D$@L$$L$ $48Vh&S $Ph$S $Ph$S `$Ph$S ?$Ph $S $Ph.$S >u$L$4fL$fB$Ph=$Se $PhJ$SD t$(PG Åt$(zG $fǀU1PPPE!ƒ[u$t$ ;$4t$8Z D$t$F fËt$01 |$lD$Ph&SD D$lPt${D$Phq$S D$|Pt$G$Ph-.%Si `$Ph$SK B$Phk"S- $D$Ph$S tj$$Pt$ D$DPh$S D$D9M$ $ȃhL$pQP t$^E Åt$E U$61QQP!ƒ~t$ M$$VP 9U]$|$$D$jRP!ƒ=M$$VP蔜 9E$1SP|$W" GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$$6D$1Ph@ ^_[]h$h$ ht$h%j USWV $Sh 'U Ǿ '󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAH2qL1ATAPAXkiA\ $A`i Ad $Ah!i Al $ApdQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph"VC |$V V  L(C 1ЉًL(L$I$1 sD$PaD$D$ t2t$ ^ {uWvMu{u C $L t P1g D$h $UL tvPg D$oD$Ph+#U _|$TGhIw@PVn w@w`VV wdcD$D$Ph+#U: t|$D$D$hD$D$GOV9rQWP D$Pt$\$uoh $D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,h $ MHtU4uL9rRQP t$|$t%u@uhV tIq81tSul|$tDEM9rQWP6 u@u`Vw u@yu@u`Va teEptUt$8ЃtEu8uXV7 t, ^_[]h $h $Ah $h$5h $h $)u\u\h% $udSh $jB wlhk$jc fUSWVt$CF 1tvt$G t[S1 tCPQ Vt$I tPUWK uW( S0 1S0 WF ^_[]USWVu]Ph $S t$f1j?1Nt}ǍD$ PhZ$S td\$ t\hjD$P jS\$S ShiW t$E L$Uf jQh $P. je^_[]PPhZ$t$j u1$YVPt$ t$t$V tPhZ$V0 u1$^USWVt$t$\G t Nj\$ Pb 9v? 1N*Ƌl$Wb VPU^ )SjU ^_[]USWVt$t$F t?Nj\$ Pa 9s9Ƌl$Wa VPU )SjUB  ?1N^_[]UPh%u t$1H]USWV@uPh, $V ] h $VF tPa |$ P\$$ShiV\@ |$ jSG_ Ph $u G V% ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP^ t!Ph $SG V>% 1He^_[]h.%h $hh5 $WV|$$h $WE t;P_ u1V_ jPV3 VhiWQ? t^_h $h $jVh5 $h $jԬ V/6h2V V /6h7uV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh $hV>tVh" $V艨FߋD$t$j7QPh $hV>tVh7 $VDF߁^UVuPh?$V t3$L$ AQhiV= u hF$1e^]h.%h:$hh$UVuPh|$Ve t3$L$ AQhiVe= u h$覓1e^]h.%hw$hh$UWV}W#ƉPhn\$W tZt4$P<tW@PV[ tGPh $u D t>V+1e^_]h.%h$hh$h$h$h$ h$h$j h%$t$A tPh $t$ D Hh%h$hh$WVPt$|$D$PVW t2D$t H^_h $h $jգ h%h $hh$lSWV\$,h[$Sw; t`P:V GWt\WPh[$STtL@xpPhiS5 t5V 1k1H^_[h$h$j hX$j USWV8}D$Ph$W u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j SS t$Phq$V< D$S% |$Oe^_[]h.%hK$hfh$USWVuPh $VI tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]h.%h/$h0h$BUVuPh$V t,jt$V 4 1u"h$hk$ o1He^]WVPt$V't&ǍD$Pt$V> u Whr$j PD$L$AËD$L$AËD$L$AËD$L$AËD$ 221ËD$ 221ËD$ $2$21ËD$ ,2,21ËD$H@42 421SV\$ Sh82auCЃ r"CrCr #01H^[h82QH?r  ؈821ыL$t 461ÍAЃ r)Aw AwÉ1HUSWV1t$ D$hVP 02x46t8u^46ǁ4646464646464646565656 5656@whl2R&uh$0h29&uh$h2 &u h/$jp $52tvh$2%61565656D2t2$h82$U- ƃV B~>CN56F v/FwD$<'!56Au"hT$a$ '56xu>Wu4D$P1VhVVj V5<< (569t$:*ƀ46l `C Lvms2D2u256 56r56#56D$P1VhVVj V5<< $569t$taY56>56O"56CatTl52+wtzD29tl2x2$ÿ`2؉$D2!3 56$u =#56uB=46=56=56u|t =#56u =46uftu^#56uS$ttH)ŋ$L$ T$ RQL$QWPU%uT. u&hI"he$,5<<h%j t$PD$P & u h$D$t,DtVPyDžuhI"h$JW WtS)uhI"h $WuhI"h$02t H9t@hI"h$$@ uh$hI"h*h$VWЃ Wj0USWV- uh?$he$jۙ Ƹ82jmP O1#O1#t$jL82Pt$USWhE$h'3(2t VSm#$uO1#WWWWWQWh$h'3$V jbV 021tT$q9t Iu^WVΉhjWc D$Ph\$V tZh$V0 tQPK L$PyRPQõ WhiV* u hg$"Ĕ^_h%hT$hh$ WV hq$Q0 t;PJ  u1WJ j PW@ Whui V^* t ^_hU$hH$hih$hw$jޗ h!$31ÃD$ 1ɉJJJ JJ BRhiP) t1hX$j腗 $1ɉJJRhiP) u 1Đhe$jF Qh82{USWV΅t R , "* * 0($D$P;!\$D$1t$$tsVsD$tVPVhZ$WX trC=56D$uCt\=56uCuM="56uCt>=!56uLhj$V VhiWn( t!$uۋt$$4u= 56t ~ j h\'3srWt& 02ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPh$h$VVUh9$ jl$U$Vs Vhit$a t$,$t!PhW$VhF$`},$jt$V Vh~it$  t$tPhb$^j tꍄ$P$$ j:QPhx$h$P$t'$Uh$UiE}uj:$$hx$h$P膲$t'$Uh$UE}u- 24$tVWUmuj|$W$VЭ $$ DŽ$@Vhit$V褾 u$ h$1@Pl$U%jWl$0Uk 1@D$81D$ƉPV5056̕ ǣ,56V1u 056$h#Z1H^_h/s%hE$hhm$WVPt$T$h$V tbP8 VV8 PWwtIƉPV5056$ ǣ456VI1u! 056$h#1H^_USWVt$T$1hT$V thƋ-056P7 V7 PWvt6ƉPW裓t>V訽 ݉-05611H^_[]h/s%hQ$h2hm$]h%#fSWV|$ t1H>t$|$\$j@ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VK5 tE$$PwCt/$F ~G F1  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP  Ɖ׃с11E9r Y8"t$8tG1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1 USWVuD$ tV} ]CtP78 tEC tP7" u/D$ Ph%7j u$D$1$R1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V0tt|$,$h%WD$7&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$D$4D$4D$ PD$8Pt$ t$ gÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr(1X \$TfD$t7|$0j WPKi t9t1ۉD$=r"11HD$$PV|$1OL$L$D$L$T$PQRh$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PNjD$fVSP诛 sD$ t P4$W/ W(<4$uM S]s {te|$t^t$Vt$t_@PWN/ W踶tNVsE0 ߉Vu ۉt3EF ^C F1Vt$h$h$h$h$ h$h$j} WVt$tVyr1H^_V2 t3t$L$|$ Pwt΋D$F ~G F1C USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t Pu 1GG GG;1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUst>Vst)u ׽1H^_[]Ís s(CtP7O uCtP79 t1@뿋C$1$'4v6s !6* P5  v6 tMtk $t$ 4$UQ$ 1N^_[]hN$ h$h$jr WV@56h2VVH56hkVP56hWVW^_USWV, $@ 1 856t1ۈ$+$*|$hjW蔱 WhKiVb l$(EPƀ}u jUX $GL$$*SjQhRPU辦u jW $L$ $+SjQhUPW膦1f|$0t,L$f|$ 0t,D$ tm$L$ T$QUR$6QPh$, ^_[]h'3jj7h$TjhIit$  t1h/$jp WVt$ 29tEtt $je UWV uPh9!$V t<|$WhiV t=$D$WhiV t)1e^_]h.%h4!$hh$3h$h $jpe USWVx$t$xhVh$W&^1@D$D$1L$8DL@uVh!$ŴjVh !$d u$D$ .3DAt\~:uVЍ\$C1|$8+jPWh%Vƃ uր>$t^h!$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhq$jc $1Hx^_[]h $h $jc WV0t$<|$jWh$V萴t8W趺 t7HfJBRhiV t!10^_h` $hM $Whk $j+c h$jOc SWVt56hT2VS|56h(2W@VgW^56hV356hjW56hkSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW覡 Whi$ U $!hr!$$HQPۍ\$4|$fGWhiU t$y!$f|$*u!$=56t PvfD$(WhiU t$!$f|$*u!$=56t P7|$fG WhiU t2D$*=) Ph!$=56t h!$fD$(IWhiU> t2D$*=) Ph!$=56t h!$1Shi8U |$Dh!$_1tPDL@uShi8U t$HuM1|TuD@uD$L|C.3L$P9Dzty:t|$jQh!$_ uVh!$11t j,DLxPtT h!$v<u h#xj $PhiU tDh!$F$t$h!$( h}#j /PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRU Ph!$$=tPh!$j $=tPh!$a^_[]PhH!$j6^ h'3jhh"$tÃD$1ɉJJ JJ fBRhiPm t1h$j^ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hq$j] USWV,$@$PhiV tr$A jjj"^P xgljj2 xi$-hSW=6 xB$/uE$0uf$Ciu.h$E1H h$Eh$EW7 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h$hgU%h|$hw$h5$h$h$QL$4QhN$(D$f($-D$](E!L$:!PS E PP $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q 56t 56E56tIAtcAtCAtPA tSA@tBAyAAT$h56UWt$PVt$D$VPRRh$,l$ }"E!Ê<)\<$0'=56`Cs|$[VPWl$Ph$h$#<*<0<2=56<$$<t$sQhk$#1L;O1#y$QRPhn"G%9u<]K%C=Ph$hk$H=56S<$CPh$&KPh#$K s k t?L$D$F*$PWhc5%ֿ Nr%܋L$D$(Mu} L$D$D$F/$PtPtPum$@$ `$"QPhc5%G Nr%D$ŋL$D$(ȉ</=56%<C<$d'$=56CPh$=56CKSRQPh$h$蝾C~@sFNuQPh$e IRQPh $MMuj>]l$ L=56?CPh$(sh$hk$=56<$CPh$ؽKPh#$½Ck tAt$D$x*$\PVhc5%莽 Or%܋D$t$)E}twt$D$p/$ttum$@$ `$"QPhc5% Nr%D$<t$)ƃl$ rPh4$Լj><$€$$P'$rQ=PuJC<u;h$hk$n=56yCKQPhw$J ]=56Pȹ$6<"<f$$ $$$ $($0$:$?$H$Q$X$h$hk$腻=56<$CPh$c1D3 O1#t$T3 ׃l3 URWPQ'h$!uj>/l$ 胷^_[]ø w'ø"øSw'ø"VPt$ D$Ph$V諃 tD$P^h.%h$hh$褍VPt$ D$Ph!$V^ tD$P^h.%h$hh$WWVt$(|$WhiV tND$Ph $V tCD$D$WhiV 1uh $81H^_h$j,P h.%h $hh$ÌfUSWV8b y h"$8h7%4 y h"$x8jh"$yt\]1L$jQP D$tPh$$ 8jh"$! 2~1 VPh  VPUSWQRPh`$1EVRQUhBVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSj& |$www wwVWj VWjs VZ( SQ( WC( D$ @ )T$VVQRWPE1I9u !8tމ556 2tщ1@8^_[]h$$_6j 蕏jj|c h$$c u8$$jV;t$$jhcS$h$$Vh#1"hQ$# j 9j 2USWV`~ZD$=56tIt@ƍD$H@ L$1jQRRjPDut$VhR$$< 1t$HFFF FF1G>\$SVj l$ UVW J.ƅZ21OjUj^ t:9uB$=h#$jV%  g8uh 29tttn1VSjC VD$$Pj3 2vh#$@jjj 1VSj VU6h#$1=2u$=|$ u'1VSjǍ VWj軍 ~`^_[]Ét҃t̓ u1Ht$8F FFVR# Ph#$u1"$WV߷t"$D$8x xx8WPV # "1"{jh#$h݈#q Q$SWH Wh`#$jV葌SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP藌 $H $u˃^_[á56H 56t$Vt$VJPh"$ijV2VPD$$Ht5t$ I?r $ !P$Ѕuσ^PD$L$ $QPj әXWV1N=56tED$@ L$1҉RRQWjP4At4$ h-$$^_VQ$ jh 'z" jVO" tPUt^Vh$$>jŠVh$$)j譊PD$L$ $QPj  XPD$L$ $QPj ҘjZXÐUSWV$$D$D$D$,41H$11D$h%$WSRS f~/P w`1A$ '5<< D$u[FtR=5<<D$,D$낃g<<8#u(@j L$ QP!1 $D$8L<<P~h@$)<<8#u)@j L$ QP0 D$D$8<<L$QP[ j D$ P5<<0 D$D$8c1Fj D$ P5<<U0 $D$85<<h0%$8!3<=56u-56~q5561ۋtVP{uJVhk$5FtPh&$FtPh&$ j -56C 9|?,u)É\$(k <D$jW D$PW Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0F1ɉQD$ P4脶 D4D$8u 8tz`Xt$756u 56-56CPVyt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP jU |$tt$ VUWW  UW 8C|$$8D$@PW7tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWkt!t$ VUWHW #|$$tS9u$UW RW $D$utSPWo uWh%$|+1ļ^_[]Ë .3DQu &E$D$$jPq  Él$|$$jh3($V]& ōjZD$ P$4P>& u-t L$PVQ&  Ku$,l$$t #t Z#t ắ]"Ạ8%#'$, PW th$ dh4$D$ ắ]"1ۃ=56yhR($Pj t$Wh:($T.#'jj@OD$|$ tjh3($U$ t9$ٺJ"pt D$(Uhn($ D$(UhYb$hPD$0ffsD$,t_puD$(moun$D$L$(D$D$$(h%P+1G@F9NjD$|,6VP>O ɉD$t3o-uj=SD$ p4t$ N @OPt$(h)'5<<0Ƌ$t ,76t'tOt@tO t=076476 s=476076g@tOy 2sg st1A T$ J sh"V-876$fyhP%V-L$ A$I$sh,$V-L$ A I$sh,$Vo-L$ A$I$sh,$VM-L$ A|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3j)9}h"݃D$,|%L$,9QPh/$hx/${W<1H ^_[]fUSWVd$xj[Vh76 j@V)t4$Fj:VGA $$|1D$hhhhh hh(K H|$WPh^$VYtPYPVh/$蕋 #CD$D$ @4$D$ UhD$PX D$,$Uj$lSR V9rȉ$`WVSb0 jD$PW$lPjt$hD$(P t.2,$AuU=476uLD$D$ 1@D$V $t)ɋ,$t;|$ h/$R1<76$@76,$ 876D$ @tL$L$fQP$|BD76D$ HJ@BB@76u@76ȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 54<5!3\$ \$(4Y&\$$} ]D$,D$D$D$D$ D$h/$WS H$,-'P5<<\ 3$L$T$,Jjuhh-'5<<#P#뇉=<<jh0$W t5jh0$W tZPW $T$D$0PW D$0t 8D$ D$(JD$0PW D$0t 8D$ vD$$c54Y&$T$$MA QD$5<<D$o5<<D$1@D$Q5<<tD$ 1@D$35!3)h4u  }WtD$0PWu|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5<<h/$h" 5<<h 0$j Wh0$PWh0$Wh}1$ PWhO1$jx Wh:0$[PPh1$h'3w jlSWV$t$$$$\$VPWS$H$HTj S7Vhf1"-" D$@t$hW0$tt$t$hd0$t t$ t$ ht0$t t$4t0h0$tjt$h0$t t$)/t0h0${tjt$ h0$ft t$ h0$Ut1$^_[VhK0$jY WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRh)1$X uUD$ L$$L$D$l$Y&\$ D$L$ |$D$ fD$l$|$l$D$T$]h61$j WVPt$jWV 9u9t x^_Vt$h"j5 Vt$VW-t@^h"V^Vt$VS2t@^h$V|^WVPt$jWV 9t9u x^_Vh"j WVt$|$ VWf t$?/tWh"hVh"Z^_Wh"j fWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ1 PQ4040<8<8D@}D@LH]LHTP=TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8<8D@cD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7Vw wV FwwVFwwVF^_USWV\$l$EffEffCEffCEffCu u\S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuu}SCu$u iS$C EDȉCDu,u(MS,C(E@ȉC@u4u01S4C0EHȉCHuhr2$=86<$=<<hj$W2u86G=<<1#PPjPP21@D$$<<1"PPjPPj86m<<1C8$PPhPh< 86P9<<12$PPhPj,86 =<<=76j:WAj/W.?y86<<4$l$0UU݋\$UW|$Pv 486086s.3DH,WѰD$hְ$W1h+&W176W 86N1h9$PPhPj 2,86 .3DHW=D$<$76hb3$!3=2_=86tVh3$z5<<hT3$j5<<h2$Zh3$Ph"j Wh>3$9Wh8;$.D$ =86u1= 86@86$1󫍄$,B76Al$$+D$ - 86t1$ 1D$$$MljL$$ PW?t$h#4$ 86l$Ul$RQPS+ $׉ȉ 086=4861| h4$$t/$$T$9‰sQt$t$WPh4$tFtA 86WPU3 u54865086t$hA5$|$(F=$PUy uRt$h\5$f A#$=`h886hK4$1=86 $VhHu Vhp5$al$VjD$P5 086- 86-486݃=86~VUWt$h5$\|>9|Pt$t$ )̓ }4$}.\$l$ 7676ɋ|$  76=86 4865086σ|,@σ|1ҿ9  869|щ 76|$ D=86Ejjh8860 .h886hp4$76=86t7686t&hQh5$5l 8676t=|hPh"6$ l =76u1=761@76=(86u 76(86=2,=76t#jh6$hq6$hf6$k76=$86u=276$86t$t$ t$4Ut$$Vt$t 9t V t U = 869$Pt~Etƃh2$Bj sQPh6$jd$8PX j: j0 j& hV% <<6$ 86086ApQt76@jxQP$Ph2$ g50PVh6$jd$8P X$T $|$8jU$Pt $,PSf'u/jZ$P$\PH u$4mfsjWV 9uD$8%PAP$Ph6$h5$|$D$D$4jP $u/h886h4$$Ph($jXv h[#j j /dev3886 <86/ D$ =86tD$ 886<$~~l$4 $jWhf"; u ƃrl$Wl$$U&MGWU&:l$ ʼn\$4Ë$H$|$76\$L$ u D76$T$dž,<tx(=86dž dž,dž(Ɔ 22u(jh;$Q=86-5D<6u"jh;$Q=86,5D<6 76N076F4Qt$Qh <$gQ=86w,5D<6F4Ht$Ph6<$$?=D<6O0 9| IУh<6l<6= 86u\Tu))Уl<61VVjhjPVp<6uh<69l<6l<65l<6jP =86G486 0861ظ|(RQhl>$> =86486 0865p<65 86~ ș)dہ|481'GuȹC=86tL1$PP$$576V1= 86VhZN 861u;1$VhjVu  =p<65D<6h`VW =86tWV5D<6x\p<6hhP 1@$=86h?$r=86|o5D<6N,I\Tt~!NȃN׊Nd1 t1WPh $RRM;$j'39u1H$Whht@P  PPftu!ѡ86t $ Q$=86u$|&D<6H,$$DŽ$%$ D<6I,$1$ DŽ$1h\'3D<6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h@$o=86Y D<6j5H<6 5H<6FU $F +$^D<6$~J`^p=2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=86uFh$ NlK`ڍOȃ$ډFd;v&h?$m=86D<65H<6F $11ہ~U uv`щSAD<6$~!ـ1@ H<6Il D<65H<6F=2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5H<6N uҋD<6B8H!tk)D4D<6B8)Nj5H<6$9sE)ȉـ1B~U uv`5H<6F$CHu͋D<6B8$؋N9ȉ$J`~U uv`щSD<6$~!ـ1@ H<6Il D<65H<6F=2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45H<6;Vs2р1@~U uv`5H<6F$BɋD<6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$\<6H \<6V$P V PV~x; `<6up=86td<6s4PP D<6X<6@X<6Kd15d<6s4d<6\<6 D<6q4jP  D<65H<6{0 9 p<6PVQ  =86tp<65D<6P5H<6g D<6y0p<6$ryxtG$\W%TuCl$AP$ D<6Ou$ց\TtQ!QЃyId t15p<65h<63 5D<6\TG~8^xN`1?9'l<6+$~0lj$Ɖ$)ى$=p<6$V%Glp<6l<69wߋ$9w$D<6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=86} $H$$$~A=862$=|j.5/扄$O1#tD?% D<6ׁ\TtQ!QЃYId t1RP$Vh>$/$$;$$|W=869D<6H,t =86 $$ DŽ$j 7.DŽ$CD<6;X,/$~ j .=86 $hjPU 2 86+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A*$h@ $l2fDŽ$2t2$_ lj$DŽ$D<6H4$ $ H5D<6D@VL!! $`Nd8) fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$2@ lj$DŽ$ D<6H4$ $l$h  5D<6D@~L!! $߉$Nd t1$Sv4$j2D<6@0p9w Au1H$$DŽ$1$$t( ǡ86D<6@0586V$SQP$h$l 86ɉ$$$t RP趜$CPKT$l$hߍ$󥃼$$tA$ȃ=86CX$tFDŽ$PQ418$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$蚛$pthj$P D<6\T$$i$$ $$$$DŽ$H0$$_$ D<6@$D$@L!! $`%$hK $l$  D<6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h D<6@$D$ @L!! $$w$$+ $$h$lD<6Hd t1$S6j$$V D<6$ȔȐG$11F$t = 86$$=D<640=20w4w+_1p<6$`SWPB $PjSy =86t$W\=86tp<6ǀ\8 D<6=p<6x\hhP 86QP2WV=86tT<6 D<6q4PP׸ 5D<6HLNd t15T<6v4t5d<695\<6vG=86tD<6p4VVx 5d<6X<6@X<6=D<6Od1Vw45l<65p<6D<6@4P5T<6e^_[]ÿWjV 1= 86VW\h#D%Bh?$2Zj&xj%qj(j<<6j YjRj'KjDh>$Lh>$Bj)j"jjj jjjjjj USWV=86ua΋\$= 86t 86<<6St$P. 4׋ 86UPSt$$5P<6\ 9u^_[]k0< PWVhf?$$j$JUSWV"=86΅ t<6uD<6H4H h<6 t<6 = 86;086486D<6;}FWh H1'1I!;HtG#P;Pt;H uV9R_1ڍ_5p<6P= 86Wh De^_[]USWV΋L$l$= 86t=86teUjQ3p׋ 86SPUt$$5L<6ԙ 9t?0 PWVh@?$Q"j" 86<<6UPQ ^_[]SI`wD$$1'1C:Qh>$h'3f$ .  [SWV1ۃ=86։ SjQ, =2@fF F)f ^_[USWV Ӊϋ5D<6F Nd t15H<6G=86tH<65D<6PP跳 H<6yU +y/\$|$y1U =D<61=U L$D$uq`|$ G`Ӊ $u щw*l$$1'р4l$skPh>$h'3" =D<6H<6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah@$ h_@$h@$T11҉ ^_[]ÉՁ|$U u L$I` L$w$$1'ʉـ1@BPh>$h'3! 8ʍ 6ʍ   1$5D<6$~3%)1@ H<6Il 5D<6H<6K=T<6Od$sC=2CNdЋT$ t1҉t$VQPR{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRt"L$|$ щT$ՉD$ȋL$D$VW|$RP*"ыt$ʋL$Vt$QRP$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45D<6;F8|$}X1Bσ) H<6yU uI`1@5D<6;F8|$|=86tH<6VPP 5D<6F Nd t15H<6USWV$΋=D<6G Od t15H<6=86tH<65D<6PP胮 H<6xU t)h@$P=86(H<6xU ‹l$(H $t@\$=86tH<65D<6PP =D<6G Od t15H<6wD<6T<6HC, $9r%UQh?$ =86VD<6 $\D$jT$RPQ蕖D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5p<6WD<6\Tudp<6jpxt$0t$ T $<=86WV1L(ɉL(@ u1LXɉLX@ul$p<6jpxt$0t$ $,;=86trUV胪1tttpHTtDpC u1"Cu) =% $D l$hVU =% $D9Pl$D<6T$5p<6p0^_[]jj WV։σ=2ȃ@PQRu =86t'ȉGffF=2u GffF^_fUSWV$8tWa ƅuWh"j軰 $$<$4D$Phd@Up tg1OVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh$t$H 1 Sh("UX CPh9"U C PhE"U CPhW"U CPhk"U $@D$t P' 1-Uhzd@$<W t1 VhedAW hjU D$ P$4rD$, 9L$L$9u0$S11:;8tx$0hϗ"蕗b$11҉ $ƅ*ŰP-j PU ^_[]$0h"jn USWV01ۍD$,ShPSu91NtAljSPSWuWC uMU D$t$$$Q1e^_[]fWVt$|$ VW t$?/tWh"x%Vh"j%^_Wh"j觭 fUSWV|$$\$(SWt$(t$( )jj`SWe~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPKE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVZ 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj$u Vhp5$ <6<6%<6ʼn߃=<6~VWUt$h5$3 |>9|Pt$t$z )σ}4$ |<6-x<6uU-|<6uY5<6=<6<6@19lj| 19ǃ| |<6u x<6͋5<6=<6<6ˉjURP =<6l$ <6uA@19lj$ $t$u h<6h4$jPVWv|$wext23$2fs3$ Wh"h<6h1'Vh<6h4$} 19ǃ} h5$ <6t$VUt$  U~{ t 9t Vl{ jrUSWVӉ $a|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h4" QPWUt$t$hd" t$t$hђ"j蓟 WV|'3Ph4A$V 1GVWjh"׵Vh(2'|WUSWVu} D$8jPߝ=@65@65|<6%UUUU)3333!!щ%ix<6B<69922T$u tv|$΍Q@6@65F6 F6VT$ F6F6ډF6P…Ƅ!) F61f1ҁ‰t$$r=<6<6\$9D$ F6T$@61t$$ËT$ u׍؉)9H1D$ 1<6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ<65@6@62t$ƺQ=F6D$F6D$ F6@6D$@6@61 @65@6D$8@6@6@6S@6@6@6N5@6@6A6A6[ A6f@6 f@6@6 2fA6\$H$SWr 93rWhA6p 5<6|$t"VϗYjVh A6v 10A6D6tA6pA6@6D$A6 @6+ @6 1҃r1I15@6~σRVPW}5F6H19w+5F6|$OL$)9r΅u A6f5vA65|<65F6VF6YVjP GD$AD$ 11L$\$@6@6tn A6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& F6@A6t vA6 F6@ F61HF6L2 F6D1\$;|$t@6)áF6f\0 F6D1 @6u\$fT1 F6T1fD1L$ G;|$tD$ @6|$11t$@6@6=<6~i |<6 i{5x<6Q5<65<6PRuh'C$ @6 |<65@6PQWhdC$cF6@F6F61QQjhjPQ\F6I 5F6jP =<6uk<6 <61! V5<6 1N1Ƀ * q&Fu  1@D$$=<6|>hF$3=<6|(L$ @6 @61PQh $PPD$$j'39u1H|$LWhht@P PPftu!ыt$<6tL$QT$=<6uL$L$D$ 1D$L$ 11T$h\'3n=@6t$tX A6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5A6@61@6 5F6D$ hh@6PL 5F6F6P5F6Vt$* =@6=@6 F615<6ǡF6)؉1t$ P =F6WjhF6) F6H9|$u_@65@6 @6)ʍZ9s1GрF6B9r)F6VhP t$ 1Ƀr!11ƃF6Cω 9rωp 9ǿs"ˀF6CI 9rޡF6L$  F61ҸF6Pt$ 5@6VjF6P  F6 F6L$)QhP u1F6@ uF6L$ D F61ҾF6Vt$# 5F6jV =F6tb1=F6t 12 HG6F;5F6rF6L$ D F61hF65F6 G;=F6r=<6t$|\tX=@6te A6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=<6|$T$T$|ʉj.t$몸O1#|$|$tD?% @6 @6jQt$,Ph>$T$;D$_=<6* F6t=<6u&D$ D$D$j e1h#/~ j ?=<6d=@61A6$hjVq fF쀁fFD$8FFF譶 fF5F6 ׉؉t$ ֍$fBt  A6$,F܉VDF81 L$ F4D$4z F61CL$ =F6WwD$(\WbD$S5F6tPjt$0d vA6 9`L$97|$0N@6L$,ʋL$(T$F61GL$ T$D$  A6D$@6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP> L$ D$1t$V F61CL$ \$vA6 F6=F6t$,9sD$()QjP t$L$ D$41ҋt$(VW'V$Yj=@6tA6t +232$2@1=F6à r t$hhjV( fFAfFF6ÉFD$8FFFY F6fFfFV F6AFmlj\$r*D$p1ۋ F61zC9uߊ F61hF65F65F6f582|$D$1ۉt$ :2x1ɉt$)rF6RQP! Wh42F6V轪 42F6D$ fF6 F61Vt$ \9\$t5F682D$ CiL$T 1VhVD$pP 95@6tA6t22#2fD$TAfD$V 2ƉD$XD$8D$\D$`D$d蕱 fD$lfD$n F61@D$pAD$| F61hF65F6iL$Tj fA61ۃ=@6 5F6<hh@6WO 5F6F6P5F6V1 5@6 F615<6ơF6)؉1WP5F65F6Oe^_[]hD$hE$ D$hC$Ph>$PhD$hJE$Vh\A$RhA$PRhA$hVhA$hVhB$RVh0B$WhkB$VPhF$hF$vjVWt$hB$ghB$`hC$Yh?$RhB$KRQhC$BC$10D$'hD$hD$"hD$hD$hD$hE$ hD$hWD$jq USWVF6=@6tr A6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(F6ЃA6t vA6 F6Ѓ^_[]SWV=<6u0׉΋ <6\$QPSt$ 5@6g 9u^_[WVhF$heF$j躉 USWV=<6΁ F7u=@61 F6 F7<611;<6-<6ǡ|<6@69v@1Sh4'8!;HtH#P;PtI$KH8 H8@L$H F7@fP\$1ҀڈP@ G7P $G7P ; jhG7j j5F7豪 hI$.31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQhQ$P聵 Hơ\H7 XH79}1Ҋ\1A xVWhHG7hNQ$ hGQ$Yh'3蔌H81B I8H8@H8H8H8H8H8H8I8H8 H8 uCءH8Q8H8Q8 H8 Q8H8 H8H8 ؉+H8H8D$HT$Ll$HH8+H8D$8D$85PY&v?|$ D$ fD$l$\$4l$ D$4Ӊ H8H8Y&whG7 R8R8 H8H8R8H8ʚ; H8H86eĉH811ۋR8R8D$T$ ؋R8H8D$H8D$H8D$5H8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05PY&Y&t$v H8H85H8=R8|$(t$(|$D$ fD$ l$ \$,l$|$,=H8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5H8 H8=H8F7t 1AF7y7\H7 XH79}(R8i-@=B'H7@9uR8e^_[]h Q$h>I$jXm USWVhH8j 0G7TY&\$Du{'-H8H8D$hD$h5PY&\$Dݜ$݄$hH8j记 u{(-H8H8D$dD$d5PY&݄$\$DH8;F7D$DH8 H8 t]+ H8H8$$߬$H8+H8D$\D$\5PY&Y&s=H8uZF7tQH8 H8 t5+ H8H8L$xD$|l$xH8+H8D$XD$X5PY&wD$DD$DH8G7 XY&w١H8 H8 t>+ H8H8$$߬$H8+I8D$`D$`5PY&D$Dw\$8F7$fDŽ$jhH8jB D$8 \Y&|$&D$& fD$Bl$B\$Tl$&t$Tj$PC SD$lD$lPD$,Pj5`H75dH75F7C <hH8j dH7D$8<BC97)؉D$D$8 T$5'\$A9hH8I؉L$A H8Iff9uH8H8XI8H8TI8H8PI8`I8 dI8uH8hI8H8dI8H8`I8I8F7 1D$1<8 '8l1A h$J$xQh'3AF7<1A t$, PVhHJ$z ΍T$(jt$>Ph,P$DD$ F7t$؉T$΍T$(jt$F$ 6'hL$΍T$(jt$JhvN$΍T$(jt$bF$6'hN$΍T$(jt$$Fft$NfQPhO$ ΍T$(jt$؉t$h1O$΍T$(jt$^؉t$hIO$v΍T$(jt$z0FT_hbO$G΍T$(jt$9FPhO$΍T$(jt$ ؉t$hO$΍T$(jt$؉t$hO$΍T$(jt$d؉t$hO$΍T$(jt$9؉t$hQ%T΍T$(jt$X؉t$hP$)΍T$(jt$-؉t$hP$3hxO$PhO$ L$lL$AQ D$iPhN$hN$ hN$hN$NhQ8hO$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظiK$L$dT$C;$I8u#Ph(I8QD$XL$$ D$L$I8PQh(I8  T$ҸiK$u1GjK$T$PL$r |$ rId'3H d'3~\'3H \'3 h\'3j B(  }T$A{^N2D$ˀ) hoK$uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhtK$yhSK$c9 |$ sSd'3H d'3~\'3H \'3 h\'3j   }KF߉Ήs(T$h[K$L$T$؅t%d'3H d'3~\'3H \'3 1I h\'3j bh\'3%}ءI8;F7*؅tءF7!^L$AQ T$Q=TI8 PI8 t+)|$L$p|$tl$pXI8)ЉD$PD$P5PY&pI8pI8xI8xI8H2vH2H8vH8\$CfK%I8f!tQ8 I8T$ .KfKfI8D$ H8@1ۺ9T$t$,@ L$IfɋT$8RD$4\$T$T$$T$ $L$JH8@)t2(uK Q8F7t1 Q8hmJ$ Q8 F7 PVhJ$@ PhQN$hL$hL$hM$AfPh:M$h_M$hsM$hM$hM$hM$hM$hM$hM$h N$wh%N$mh?N$c Q8hJ$v1BD$D$pfP2@)f~\F7tSωL$!ȹT$V!RPt$ hJ$T$ D$,F7t1RT$D$fxf5P2F7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BXH7C9D$=F7 ؉T$5\H7|$7H7)RQP\ GD$9L$~D$8:H7uG9u߅uQt$,; L$IfɋT$8RD$4\$T$T$$T$ $L$E5\H7)H7t$>RQPhK$\H7;XH7}0u hU$cPh6#QCы\$1B\$D$\$D$T$jh-J$j,\ 1AhE"WVB8I8~b I8I8 d'3Qd'3; t'3h\'3j.I8 \'3Q\'3.H I8by`) I8I8 d'3Qd'3; t'3h\'3j?I8 \'3Q\'3H I8|tN= I8t4d'3H d'3~\'3H \'3 h\'3j  I8I8h\'3vh'3zvH8I8H8I8H8 I88^_jj1A1=I8P跸USWV׉E\$1AMF7]E uWVhK$$t hK$ShK$F7t5@D$ \Y&\$D$$K$F7fyuh'3je^_[]UVh1AtD$HG7$K$uH8D$$K$`I8D$$K$KQ8tD$$L$2H8t9+ I8} $ L$!L$LD$L 4Y&D$Ht$H\$$CL$$  I8F7 Q8L$DD$D=pI8@|-xI8\Y& H2 H8\$,D$(\$ D$\$D$\$D$$VL$/F7TI8 PI8 t5+ `I8dI8L$XD$\l$XXI8+hI8D$@D$@5PY&H8 H8 t7+ Q8Q8L$PD$Tl$PI8+Q8D$P$蒼 ^_[]SWVyYF7t%<t^t3F7D>L> QPhQP$lF7tkD>L> QPhrP$F|>uGD>F7ufPhP$ܻ"L> ffPQhP$踻 ^_[WVF7u8jjVJ t'86ڶ PWhP$hhQ8"6赶 Phk$hhQ8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hR$ $t$t$ t$SPhP$ź UPhP$諺 t$t$t$ hP$蒺t$ֵ PhP$xt$ 輵 Ph$^r0G9s'GPh"8| KG9r߃$^_[]fUSWVƀ8-uFh"V=u R8h"V1u R8T$,11CD$D$hS$Rt$0] Hw؉$`6'\$̃duE뻁뱀=R8t\랉\$떁댁낃u1 !31;L$(ujmz1L$ 1ɉT$Љ $PlNL$Au $APzD$t2ڋL$ PW8 WNf uމ$D蘴uY|$ujp5 Džub PSxm$t8=R8uIj Vh"v WhS$T1FV*Phk$VP SU, h"=R8Mj Vh"  Wh%S$V \$O1#I"YS$VWS迢 jjVWS豢\$u( 1GWWWjߐWjԐWjɐWV躐Wj 诐VW) u h[S$j1P jj) uKhS$8j uz' j j jg) t)qtOQ j j@) u~S$8t1Aj jh"ן ukWhJS$jhS$)t$U + S$Q7膒0WW( S$tO1#V=PShc5%WN SWh7S$j_AV7&=R8uO1#趐VPhS$h'35j fD$tPhT$u}h8'PhT$h'3jάUSWVPu } h8'WVY cR~5StET R8͍Hw4$6'R8벃LR8R8둃ftTdL R8tR8eR8VR8GR88R8) !3x@R8=R8tjjh#%& R8ND$ jjj"M@ R8jL$$Qh@hP莀 u hr%5R8i )ލ<S H $6'=R8t1Aj D$<1CPS~D$D$ PS~D$D$$PS~D$D$(PS|~D$ D$,PSe~D$D$0PSN~D$D$4PS7~D$8|$ |$z |$o |$ d |$Y |$N F  S8D$8gtj5R8& rD$ D$O1#D$D$O1#_;-S8S,t.H$1ۃ=R8uWh1Z$hZ$h]U% >h7&SLg =R8uhZ$hY$h]U% 1CS8FLCSS H3 VT$W$6' \$@1ɍP$7'(S81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 120S8#S8L$L$# 1AD$ PD$@PD$ D$<+S8R D$ Pj$ S82 S82 S82 S8S8׋t$#D$ PjS8d$zT$ ED$ L$TL$@JL$C S8"2-L$#d$d$d$L$׋t$8S8:PS8@.XS8"@S8HS8 `S8\$ pS8S8S8 t S8t S81SSP L$Y\=R8j$)/jD$D$ D$O1#D$O1#S8L$9a|$u qS8 S8ta|$  ‰4 D$=S8T$tD$1@D$ ԉ1ۉD$0ĉhxShxS8 atgcuL${S8 S8zS8 V8@ V8S8S8S8S8 S8 pS8 S8tJt$(~A|t1S8t|$ ObTS8S8tPt$ tH@WVhS8D/ S8=R8t=R8u[$S8tMD$tH@Vt$ W. =R8t=R8uL$)[$S8tDD$(tIAVPW. =R8t=R8uL$(7[${S8tDD$,tIAVPWT. =R8t=R8uL$,E[$.S8tDD$4tIAVPW. =R8t=R8uL$4V[$S8 tDD$0tIAVPW- =R8t=R8uL$0c[$xS8)f=xS8=R8tP=R8uG=S8t4d'3H d'3~\'3H \'3 h\'3j [xS81=R8IWhxS85R8 u+87tut)7|$t+u-Y$/9|$PhW$!Y$|$Y$ PPhW$蟺83u= S8t"1ۃ8= S81ۀ?D$ hX$'USWV,։hY$\$,PVh:'hSdh\'3Sd'3H d'3~\'3H \'3 h\'3j 芥11Ks3|,„u u_tIAD,@ u1l,uS]tKtW1w)ٍQPRw SUD$P2U t$6 _5R8U4 k1w)ٍQPRBw SUD$PT j.hU8D$ Pj UPhk$j.hU8U8Ph4%]F d'3H d'3~\'3H \'3 h\'3j h\'3R0^_[]USWVD׋T$\l$X S8u S82 S8A $T$w $t8'2-t gr^rr r r2^h"%Wk$"t$1۽uj/Wi tōt$$^^^^^ FF\$SVh7&W{ D$$tE/SVh7&W{ n1\1ۋ$t.t) S8t$jtVW脇  L$PjVt t$F11$< w<w© <wKɉ$w'$1E$8' $F$1EF11Gщ;t$r.t벃뭅ul$$l$ Ej/WIV<$L=S8W{  E/1ۋt$~~jv|$WhQ V}y jWS |$$u|1ۃ<$uoFr%1C uW1D$ D$D$D$F Fu= &h%Vht# S8T$v1FD$)1C؃D^_[]ET$LW t$ȉt$V3CىD^_[]/t$VW t<$ul=S8tcWz ŃuhWVth uTWD$$L$ D$$HT$JHp 1V '.U; 1ۃ<$ T$t$e1C~ ~~~7&WhZ$hZ$|WhZ$j2 USWVP։Q ý S8t S89t;~11 F@Ft 1JʋFP\كF@FF1҉PPP P|FWhPL$ pL$ tND919^_[]WhZ$PhZ$j1 VD$ S8tw:114w "w w7ɉJ@ΉpfP ɀ:u r9‰w@^Áw뛁w렁vw닁wHfW1ցlSVYtt:uOq\ PVhp[$1D$hPQjkPVh[$Qy PVh~[$ʖ Q>PSVh[$诖h\'3bK^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjVZ'+D$  PW1PPWSjV"'|$dt$ \$h\$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t h\$h-U$QQh%PPh[$< C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh\$茔 d'3H d'3~\'3H \'3 h\'3j HT$h9t$ f h\$/ L^_[]hzW$ jh[$j-- D$t'T$tt h\$h-U$QQh%PPh[$ ËD$t%u'\$%tu\$Ph1\$\$!\$PhZ#rUSWV|$<\$8D$4t$0~u/jUJ u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWh="ВPhk$PWho#诒 ^_[]USWV|$4t$0=(V8uM(V8hh)V86t )V8'j.h)V8@t@hPh)V8( t"^tCt0Wv`rhh"%h0W8R( ^_[]1w)ȉPjQaj SVUH fEu jU>I WUu&Vh0X8ShO\$hh0W80W8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh0X8Shx\$hh0W8謏0W8[SWV$L$4D$1G\;'t$"tZ@:t9rD$PhG\$运,^_[SWV|$t^D$uFD$jjPH t1Nj0j.V>t@h)V8P^u7ut$觋 "%hVh0W8& 0W8^_[VD$L$ 1Ҁ0QRRhh0W8VP ^ thhD%h0W8> 0W8^Au yuyt$Qtu ȃPO QG} APh\$hh0W8*0W8SWVD$0X8Q4\$R+X84\$R,X8ƄR-X8.r|I4 Vhk$j =DY81t 1AFL$ tD$tVh]$(=$Y8u 4Y8tL$|=4Y8t@$Y81C=0Y8u WUje. yVhk$1ۉ؁|^_[]j:zSWVΉQhS0 t!1G=0Y8u%5WWVWh<' u;D$ D$ PCWWVD$Ph<' tt$TĨ ^_[]hD?%t$  tԉ1|$l$Vh$PVSFHt$t$Wh|dD$PTF \$tN1D$;D$ 2i9t$sVt$Mt!ʼnD$t$Wh|dt$F ul$$WhedAPE f$a$>ukSt$hf"h%h$WƄ$tD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hXb$h$S p\$ =HY8uD$]H$D$ P$P M8\$t$Phbb$HY8PU uUhk$1@$~#Qh>b$衁1@$\$$$Ĕ ^_[]$Phk$j oKPhmb$h'3r jgUSWV L$LY8$T$t-PY8*jhLY8f PY8šLY8$T$1i E$48t!u6$t$P&>T$ uF$t$P >T$ tEM<ǃ h4$b1 ^_[]ËD$ t 0LY8$4$݋D$ t 0LY8$$ؾTY8PhhTY8 uhTY8hk$jV fVD$t.})zh9hb$58|q l 9T轴D?%q%<'PQhc5%58Gq=#u58h $ l 9^ËD$ H^WVθq%<'PV<t)uVhSm$58p l 9SGt8tPwhb$x whb$fuj wh9e G99^_WVD$ t;59D$=(}8 8u (}8<';pt8@uVhb$j @u=(9th(9Phb$À Phb$賀u59=(}8^_Ã|$t b$l 9Ã|$t q%l 9Ã|$t b$rϲl 9Ã|$uh9hb$58So 螲l 9Ã|$uh9h c$58"o ml 9Ã|$uh9h0c$58n <l 9SWV$$DŽ$HH$p)Ƌ$ ƒtS!=X 9wc$trc$mc$atσ=d 9 =h 9 PSj $;rtr1Auu($$hVc$PQJ te$P$$hac$PQ t8$(1;BQPVWEV =ְl 9^_[USWVx֋$$t{tp11@=.3D_t1z\t r9΅t<΄t45.3AҀ|Vy5|.3TVP5.3@u΋$ $t`1Hh 9trʄt<$1ۊp 9t8tCu 9s 9B+$=FFu4$D$|$ 1  9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ 9<$؉D$9$to\[$uvz$\$-.3BDEJ<0HB,t ]tVрy$t[.3BDC$G)=~"B $tG)=BJB5A.3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$58hfm$ <$?uhVW x^_[]USWV0$Du%$H$Dh|c$PQ y1E-9hq&jUhX]8L t$H4$=8I1VV$PH Í|$0;=8=9$H5h 95d 95` 9s =X 9wc$trc$9ƒ=}8RPSQUy=9uE=8t<}8}8$Hct9}8 9VV$PO Å 4$j9xl 90^_[]Ã$D|Ã=8t=}8;1 T$󫋄$HRjh4蘷 |$D$=8ʉǃ=9$H[L$05h 95d 9j =X 9wc$trc$9Ã=}8VPRQw=9u9=8t05}8}8$H1t95}8G=8-=9$H$HL$05h 95d 9j ƃ=X 9wc$trc$$H9=}8PVRQv=9u_=8tV=}8}8$H1t9=}8$$H4hc$2sD$P E;$Dnj=8t#8@=u1Hjh""P jhX]8荐 WV=9t@=8t75}8=8}8815}8=8u 9^_USWV1@=}8S=8Fϻm$ͅtUShm$58c58 t$PhVh'3xd|.3L$DH?u"Ã|$t!hKd$h@d$h0d$58:\1胟1Hl 9WVt$D$ tu51>"W]Bth}#WKBt,1H71@1L$t&8}#tF>"WQhTd$R[^_h\d$h8t$t$\l 9Ã|$t=(}8t58hfd$ 褞l 9hd$h8t$t$l 9WVD$ tul1=P 9P 9F>"uhkt$~hF>"WPAt(h}#W>At1WH}8P 9F>"1HkP 9}#Phd$58~Z =P 9t5H}8hd$58\Z 58hl$ P 9t ,}8l 9^_vhd$58Z mhd$h(}8t$t$l 9he$h8t$t$l 9he$h,}8t$t$l 9=,}8t P 9h&e$h}8t$t$al 9WVD$ t+}&}.1=0}80}8}#蘜1Ht$u8vhF>"V?t\h}#V}?u$0}8}#Wv }8v]8hVW =|80}80}8=|8t?F>"?t5 85|8>z@#t5 }8RPhne$Q{X0}8#58jj6h7e$M0}81l 9^_he$h}8t$t$ l 9he$h$}8t$t$l 9WVD$ tZ}UuZt$~hF>"WH>tOh}#W6>tBWy7vhe$58W 1H_1=81@18 81Ҿ}#tF>" щ 8PVhe$58HW1=8l 9^_ËD$uD$L$he$PQ[ tvD$ph&f$gu<=l 9u0=(}8t58he$~ D$ph%f$tgu+L9x9x9֙l 9VD$ L$l 9t u]H ā8HQtsP t8 =x98t5hx9h>f$P V l 9(^KVh-f$;Pjj$hWf$VC%^ËD$tIDuD$L$hac$PQ t$D$ph|f$UfuL9Șl 9SWVD$-uD$L$hc$PQ  1G=9hq&jlWhX]8 t D$1VVt$ ǀ?tx=9tyD$thWh|f$eu L9=9uB=8t9=}8}8D$bt9=}8 9VVt$Q DžaSj致9|l 9^_[ËD$uD$L$hf$PQL tmD$_D$L$hf$PQ( tI|$BD$phf${du8D$phf$bduL9ÃtЖl 9USWVt$ |$.E1ۈ$58jj,hf$% u v1.Ll 9^_[]l 9USWV D$ #D$$L$ hc$PQ L$ ȃ#D$$L$ hVc$PQ D$ L$$|<$Dh#t$!t3$8|t+4$$H$f$ 3D$$hf$0D$1E-9hq&j7UhX]8| t D$$\t$=91D$ H9=89"t#f$9t$t#T$$VVP4t$Q9u?=8t6}8}8D$$" 9tA 9}8E_t$jV9$9t4$c9l 9 ^_[]SWV$tKjjtK~S} 9uWjد1uhg$Ò1Hl 9^_[þV! Fujj苯hR# Q$tj/V\ t@hQW =8t858V 8HQP~ Q Pj AR|j5, 9hR#WVb  jWVb Vhg$l 9jUCSWVPD$D$t&D$t$h=g$PV製 r莑l 9^_[ËD$phFg$^u|$hNg$, tD$x|$WhYg$^WPjW# uP|$hag$ t D$x |$Whkg$I^WPjW# 1ۃuM|$ Àu*D$p Vhkg$^VTPjVH# 858hsg$ D$l 97=x9t =x9u=x9t#hx9hg$58L l 958jj%hg${ËD$l 9ŏ=x9uD=x9t#hx9hg$58DL l 958jj$hWf$ËD$uD$L$hg$PQH teD$ph h$\u<=l 9u0=(}8t58hg$k D$ph h$a\uL9Ԏl 9ËD$uD$L$hg$PQ螺 teD$ph?h$[u<=l 9u0=(}8t58hh$ D$ph>h$[uL9*l 9ËD$t8uD$L$hFh$PQ tD$L$QPhO1# ڍl 9USWVh$V< $|F$$h1Gh4V 9}hhD?%V G9$uVhk$Zu jLTL9^_[]ËD$t8uD$L$h[h$PQ tD$L$QPhuh$ l 9ËD$thuD$L$h%#PQ輸 tHD$:D$L$hac$PQ蘸 t$|$D$pph{h$Y Ãtel 9VD$t$5(}8(}8u hh$Y%(l 9D$ phh$Y5(}8^VD$Hrl 9>5(}8(}8uhh$8YD$ phh$"Y5(}8^VD$t$5(}8(}8u hh$X%pl 9D$ phh$X5(}8^Ã|$u|$t5l 9Ã=8t 1PP)j=8t 1PP jz<|$u|$t܊l 9Ã=8thh$3X7V1VVcV-<VPD$ D$t}uD$p*{l 9"t}#D$ phF>"V9)t.h}#V')t"}#/1}8 }8}#}#1@}8 }8F>"F>"PQhni$58;B}8l 9^ËD$L$(}8ti$Rh\}8QPl 9d}8ËD$L$(}8ti$Rh`}8QPl 9h}8SWVt$|$(}8ti$Ph\}8WVsl 91ۉd}8(}8ti$Ph`}8WVHl 9h}8^_[hi$hX 9t$t$l 9hi$h\ 9t$t$l 9USWVl$|$$9~E1H^_[]Ët$ ~h+,%W;'t.hJ`%W)'th0%W'u1C$1|,vGxǃuv 1$o1FVj襠D$Vj薠tR|=L}8$P}8|$$t =(}8t/8 L}8}#tF>"5P}8QRhi$P?tR|=T}8$X}8|$$t =(}8t/8 T}8}#tF>"5X}8QRhj$P?t$j؟Vj͟1jt$ t$ M l 9Ã|$thhVj$Pu5=l 9u)=(}8t58h[j$ hj$OuL9x9x9@l 9VPD$ tK}F=`9tQumt$j PvBI x $9tBvhj$58> 5ہl 9X58jj/hc$S/@ 9D 9D 9 @ 9 С8tRQhj$P2>Phj$ ^V|$t%5(}8(}8hj$N5(}8@l 9^WVD$ =8u58hj$D$L$ h(k$PQ tq|$ j=}8t58h3k$4 89L$j qP3 8t.9F9,9u#ts999,9'3H '3~'3H '3h'3F< u# 8;49~F9u '3I '3~'3P'3h'3 '3 tu:Q'3~'3H '3h'3'3у u58hk$ͯ 1Hl 9^_NA 849158hok$WVD$ tkfuD$L$ hac$PQ tFD$jp謸lj!ЃtD$VWphk$58{;1~1Hl 9^_USWVE{uE Mhac$PQ t]E jpPT$$!ЃtI58E xSPIPWhk$V:1;C ~1H1l 9e^_[]ËD$tu}l 9hk$MKËD$phk$8KVt$ h9"jVt$tvvhk$587:^USWVD$uD$L$hVc$PQX D$pvhf$ktǀ8u0"WV,U`UWPr UhD?%S UVS S l 9SV|l 9^_[]USWVPD$uD$L$hac$PQ_ hf$苐tǀ8u0"WÃP茲|@CSWP =P 9@ 9$-D 9(}81(}8P 9@ 9D 9L$Pjhc$qVhc$h=P 9-D 9$@ 9(}8V{l 9^_[]SWV|$uvt$>h l$Wzt+hd%Wht hl$WVu: 1Cv荼tu&6hl$587 z1Hl 9^_[t8u88P58h5l$58j71VD$ L$l 9ʃuCuD2tK2VO1#tQPj h`l$587u^Rzjpp l 9^WV|$ WtQƋ|$@tP0FWdF=(}8t3|$t,P6hl$586Whil$58l6 ^_WV|$D$ l 9uIw_tAƋ@tPF6hl$586 l 9^_Rywhil$585 ^_V|$t.=T9t65(}8(}8hl$F5(}8(xl 958jj,hl$y^VD$Hrxl 9`=\9t$5(}8(}8u(hm$F-58jj,hl$D$ ph m$E5(}8^VD$u5=T9t=T$ 5(}8(}8Ju:Qh@m$E;xl 9058jj,hm$rQhHm$RE 5(}8^ÐUSWV@$(@u$,@tw~!$,@$(@h(k$PQ菣 tӋ=8~+$,@X19j USܻ t F9u19u2$,@pho$583 l 9@^_[]ÍD$h@h8P 9D$@1ɽ $L$99` .3OGGDA@u8ȃ$t \u_GGY .3WDQuViuAG;$(@}/$,@8)Q4V $,@4#1@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@8)QtV $,@tHt80舆tƃu58hh$'58hh$~ t;=8u258hi$ l 9D$@9G=(}8t<58h8賥 8HQP~ Q Pj J5j 6\$S t8t8058V =8t'~t!8HQP;H~EQh@D$Ph86 8$(@t8$,@Pj4븃<$JE1A;$(@t4fUSWV1$D$jh́8\ t%=8t 1PP1<$~KD$@$Ahvjhj <$t(=8t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4<t^8=8u 8D$ Y$-8}8t+h#Ut}|tUd8}8<$~D$@$D$<$d-SWV։jho$Q jho$W tlhp$W)tjhp$W uYt F t8t4ho$t8tjhp$Ws t ^_[(11VPP ^_[)WShp$j} USWV$\$@t$<|$j ho$W |$D$ 1D$D$SyƉ$PD0h,p$PM(t$Dh6p$$t$脛 $t|$@t$t$@ЃD$;8}8t|$tt$D$L$d).$`.$Y.$tM.|$Htt$HD$H|$Ptt$PD$P$t$eDŽ$$t$ADŽ$D$Te^_[]ËD$lt8uu L$DUuD=8}8t;P=D$HL$H+8}8tD$Ej/t$L t@Pt$Dh]p$t$HD$t$8}8L$D|$D$81D 9@ 9< 98 9$$9<}8t1$Pt$蕂u$\$` D 9@ 9|$pyL 9p$h^"t$LƸD$|$t$u$QPu5$8$<$$$\$` < 98 9@ 9 D 9t+t$j5D 95@ 9P-Y=(}8tPt$Hhp$58' D 9@ 9 tQPhp$58'58h""L 1O$=8K8 1O$*|$pu D$TQhp$5 _8ht$hW =l9|$Lu:|$LD$puuho$t$Hh#*uho$c~D$LL 9q$|$LD$L8|$dD$t$ho$ ~8P&$$Wt$<h%V-1A$<$ǀ?tvj:WT t=@j $QP%. ~޻t?$9u3;$u*W9$<r$)PWR t/h%V+-Džm1Ft$Hhp$1$t P$$u |$p$$@ 9 D 9t$Lt Vhq$t$d蔯t|$dj%Wt Whs$1$GGG fGs$P$xPW# $u2$t'8t"$tJ?t1hV%WEtVhs$2$(2WDŽ$t$D$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB p}8JBB D$(PRW$8 t ]]0. RtD$(Z$$PN-j j WhSvv t%h"PS j "PW =(}8t+D$(xt!~s$tt$WSP58"v jv_ Åx`=(}8u~PvvSvx)$P$P$PhO1#裈ykS. 1KW$Ph t$蓡 Nȉޅɍ$P PW$4hs$i0h1N=}8tJ$t$uP莚$$t$uPi$8~R9WhcS$[tNu1h@hNt$h8H %ut8058ދ$tPDŽ$$t4W9PjW- $tPnDŽ$$t4WPjW $tP/DŽ$D$(t P |$D$$h!j$8<tQohc$$辰D$$\t$ vj:8tV&=(}8tWhIq$58 t$$tI=(}8D$tPt$hhnt$hrt$581@t$ht$hh0q$f |$dwht$V #ht$Vht$Vӭ8tph7:#V跭 ȅu@ 9 D 958hnt$Ӓ 5D 95@ 9ht$Vq5D 95@ 9ht$581F&1t$lh~t$V7 $`#=8t"D$$u$tu$QP|$h-u$ tPh:u$Wج hKd$h@d$hKu$W辬D$$0$|$Pt1$tnt$tH#tD=(}8$tPh_u$58 FWhu$$8WM $$0t-=(}8tPhtu$58 FShu$W t=(}8t58h#4 h#t$ ۫t$t1V`}\$D$Lt$P52Ɖ$$ىD$ډ׋$$|$^8‹$4$8$ L}8ˉƉ$D$@1S$P8$+$$$$+$ى|g@By)Q襙j$PӤ$+$$$$+$ΉЃ||$`t$@$Dt$M$|$`tCt$5^85^8臢 h#5^8M|$`=$@$Dt$hWI#|h#t$gD$8|jj n$D$@h9"P\Q D$@|$@DŽ$pHD 9 @ 9 m!ڃt9}M#$H5< 98 9$$!;$$=(}8t58jj hmq$蚺D$T}D$@\'3=P 9=,}8D}8 @}8ƒH}89}%8HQP ;HQ#8HQP<Q 8tB$ڋ$!t 8 95< 91ϋ$H1 D$h#P h9"t$ D$@|$@tDŽ$@` t$D$@Phg$hq$Vhr$O@"^8)PSh%r$藋h7r$%Pt$Hh{q$jBlh\r$h~r$qbhv$eL$D$ D$8t$4D$ D$0D$D$,T$1@މPj Jt$ӛthr$jct$@$=@` $#$1V$W膠$$$$$$t$@Ѓt$@Wt$貳 u.58$PPRPhr$V  D}8=@}8| jjk< 9x& @ 9 @}8D 9D}8; 8 9u1D}8@}8D1\$  @ 9 D 9PL$T$ T$8t$4\$0r\$ (}81tt$hw$58  L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Whhw$W(VWhw$  Vho$1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhV%V @L$ǃuC=}8taD$t$uI$t>th x$V'1Ʌ $t}th x$U1ɉL$<=8=8t 1PPӼ=8|$DhPW/ |$L$D$L$D$ tD$ D$$=}8}8L$QPq=}88t=ut$8t$8t$ s t D$,t>D$Pj3D$T$"tQPhx$ "D$Pj詓<$l$,|$u'j/V>tG1|$t>tFhh &l$LU l$t$1l$ -L9D$Pj«9-L9*x1l$,1Kd}Z<$t3$DSVW腖 ShV%W& SUW <$hhJ`%t$LVK t$l$D$ D$<4uT5}8}8=<}8n$tc$hP|$LW |$D$Pj5}88}8uj/U) t@ʼnD$ D$$=<}8tAD$Pj?>uP=l 9uDh'3jhhbx$胮)1D$PjV8l 91ۃcÍL$%L$0d؁D^_[]1Ehw$PhXx$h;x$j萗 USWV օ\$ |$$jho$Q l$t=jhp$U t;jho$U t9T$(.C fCPC fC C 1}Gt$j/U2$t9lj)CSyS\$$UP { uG<$WxC Uxj@Vܫ|$$tZ{ u 8w@P}xƋ_j:S褫t@P\xG_Ot[uUnj]Ue$tYÊ@t<:uL)SUV Vɉ,$}:1j:VtEt$t$Vh&s$1ۋ\$ t3tHj PU }t $9ut=s fCt$t$Uhks$ CC tWt_uk}8KUVhs$  t$t$VhFs$ \$ n1HJ3}8(uO1#UvC{u{ V%tV%PvC1 ^_[]hr$js WV։2vvvGvvGF G FfG^_USWVȀ%t u7Qt*5.3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=8t|jj KMD$~h^"W/ D$|$n,}8D$ pD$'3,}8u Njhe8f t$jLD$=84}8xP)] 4}8|$tt$\D$jl 9D}8=@}8jLh^"V^D$|$t~D$ @` D$fxtD$xD$(PWJux.#D$0=u$$ < 98 9u h'z$58o Whg$Vh#jl 9D$tt$jKD$tt$j kK4}8xP[ 4}8|$ t|$t D$ t$Ѓ|$t t$D$$,}81D 9@ 9D}8@}8e^_[]Ë=D 9 @ 99" t^L$ hwc$VUthmc$VC9"u39HD$fxL$ D$@щυtSVho% Vhk$L9WD$|$Y8;e8v+ e8tQ48e8Pmce8jAD$ujj ID$=P 9tDH}8=,}8t < 9!ȉ'D$ !jWPt$-19HspL$1HfytL$IT$fztD$PV5T}85e85e8IE aPhmF# hNED$HQPD$~ Q Pà tWtiD}8 @}8;L$D$|T8HQP;H~0Q#58xH}8L$D$L$Pj#͋D$@ @D$HQP;H~bQ @}8D}8D$HQP;H~(˃ tًz8@}8D}8PSPj 1HjWQP蠩Ѕx,5D 95@ 9h>z$ c$u hp$nftcD}8 @}8;L$D$}%8HQP ;HQ#8HQP~ Q Pj 2D$@ @tu hmF#eD$@ @t$f8 t hz$e1HD}8@}8j>|$ tD$ t$ЃD$t$X1t$VD}8=@}8 Pj#%hz$hxz$h+hHz$DSWV |$$D$hc$W萱t D$c$=\ 9wc$trc$D$9ƅu=p9=t9 4F959t jVth{$j$=8959t jVtha8h~$t$ jhLa8 jhe8 hjEHa8hc$W| 8|t1@v58h~$;X M58h~$#X j#l 9!hjD$ D 9@ 9 tQPh>z$ \$$SWho% ji8 j%#D$ D 9@ 9 tQPh>z$ Vt$ho%j Ha81WW"W4$jCj"=Ha8SVh~$58B4$jCjo" ^_[Åu1t PU"=8t j  |$1=8P"=8t j  |$1=8P!=8tV 091j $,y h~$a=x8t l 9jYVV=8t ju!jk!=x8t l 94$jQBVt$ho% t)Vt$ho% u=8 j =8{jklWVd}81VA595Da8L 9rt suY%$$dWPV(u WhM$Vu 8Iu1IPVQO jhe8* Ph+$j}w USWVD$=}8pe8(a8e8jjP\j 4}88tL$jQjhP菪 e8<<=\}8w=d}8j=(}8=8u (}8h{$Ɖ=(}8~&t =8u!h,9hi#58 =8tCl 9=$ 58h{$S ht{$ _1A =`}8=h}8=(}8=8u (}8h{$>Ɖ=(}8~&t =8u%h,9hi#58B =8yl 9=tT$ wJ58h{$R ?{$tgd}8h{$=8 {$3{$t2h}8h{$~=8{$PASV3Q LPSV3Q QEPSV3I1  $l 9=t${$ <$$T$$$VRQPWh}$ha8q }$$:$:$:$e8 a8D$ffe8k= }854}8UN 4}8}8=81e8(a8u fe84}8t PN e8jjPf 4}8=8u(QT$ RQhP 4}8 e8Qhe8P 8tjD$ Pjh54}8蝦 D$1e8e8e8e8e8e8e8D$Phe854}8 OD$e8j54}8jy h}$u[=8" e8$t#/=\}8=d}8=`}8=h}81)L$ ׾e8󥀼$u DŽ$$j j $Qh$QPR =(}8=8u (}8$P$Pt$h}$Ɖ=(}8~&t =8u.h,9hi#58 =8+d}8 e8tPVe8 e8e85e8=e8e8SWVRQPh}$He8$e8$e8D$|e8D$xe8D$te8D$pe8D$le8D$he8D$de8D$`e8D$\-e8e8=e85e8e8 e8e8PQjRVWSUt$|$$$$$$$$$$jjh}$/X=8[=8N81ۉht{$kX1A#hV}$hu}$u 81ɀ=e8D$jD$ Pjj54}8跢 1Ƀ58h{$]L 1E=e8l 9=$ w58h|$h,}$W54}8I 4}81AJ8;l 9=t+$ w!58h|$W58QK 뗠e8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph|$ha8 , |$ |$|$1-e8-e8-e8-e8-e8-e8-e8fe8D$L$  ȋL$$ D$( ȣe8D$ $ fD$ L$$T$(t$\$VWRQPSh|$ha89 1-e8-e8-e8-e8-e8-e8-e8fe8D$L$  ȋL$$ D$( ȣe8D$ $ fe8f e8;a8e8jPhe854}8`1ɀ=e8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph|$ha8Ѫ \|$ |$|$1e8e8e8e8e8e8e8fe8Le8@uD$ $ ff e8jha8he8 58hs|$58h{$58h=|$58h|$58hs|$= }8USWVX=}84}8tuPjjPD ƃPj54}8|D t$4}8D$fD$D$jPi8<D$T$ |$ Mbt$1PWhT$L$+T$ +L$(x@Biy1PjV>a u>8t48#th.~$uhO~$ (a8t$4\$8VS54}8D ǃu+8t ۬8#uoVS54}8C t׉54}8C =4}8t$jW/C ut:|$9uD$0jPjjW薜 V54}8Ehr~$Q54}8?C 4}81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ 4}8|$ t<$t D$ 4$Ѓ|$t t$dD$8,}8D$4$}81D}8@}8e^_[]h#u ޘE 8|j/u ( 辦8t账8 zt ;u t"E "} V%te%jPV%jP/].=\ 9u+Q8 uhu @ =\ 9t&8 Q|$ 9tE99t jP[jSI< 98 9l 9A=6t jjk[ jhe8 t~jhe8~ u(hj+=8t$M l 9D}8=@}8j+u hz$J{|$t) D 9@ 9 tQPh>z$ Ut;tSuho% uhk$ h^"mD$|$}t1uu $<$t{D$ @` u hz$;h#u GtbE 8|ujj *D$E @h9"PI $<$1,}8$}8D$ p(u h#fIT$\'31,}8$}8$fxt$xD$`PWot#D$h=t 1,}8$}88;e8v+ e8tQ 8e8PDCe8j!=P 9tH}8=,}8t < 9!1ǡ9Hs:|$> D 9@ 9 )$fz$R|$0|$D 9 @ 91PPPt$ i KD 9=@ 9|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q Pڞ t u\$,ى;=@ 9D 9|1jPPt$ \$0D$HQPD$~ Q P] " t ]Pj DtiD}8 @}8;L$D$|T8HQP;H~0Q#58yH}8L$D$L$Pj#̓@}8D}8D$HQPD$~ Q9 P芝ǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 @}8D}8gPQۋ] D}8 @}8;L$D$}%8HQP ;HzQ#8HQPQ 1JjQPR8x~L$1HfytL$I$fzt$PW5L}85e85e8Vt8 t hz$D1HD}8@}8vu hp$DE @Phg$4Pj D$@ @t$8 t hz$vD1HD}8@}8$@ @tu hWI#PDj|$ tD$ 4$Ѓ$t$1t$V9t$t*t$hz$58 58h{$Q8 D}8 @}8|$| j%=$}8D$ =@` jSwBT$DD$@!уk։1\$HPSAYs{ 1CSu l 758} D$@P|P6DPWhI{$VPj#2hq$hz$h3hHz$USWV\$j/S t"V%9tjP/V%te%jPDžxxy8hShy8W ƀy8.uey8G1dMt[G09tÉ؉jhy8Fx.0uO.u1GOtShz$B1^_[]58h3$Z6 SWVd|$t1F5}8j"jdh|$SLV 8Iu1IPSQ0 W9Vhe8U SWV09 f$D$@=u1H$jjSPKt h|$0Ahh$509 509 t 09j Dž,y h|$@=x8t l 9j9t+t&1ONthSP0 ju=l 9(u jju'hZ$l =x8t l 9j8^_[V迚0}8j Da8螚0^USWVPDa8h;j |$ 8te$e8to81@K$to8e8188E8 l9CthQPT El9 < a8 a8<(a8(a809<<0909@@099DD99HH98LL8X 9PPX 9\ 9TT\ 9` 9XX` 9d 9\\d 9`;p 9VQPR VWp 9PR q; 9VQPR VW 9PR h 9h 9; 9VQPjR VW 9PXR 9VPSAR VU9P/R 4$Vj=Da8tDa8jփ^_[]}8j&=8t#8@=u1Hjh""PM, x819Da8jhLa8 WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR1K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t58h$0 l 9Q 0911j1xt5V9 091Vh$<l 9jR4^58h$[0 fUSWV(Em1hO1#S謢$@0 }8}8%}8% }8h$Y $t }81@}8}8}8}8 }8$}8(}8,}80}84}88}8<}8D}8@}85H}8L}85P}8T}85X}8\}8`}8d}8h}8l}8p}8q}8h$X tVPhq}8GO 9 It8h"X >"t x8hԀ$X h,o$PztFhd%VhtJh2[$VVtu 0}8}8 }8h$W |8t8u|8O1#O1#=0}8t8uh$e 0}8t$hwU%jW th,#P訅1'31N9tQu88\'3j'39tVut!(}8tRt ,}881Ɖ‰׉hS$$D$D[ X̃Dn<$$@='p}8D$j P5<<#9 8D$8$tS5<<hq}8L $9X<<}8i1g 88S8D}85<<}85<<0$1F1@(}8,}8p}81 }8}8j15<<0F858<}8$t$j h#VK t$(5<<P0D$1FD$h%P t8D(@ƃuӾD$(jPV3v ft$讆ډ8}85<</8}8h#P迂$8'3}8 }8D$jP5<<6 2D$8$1}8ED$j P5<<6 8mD$8$T8$4$5<<:8N85<<h$? D$PPPhۃ$h'3Ƶ1@(^_[]Ãl$t$ 11GVWV58o !3)$<$@5858=88t:D$(ppppp  p}8Hx8h8PVS臑 5ā85ȁ8h #R t8tP-ā8/ tPqƅu] Pmrƅt=ā8O6e-ȁ8=q}8ā8uetahPhq}8bH =wVhG$hq}8H 9r&5ā8j?PVhO$ q}8ā8uhV%,ā8 V-Vh=$PG Vh#($WH h]$cQ tlj1WQho$| o$V:Q O1#O1#tWQV| o$VQ مtWQV| o$VP مtWQV|| o$VP مtWQV[| hi$P 0"tWQhf$4| ho$P y$tWQh!# | h$aP مtWQho${ h$=P tWSho${ UW6VjVjrVjVjh j9$<|$|$ $@j:0^t$@0<jh́8 hvj+hj $@0j@V]txGp58<h$8<?u D$PPPhۃ$h\'3y1Ph$F 8P*ā81\$(ht$SE t$~$@@FF =}8t 18}8$<@VP=}8 8tȃujUS 8ȉ8t=u98Ph$58膰 58 =8d8|$|$ t&WWWv$@$@8jh́8 hvj^hj O5<<h$Y5<<hz$L5<<h$?Ph$75<<j?uPVhe"5<<h΁$j?UPWhĀ$j F ރ uR`01Jt$$D$Dc ƃ=}8tjWW|VP PVh'$WV =8t>58h8" K=8th8h$58֮ 58ajh@h8h'3'tEt W=8kt80t&ƅu'h$$58P" /h$~ ti$=8t8j 6WA t88t8058V =8t'~t!8HQP;H~Q~  Pj4hvj hj ^_Ã=8t8HQP~Q fPj ܰeV5 8u<2t!2h!#P蘓tFuh$jC 5 8y$tPhh83 8^SWV|$1t*2t!2WP,t Cuމ^_[V58u<2t!2ho$PtFuhԂ$jB 58O1#tPhh8P3 8^V 88$ 9$81( 9 t8A85P5t8O:t8^USWV1|$- 2t}D$ 2111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,h?$D$Pvt uu ^_[]c;9ơ8=8t#tE$Qh$Pڪ 2t72 8ttPl#PV8 8uV-jV D$E3Vxtǃu&Vt$hM$ Vt$hi$586E|$tw7j h`l$58"j 7t$V= t$D$PjW Mr^_[]USWVP 8$ 9$t!uL( 9t.u=( 9A 89!22( 9 , 9A t tu ( 9( 9tu$( 91B( 9 , 9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5$ 9 8;$$ 9 81tu ( 9( 9, 9^_[]WVt$ t82t2VP谎tuVh$j> G^_h$f=2u > 28@=u1HP" 1;2USWV}uCjh09<090909090909@ 9 D 9 0909|$(jW<@ 9@}8 D 9 D}8w+09509G1;09)ʉT$t$09909s?D$009D$(L$, 090909=09D$8D$"8ʃ|;D$L$y =,}8`E\$ |$tY1${ {{;{{WSWVP ;{{{ {{|$$PS\$j*U$1ۉ___ __$PWj~ 1@G ____SW|$ S\$O =,}8fDŽ$ H 9t$Phk$hQۡ1F< 9 8 9ƒ\$x|$|l$xY&ݜ$݄$ 4Y&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Whυ$QP/0 99|ӡH 9tPL$ 7L$ )΅~DQ4))hO1#ShT>'Rhօ$QP負Ƌ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4xr r11ݜ$D$8dt$4) 4jh́8 VD$ B J1rrJVRVI $^Ã0D$4L$8T$ 1ɉJJJ JJQRPhx x$1H0VOy0j>y0^USWVh=(}8u=,}8u }t$XjVS4+09~=09N+ 09y@BD$HT$Ll$HL$$D$$5DY&D}8 @}8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иO1#t#|$d5L 9PRQh*$hWq|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQO1#r#+|$QRh=$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ 09HQP~ Q PjʍHr̃t"109HQP~ Q P}j\t"u509HQP~ QP>j09Gdu091G 09HQP~ Q Pi[~#\uE09HQP~%Q'H wr? t:,u3Pit%09Gdzh$t 1N09=09i"%p?'h09P^tu :v2USWVՉh09QytDj.V>1ۅt6UPxu&)Wh09V( u1ۀ091C^_[]SWVD$=8t5l9hڇ$58& nD$t$hKQ$PV` uA 0}8}8t }8t$~Vt. |89PQl 9^_[Pvt=0}8t"=(}8t5|8h"$58m 1G=8 Shq%h9,% =9=9ShI$h9 % =9Sh+&h9$ =$9Sh?"h9$ =9Sh%h(9$ H9=}81PPv h$j(' WVPh8#ơ8?snt$hB$Pz Ɔ8 8?)PRQh'35 x?t$|$ 81; t8 ^_Ph&$ ^hH$t$h$58 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=8tDt W^h=$.$t V^ho$PD$D$ L$PQRSm:4$uu|$l$ ȁ88tQSh$PSh$P D$WjPUh'3tU5ȁ8sƉ$t=0}8t`V!S!<WFWt$PU" Wh#($V" WSV" $t P]4$VhFg$uD$uqhNg$N t66h"t$h$58l 9kt$VD$V PjVc D$PhYg$vƋ|$W PjWc u{D$ u?hag$ tt$VD$ Vu PjVic D$ 8Phkg$Ƌ|$ W? PjW3c 1ۃD$  ˀuPhkg$贝u_4$|91F=8uR8,=89ShcS$iXOuh$ٚ 1$tP[$|$t.WoPjWcb D$tP[D$|$ t&W9PjW-b D$ t Pq[d^_[]h@hNt$h8 t8058EWhhx9O ux9x9x9V5(}8=8u (}8hj$1t>hS$h,9 r1ɀ,9.)h,9PhX$58jhu$h,9H! tfjh.'$h,90! tN=8p9tt9j hz$h,9w uh58h$` S=8p9tt99j hb$h9G th9hb$58K 1Hh9d9`9\9X9T9l}8Ohl$ݚ1Ƀu 1Al9u ǀl9u T9l}85(}8^Vt$t.3DH@tNFuhl$V ptQjhm$V tDhq$Vot9hR%Vot.h}$Vou'h9X9\9 `9d9^á09t P;^1098p9t9=8u 84}8d}8h}8|9t PAX|9=8t8}8j=8t#8@=u1Hjh""P jh́8~ WV7b0jk=8tp09t1@=u1HjP 5095]094}8x#jP 54}8 4}88|$ j =8tD09t1@=u1HjPl 509\0981T 9P8u 9a0^_Whӈ$j D$tPYt h$j hB$j USWVt$ \$l$|$WSU荕 tU| u;HDO 1 t$ tۋ$fO gK9uX '3I '3~'3P'3h'3\ '3 tuÅt$g t^_[]Vt$V&Et^Vh$j hhx9z tx9USWV=9}8t`=8tW$tw\59Phh\19F j h\191\19tJ\591PZ\59`59tNjwt`59`59t$h5x8V |0/thhV%V hhR$Vx Vϣ5$$P  (}8L$(}8P 9$-,}81P 9,}8$ t1=8PGt*9"1SSQPVhf$#u8l 9d$$r t,9$ t1=8PND$(}8$P 9-,}8h^"VS\59V襢\59t2$75\59X\59Vh`$ h$ 1^_[]USWV,=}8t8l$@11 SjhU tUhc$萑 ",^_[]<$tދD$0S ,^_[]WVP5(}8=8u (}8|$=d9tft$hΉ$艓uqj h,9.@j WP$  =.3LO@1 58jj(h$;/ru=l 9u=d9u d91HtJ=8uA58h,9 8HQP~ Q Pj W1H‰5(}8^_USWV45(}8=8u (}8\$L=l 9=X9!t$Hh$H+j h,9V-t|$j.h,9<-th,9X,94$uY,9519 ,91f u>h,9h $58 f,920h,9hG$58׀ ,9t$1 UVhZ$U"/ D$(VyA!у $ (}858jj(h։$?-u=l 9u=X9u X9tj=8ua58h,9 8HQP~ Q 0Pj ]# 8tUhg$58 4$|$5(}8=l 91Hƒ4^_[]t$h$j2hd59,td59h$j USWV\$l$jWeht#WyeUhNJ$S- Džu&Uh$S- DžuUh$S- Vj3e^_[]SWVx95(}8=8u (}8=l 9h#艏x9u_j h,9*tL8tGx"uAHt.1Ҁ"ux"u"@x9ZHt@r1Ӎx95(}8=l 9^_[SWV$h$V V he%PI1Fta\$SWo t?|$/uH$VPVS 1u%D< [PPftڃt!щ 0 9U8^_[ËD$t*uRL}8t P}8L}8T}8t4X}8'L}8t +P}8~L}8T}8t +X}8~T}8Ph7$j WVPD$ .31NDQtaj WPL tDtyu@ |.3LQf~gtmtku! tbt y1HƉ^_VPt$ =8uMPh8hhVD  8~} 8=8uMPh8hhV[D  8~} 8jh8hhVC u58h$- jh8hhVC u58h$ ^ha$h$j@ USWVPT$ t$1Ʉtz|$ts|$$tlL$ $11ɿ^w!s; $s t$\At$T$ \tߋt$T$ E;L$*t;L$s;l$$r^_[]USWVl$4\$,D$0HL$D$1U%t61@;|$'Lj3EٍE$UƒbH҃r.%M5nmtuc8t=x9uVڡ8O1#tx9ct . T$ l$1ލN13;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh7&PQ ƅu 4$Q 1$^USWVHuI\$ $Cj j ShWuu @ t "hVW j VS 8]t/M I9Nt vuvvS4 jjS ƃPjS \$fD$=8~%|$@jWa 8O$Cuu S VjPe 1D$ PWh0" D$ PWh $h%$ M81\$@jPPhSvvI? thh"Sb ZM8Sh$ -D$ PWhR$0M8$\$=8~N1PD$PXT$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,L8tL8#tj}udL8AuZku<FD$ t:D$L$ PQhhu< t\$ ۋEu Y -LD$ PWh0q$ 1He^_[] t$a- WV|$h#W=t.h7&W=t!t$?tt$ h$& 1F1^_t thҌ$j_ Vt$ Vt$ `t t^Vh$j9 USWVHE ML$8t$QPVF DUt$F|$vq>Vh>1^USWV0]u =8~|$jW8OEދu~ t#9rWvPc" )~ ~)E 81m<$SL$Q6 ƃrGt\)L$<$uH8u}G8#}1D$11BtfT$ <$=8~M1PD$$PT$D$+T$ +D$(хy@BMbiy1iGVjD$PI uIG8w;G8#iMtuL$E58E58Ph$VmF<< FMA(1e^_[]ËE@,$FG(F8<$tF19#u‹F9~sWP6tF~WuP`  ~ FUSWVP|$ GuhY+GG1(,O _91G G1Fl$WVVU'tY\$GOQWG;Gu!,EUw5tGo1F u$E G(1@1(u8,t<_tGO T$t$)9|JSPVM _ ^_[]AUSWVPt$$\$ l$|$WSU tUZ| u2HDeO,1t$tۋ$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV Ch1"P_6t+h1"VM6th1"V;6u5959u }h$VW Hσ s У2߃c u159σdt ltntF59뵈5959맃t Vu% !39u=59D4$9-u yt$$PQb1ۅtz<$ua59tXTC8uNWƃPM(MVWP 3.gz$PS߉ޅu4$h:$^$%=t0=@VhI$=59G559=59jV DžND$PW&%$$PI Vhx$D$Vh[$!t$$t S7NvB11BW%jV $=59$uXht$Vhc5%PWd9r DŽ$.gz=59uhh W ) $D$D$P D$ T$4$? =59u@D$ #D$Vh"$Vh" t$ u hǐ$RVυD$ !=t D$D$pD$559hVW W|<ǍWht$o2tI=59uC59u:Vh$H$Whw$h'3t;jD$P|$W t $Vh$b1PPPWH(=59$uL=59uLhh W ƒu 1@P D$ 1@P T$=59u:4$T$WjVVhP$F$P= t$ $T$ V1PPPGD$T$4$ t h$uD$ tP t hǐ$RL$#L$59tGujjW tV$PQL$Y!tNWh$4$:u WrVhݐ$aWh"jWh$ $l$pT$ 3T$ϋD$1 u V4$ $Qt$Pt$h=$4$ $Wh E" $1B1P 559Xh@'hi#h'3c jXV'3h@'hi#Vc <Ph$Vc jgXUWVD$Pjx2=59t0#D$1=uT$l1h$jKh}"<|$VWj tt)u1)tu4hƍ$6e^_]ÍD$t$1B1h$PjVh׍$PD$L$ $QP =59u 59XUSWV׉ˀ=59u hǑ$ t$59jjjS$!ƒt7jPS tuh$ql$h$11PUVWh$_؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph $jV]L0L0D0.Vh'$h\'3Ia Wh@#^^_[]PD$L$ $QPPq =59u 59XUSWVpT$hL$lh}hD$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RrT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$?'1@ɽ9jD$0PuŃ|$<T$1D$ D$,8@D$,O|$01PPD$(P(T$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $$@'Cىt KDP@uD$ .3|$1 ,,C t ^DH@ujGt-Ê .3DA@CCu 1OD$" 8.3L$C CDP@uʃ;K}/ K>C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _EH9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$?9$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  Êt.3DH@tKCu$ D$VVD$PV4z Ǎ$$ D$ VVD$PV3T 94$ =,,31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$?9L$ QhP ?911 |$ 1 $R2t1BuڋD$8L$ Qj P2 Ǎ$Pj t$d2 ^ŃuuD$ L$ }D$HPQ4xWt$ PL $(4$hUt$P* L$l$ ȉD$<9 ɽ|$X.3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't .3DQ@tVFu$$  Qσ s[1(j $( PSkV (8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A .3CDP@t Cu;|kw.3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =G9 hh V証 EKCDH@uٺr$yG=G9 GKoCDH@uٺ|$KfCDH@uٺ$ GQC t _DH@u<%ƋD$pW@1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,=9t!9}uEpVx*mj =9xt$p@ =9>GWVZt$F1Ejhh592 Å1|$څ,5 H95H9h$|$t5 H95H9h$59 5911<=9t6 uGp5 H95H9h$W W߅uFuLP9t@PEPP9tP9P,xP9(^_[]R5 H95H9hH$j 5 H95H9h.$5 H95H9hW$VQR5 H95H9hi$$P5 H95H9h$$P5 H95H9h$jjUj 5 H95H9h$lV5 H95H9h$UP5 H95H9hs$>5 H95H9h$(5 H95H9h;$Q5 H95H9h$5 H95H9h˕$5 H95H9h$jj} 5 H95H9h$5 H95H9h$5 H95H9h($5 H95H9hV$n5 H95H9h$X5 H95H9h$B5 H95H9h$,$P5 H95H9h$Shk$95 H95H9hh$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@uLP9_NSFJ1<=9tJ9ouwvSt?G $pS|$698^_[]Ë$@S5 H95H9h$jc SWV׉HЃ s%j SVM G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S+ uC9tP9stP9؃^_[]Ë5H9= H9SP PWVh]$jt USWVP׉΋$1m~ w]$T@' 1at*dt+fuC j   j j t C$1E^_[]USWVPӉ΋|$)MQ1?t@$M7Et*j @x 22>u)jH1҉P52 25ojnH@28 2>u j559h\'3Iu G9P2h 9"j tPPh$h'3=j2USWV\$|$t$ G91EtB5G9WVFL H9H95G91H9H9Ht8h^"p=G9 H9I H9Kph#jhG9O9rfH9"G9 ... H9G9H9@G9 G9 =H9uG98#uxnu G9  G9W1 t,E-G9@J}G9H9R)ʉ1ɉH99‹\$kH91m1 H9QH9u>#u~nu G9tG91B C1ɾ8f H9@G91ɋ\$uH9\$t1A ^_[]ÉQhk$j5 USWV|H9uN H919u:=G9uH9'3'3 H9J$$H9\'3(H9 9"H91NHQPPmH9='3P=,H9tC,H9SYS5 H9] th,H95 H9Ƭ o,H9=,L9tM$H9t=\'3tPV$H95 H9h,L9p ,L9(H9=H9tH9 H9 H9@ H9 H9=G9QP+rf|$G98t0W5 H9,H9V W5G9V& =<W5 H9$VT W5 H9$U= V UB PWVh$Wh,L9W59h,L9W$H9޻t=\'3t Ph9"h,L9P9$H9rH9tt$t$PF $H9H9tȋL$!QP@ (H9,L9=G9uH9 H9$H9\'3(H9 9"h^"P8H95 H9hk$u G9H9$@1Q5H9Pk 5H9hH9hH9 ƅttbH9|0 uNt$@ $@ $QV5H9PH91@|^_[]5 H9hk$j 5 H9hU#hv$h`$5 H9hV$j hD$hD$b =,L9uhM$J h,L9Uj+h $벡H9@ u:HQP~ QP" t5H9P~j 1=G9t G9t SWV H9X1t^h^"36t&Nj@HOW uWN [뾋HWPi W, 1F^_[Vt$Vt^Vh$$j Vt$ D$tVPuVh0$jg V^WV|$t$ WVJt^_WVh=$j3 SWVP\$|$,P9t PD$jPSW PL,P9VPSW ,P9^_[USWVH9jh0P991FD$8P959TP9JBtOz T$R uW|$+;A 0P94P9|P9ыR L$y th|$ H9)щ;HT$7D$t{T$A 0P94P9+|P9. H9;H@ 0P94P9|$to|P9u1ۉH91;AH91;AT$t1~T$ |P9=xP91ۉ__ WjWSQP6A|$t4JT$B8 H9;H`TP9T$|P95xP91~>~ VjVWQP@1FT$1|P9=xP91ۉ__ WjWSQP`@T$t tCsBtt$u H9;HrTP9xt$tH91BtȉÅQJA7$ C'=8P954P9$=0P9FPj W @) 4P9QPWѱ 59Ҿ5=pP9 pP9R҉Y = 5H9h5"5$H9 1 u 1Pjh""0P9S1P5\P95XP9)1Pjh""XP9S1P54P950P9S%1Pjh""0P9S1PS =8P9 T$0P9=4P9GPj SU ƅ F@+6vFt P讐 uF6^_ËFp vhk$jb USWV ՉL$P9P9щT$Љ$ .3xP9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B P99r7 P9P5P9P9P9P9$xP90D$SPt$V. it}ŋ4$L$]\4$L$t&uE\P99r+P9P5P9ƣP9P95P9F1C4$P9P9\$D$ P99ȋ$r+ P9Q5P9;P9P9P9 ^_[]USWV`}$111D$h$u W螿 uu5<<>ut0Gtg<<;u<<$8u !3ȉL$91t*V,t@T$?D$D$t Vlj|$\$ |$t?1h%S$ t+8ttDGh$j^ 1E L$3f the%Đ u3hk$jN tD$PW uh˙$ۃ|$ tt$` uhՙ$뼅tt$t uhG$렋Cu/hR#费 Q$tjhܙ$VV VeSPE/ QVhߙ$ ]Ph$h'3 jUVQnt@t $e^]Vh$j WVP։e1ɉQPW跍 V?t$8t=1H^_)8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pV7 Cf{~a11C403t?L$qPdt+{|7u!47_3L$1qP D7EC9|^_[]Vt$FtKPF tvPjv ?zF vv"zF^USWVP1k<2~42$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùm mUSWVPk<22$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)oh'3jjChK$Cj) V1=P9J"Qt*Tjjj)  V V|5pj<DP95pj<QP9j5pj<@P9jPVP9t#1ɺ2A<.uP91 1@^USWV D$0f 9P9Z P9,I fEE!f ufE(Mt!U1f~ t @9ufE,$iTtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? .3DAh'3je# W蜺@$4D'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$DD'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLN]=m$ 5lj<貚5lj<š1QQPS$t$V5lj<"5pj<\1U)19}1ۋ$p$)ŊEt9}1< ˊEE5pj<h$1VV5pj<n~UVj5pj<\~Vj5pj< 5pj<=5pj<?,= |.3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h'3jd bxu+=P9 P9σqt$V[VVzo5pj<Ih'3j ,$,$fUuE 9|)BfUh'3j ,$T$4xut EfEuGza|1x(| E9}ED ufMh'3j@ !}Eu)uE t uP蓳uf;}]D; jtKD; tt$4UЃF4; ~ttt$4WZuE tuPu mE u9umEP9,Et)uE t uP薲uEtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃulEE tPlE ^_[]>Jt$5P9t$t$h-$h'3 ZJ$@ t$St$t$ t$UPh]$'I $A It$U5P9t$SQPhǜ$h'3a $j7USWVT$qЉD$ qLGud$ T$T$ $P$ǽ)j P׷)1Ƀ QWl$ U|$ WD$pytS;tNt$Cj S蒷)؃ QSVWD$pxt G}uo $ $l$Atl$|$q衔KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCA G΋<$9Ƌt$ufth$VSww|$Gu1PPw |$ GL$G)VQw wd ^_[]D$L$P9 fAËL$1x9 P9~P9USWVl$0.P99}=P9DP5P9Ǎ PjQ( =P9ۉP9t @tFj9<5@9c$hڠ91=9Py^D$L$ttu* h"9h9 hܞ9-WVL$D$t$ $$E'1Ƀ)lj oh9b8Q8h%Pnt*t!h:8 Wv^_hËD$L$ttu*h9h9 h9%Vt$ h9N As'T$fzufJvPh7%hzuhhD^ËD$L$Q1Ɂ~t't%u'f!tKu1Af fffHËD$Ik@ltH@1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH 1@ËD$Ik@ltH1@01 41 71h$ 1@jY81h$ 11P9jL1|9j$1<1h$謀 1@jj 1jj1jj1jj1ËD$@1@ËD$@1@ËD$@1@ËD$@1@áD9,jh@0 1@áD9,jh0 1@áD9,@QjP0 1@áD9,PjP}0 1@ËD$1@ËD$1@Vt$ 訥1@^Vt$ jra1@^Vt$ j\a1@^Vt$ b1@^Vt$ ,1@^Vt$ 1@^Vt$ n1@^ËD$1@ËD$1@ËD$1@ËD$j辟1@ËD$j覟1@VD$ 1F0V菟^VD$ 1F0Vx袩^ËD$119‰)Ѝ9hPPQQj jh  1ø91hPPQQj jh  1ø91hPPQQj jh  1ø١91hPPQQj jh l 1øܳ91jPPQQj jh K 1ø91jPPQQj jh* 91Á=9ftpthh9hO1#h!91hPPQQj jjd 1WV91hVVPPj jh =9t#1GWVho$ WVho$ ho$h{ ho$[{ 1^_øڠ91hPPQQj jhF 1h191P9jH1ËD$@1@SWV|$YRWPVhɚ$S9^_[ø"91hPPQQj jh  1øܞ91hPPQQj jh  1ø91hPPQQj jh m 1ø١91hPPQQj jh I 1øܳ91jPPQQj jh ( 1P9jG1ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@О9v&%1@О9+/%1@øN91jPPQQj jjeu 1øڠ91hPPQQj jhQ 1h<91ËD$1@ø091jPPQQj jje 1ø91hPPQQj jh  1ø١91hPPQQj jh  1øܳ91jPPQQj jh  1ËD$1@ËD$1@ø91jPPQQj jjem 1ø91jPPQQj jjqO 1ø۟91hPPQQj jh + 1ø91hPPQQj jh  1ø١91hPPQQj jh  1øܳ91jPPQQj jh  1ËD$1@ø۟91j91hVVPPj jh^ =>9t#1GWVho$b WVho$S ho$s ho$s 1^_øڠ91hPPQQj jh 1hݭ91Ë @9AR@@91ËD$1@9Q$1@9$1@9$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$@1@ËD$@1@ËD$@1@t$p1@VPt$̻ƉPjV] tjjV膲 4$ N1@^jt$ 1@WV|$jWtWcjVPB 1@^_WV|$jWtW0VPγ1@^_áD9ƀxjjP 1@5D9ݾujj5D9躱 1@jt$ x1@jt$ f1@Vt$ D9ƀx6讼j65D9e 1@^VD9)thjj蠛1H/t$ ƀxj6P% jj65D9ֻ1@^WVD9)thjjK1N?|$ƀx1FV7Pΰ jj75D9V75D9蹺 ^_VD9)thjj1H8t$ ƀxj6Pi jj65D9V|1@^ËD$05D9轼1@Vt$ D9ƀxj6P D9)t P1QQ6P论1@^ËD$1@ËD$1@ËD$1@ËD$1@ËD$#$1@ËD$+$1@ËD$3$1@ËD$<$1@ËD$I$1@ËD$S$1@ËD$]$1@ËD$o$1@ËD$|$1@ËD$$1@ËD$$1@ËD$$1@ËD$"1@ËD$F$1@ËD$M#1@ËD$|$1@ËD$+/%1@ËD$$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ø"91hPPQQj jh u 1øܞ91hPPQQj jh Q 1ø91hPPQQj jh- 1ËD$1@VD$ 119‰)hVVQQj jh  1^ø91hPPQQj jh 1VD$ 01jPPQQj jh Ɔ1^VD$ 0h%P thVhO1#hG1hVVPPj jjd4 1^WVD$81hVVPPj jh t#1GWVho$ WVho$ ho$k ho$k 1^_ËD$@1@ø91jPPQQj jje 1ø91jPPQQj jjqs 1ø91hPPQQj jhO 1ËD$1@ËD$L$A f@1@ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1@ËD$@%1@ËD$@K1@ËD$@1@ËD$@1@ËD$@1@ËD$@1@1@ËD$1@USWVPt$11Mf$0jWWSSUUh W[5 x;}ԉ1@^_[]ËD$1@USWVP1A~9~^Պ\; 1ۋT$~N,$9uh$PRQBWvwjhD?%PRQ%W|$ Ft$uMhB?%v誳;FVx$9tكaw~ ـb(Qh$Pm t^WPS\$OUF8tt$SVЃ F9u v(j^_[]fUSWV|$5P9ti=P9WqWqG-P99v1WHuáP9t P请P9=P9P9P9^_[]SWVt$3t5P9PA31SSVW 1NtjSSPP91ASSWQQPSB3WnX =3t@h%WUt5P9WbA3W2 P91^_[WVt$ w?=3t-t)95P9r!P2 t;P9slj42^_5P9 P9P95P9g5P9AhVt$5P9P9P9VLPhk$^PT$D$ $1APYXWVPt$|$5P9sP9P9D$$WVP1A4$^_USWVt$R5P95P9 >-P9E.3\Jك@to@uwt uDZ@t< ty< =P9u =P9tI5P9xntj 5P9=P9uj 5P9P9P9P9P9?=P9u"5P9ntj 5P9j 5P91P9P9P9P9P9 P9f)P91ۈD$uP9C5P9mt$L$4 5P9m9Ƌt$|25P9mVUUU9}j 5P9|$uCj 5P9KVW5P9T E߃ @ ȢP9P9=P9uW5P9lt7j 5P9b%5P95P9PP9P9P9P95P9? ^_[]t$Phk$VPt$D$ L$ $PVP1A4$^hO1#t$t$t$t$USWVP|$ \$$l$(t$5P9P9P9D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW>j5P91ɉV,$E|$@t[D$@8tRD$u:h#%5P9|Nt$@5P9jNho#5P9WNWt$Dt$u h4%5P91N4$t5P9vjD$ 5P9j5P9j‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5P9N5P9pjthr%US5P9gN/)PS5P9 5P9D5P9FÃ~0L$ZD$  ! L$X1)<(x1 .3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP_ QtRD$(υ~] $9I\$)RPQ_ KOuLuH|$@tAt$t$D|$Wr Wrh'3jf D$z19Dzf tN;L$$} .3DXuh'3j  $9A)RPQ^ $8GED$t+)j Pt$5P9 L$P9P9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$Pq 4$\0^_[]hO1#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5P9g5P9f$tKۋ|$,;Sop|$0L$Dȃ19AD$LD$Ut$HP1t$PQQ Źt3;|$,t.D$DE9}SoŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j POtC@j P9uL$$)݃} 9WUQS5P9ƅ|$ VwƅtV5lj<4$5P9PW5P9DPW@1PPW WYD$E|$ GWUPS5P9~Pŋ=P9VmPWs=P9VDPW:@5P9<P9P9#WUt$ Sh%5P9r1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV蹶4$tWVVo:WUPT:WK:^_[]hO1#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]hO1#t$t$t$t$USWVP|$ \$$l$(t$5P9ɵP9P9D$,$VAUPA14$SWt$(^_[]hO1#t$VPt$D$ L$ $PVP1ɉ4$ ^V5P9a5P9!b^fUSWV $$$ x915959О9v&%5Ȳ9W蟗9WVP轮 HE'Ft(=09tvvP[l vh09B>vuɸ@999в9Բ9hwU%u $|$ hS%SUy e~o~1pMrtoCID9붃fi5<<h^"V" PhW) \$hB#W_ D jPh#x t \$Sh|$W u4 m%HE'WKjPWV t }u몋}tED$thB#S <=u̍4@hB#P Fhp%Vai 0t$VWj F|9hԲ9hв9h^%5<< `S萫$$$ Dm<<$.61Whu%/u#D$=uD$h|$d}Yh%WK t41Wff t@ < uFrWC WC jh#h$ ZB5pj<^ǃ5pj<^1FVVPW[t$9t5в95Բ9K5$9h  Vj!Vjh'j5pj< |hh9.D$D$@V覓ljD$ V藓D$1Åj9P] $t|$ o u*t$ e%n ut$ %n j|rjUĜtc1L$ <:B @9u1PPPPPjPPj jUVP4t(j t$WJW^11V|$ t$~144C9uWVݢjtPj聹jVh #} Zx9j̲9j" 9uٸ=|9t j jjp.P91 ^_[]Ét$ hh1GQWP Phi#h'3 VW[ =h'3jj,h&%Sj9 h'3Vjhd%2V V1Fh'3VhEh%V UWVVQ h #wo P~ 6|[7=Ԟ9t>V葙Ph0%W 5Ԟ95Ԟ9輦Ԟ9=(9t>VIPhB%Wp 5(9貃5(9t(9=P9uh'3jjhY%~e^_]Ã=,9táIJ9tt$Pw j j h #hn tP{} t hV%j} ZjhBw h,j"USWVB L$QE  P` Ń j h%U ~ uF t$|$ W W)cfD/UWM Wjŋ>7P螛tn,$n ;nu:FUW艙t^FPvqtFljFn ~D$PX4$XUV S_ ŅS0= ^_[]ËD$L$I41@fUSWV1t$|9j9V“t$t$ t$t$4$j~VP;=|9P覝t$Vj >hj]jYj߄{jVfʁV2Vjj^4?15|9uD9VPX~BjhyD9jPWyjhx=9V/Vbu%D9ǀ$jhxupGuD9Phk$jX jtOD9)tTPCu2PKu#PuajhxP迚^_[]Ë$l$ D$jPttщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVfVfSWV1t$t$t$ t$t$4$5|9jV$jr4PVf8 D9$*tKuKt!PуtD9$PD9L$$Q4 tXD$t$VSVx)VOu%u%t*VC^_[À)ujhasu Vt5lj<q1WW5pj<; 5pj<-5pj<qSj 聲9;xhj_jZjC]jVkJ%%!}E'USWVο$WQSV] Wh%S] WSU:] Who@%U] S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQV\ Sh%VI] SVW\ Sho@%W-] Wit VW^_[WV1t$t$t$ t$t$4$5|9jVtkjo4PV[5xGD9*tD$$tL$PQ_t$ViLtV諕^_ÉWj M?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QRZD$l$1@$4V#Z9D$pPt$VN Z$DaD$|$ $%t um.3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5.3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u.3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04X Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWC 5Ԟ9t@WPh0%V 5Ԟ9av5Ԟ9#Ԟ9sh#h%U Ԟ9t*W蛋Ph%V 5Ԟ9v.5$9脝0UtPh|#hc5%j[1e^_]Ph%h'3h j> UWVVB =(9t>V1PhB%V݄ 5(9ju5(9,5(9wh9"hr%b (9t81h%W莄V蚊Ph%Wv 5(9u$艜0ZPh%hc5%j[$1e^_]V1hhPh$PjjPj jjh3h4xjPѪV^h'3jjh%oԞ9tPjjh%njܶ SWVD$x1|$Ԟ9t(9P1; PqPVhe"W+^_[USWV$$$L$$QPhVm $h^"VQ $D$W"1K4$p 1G9r6|$  WU轊ŋ$(\5F4$p ÃugD$ PVuuH|$dh^"V $t:|$G=Ԟ9tVh;%h$%PY 1KS1D5$$t 4$x 4$>uԞ9tVh;%hC%P 1ۉ؁Ĉ^_[]UZ$$$1K]A USWVu ED$l|$(PVWx  ED$8D$1ۉΊ<'t  j Fj'VKku VnRljt$ t$PS D$ t$ )VPh"L$QT h%VF t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/Wڈ tW3 É@/ W3 É|$PD$xQSN ND$+D$D$ .t Vt$WE tSN Džu]D$T$L$;ȉD$Pt$ 跇SD$L$Wt$t$ h%P 뒋D$L$T$;t RSz+ |$\$$hD?%ST G|$\$1\$L$< t$0Vhht@W] fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=pj<jP|$ W 5pj<d:5pj<Șj5pj<V5pj<z2dpj<D$D$(D$$1WSyD$ L$VWSPQL-1N|$p$ ,9h,9hptt$$.~ =3\$h3hbtt$(~ us=3ujjh%j9* h3hf@t$$} =3t03h3hbtt$(} %\$3Ԟ9t Pm(9t Pm3£IJ91t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5,9L$@EL$D$D$9}7D$hP"-8x@^|$u9Mx{;5pj<tV?jP=|$ۋ|$t h""b"h+PL"^'3H '3~'3#h'3谌9Nj|$t]j 2;5pj<t V|$ t E%u15pj<5pj<j5pj<WO]t$(;twP)uWD$td$8u-e^_[]D$t$ h%jL VhV%P= 1S%& 1FV& Sjh#%)% VSa t$% $ D$pL$|PSt$($ t$ WԞ9t*t$h%Pʹ 5Ԟ9߉Ԟ9(9t*t$hi#P蚴 5(9謉(9h &D$ 0?u.h+%D$ p'ut$vm t$e s hڠ9REtt8tjP( u%t$V67 6h@%83 jn3L$1Ph.%3 USWV։5pj<Џ1@P5pj<M5pj<8[h41PSU|  $4hP14hPS1CSA  3Whk$|f4hջ$FPU^~Z5pj<;@)VUPRQ5pj<_VtcjP.|ft05pj<ǥPVͤ5pj<oPV1PPV蘰 V?Z^_[]h'3Sj+h%C_S* fUSWV-1@=P9$h!%Pjq hpD$1D$ $ $?$VD9$VWYD PWt$ k VW>D G|$ "%G'.3D$WDPWt$ ;9 uD$L$DAu >uD$ |$O 4$ ))ht$PD FD$ |$$ ))Ƅt$D$58 }? jSPy ƃ $NfF6Ju1ҹhtRRRRQRRQjSD$DPju4D$D$D$ D$ jtgD$ Pt$袘D$ p P9 )) hPhP9C 14G'jVhP97 t1GuD$(Vh"%j@$S貫 1PPD$0PD$XPSk$ t|$Lub4G'hP9hc5%h,jSj"D$L1QD$PPQQS$ Sh"%s1=P9su=P9lu.3 P9DH$D$$PhV% u5$nfsu( $D$1@D$ |$$tD$$D$$i jv~h1Wt$TVF j!W|$0W6 iW&]hh#%QChHX9PPj}=HX9 hHZ9PPhh#hg$% Ph#%j+o h#%Wohd#%Woh#%Woh#%WnhHX9h#%Wn =HZ9t!hHZ9h#%Wn $9h$%Wnh$%Wnh $%WnWh[%jtnhP9h#$%h DŽ$hKU9VVj~/j h%V/ KU9defa1ȋ OU9ult1 j h$%hKU9 KU9manu1ȋ NU9ual1 KU91 KU9none1 OU9 tlf=KU9 tb=KU9t`hKU9hP9h$%jtChP9h$%Sj~$$zKU9Q9hh$%HOh!IfhP9h$%h$%hL [ 8 Q9h%D$ Pj3 ~ht$ hQ9> t$&zj hQ9Vth%D$ Pj ~ht$ hf9M> t$yj hf9BVt=f9t Q9h}%D$ Pj ~ht$ hR9= t$vy=R9u:h%D$ Pj@ ~ht$ hR9= t$3yj hR9Ut=R9t Q9hhS93u=S9t Q9D$1@$" hGY9S$W$= VS9PPjxVR9PPjw SWtt%Q9|$$|$ t |$ujT9PPjyy|$t jU9PPjz^hT9 =-U9u=%=r!ƒ%t๗%=ujQh-U9B< j-U9PPj{hQ9PPj}Q9u4D$D$Pj訐|$uhf9PPj|=f9;$;$tf9=KU9%tKU9=T9tT9|$ti=U9;$;$tU9=-U9;$t-U9=Q9tQ9SVWQRhP9PhS9hR9hð"h,$L=-U9;$;$t-U9=Q9tQ9WVQRhP9PhS9hR9hŰ"h(jjj0 xP JV9%Phk$hv ha}<hP9h8$%hSƢ S"jrjQ$H1WWV$Ph*"%H t( ;$P$Tsh<"%jPbt^DŽ$ 1WWV$Ph["% ? ;$0$4&ho"%jPh`uq5̲91H t$1t$t1t$t$th%j<$t$jWP91@$F=f9h9"h%r h%jft$(V\$ VlPh$%h%Wtf=R9thR9hA%WXf =f9thf9hL%Wt<س91ɀ=ڠ9/ڠ9QPh@%hh(9趘 1^ËL$1Bh$9WVt$=P9u jG7Wj DŽu1@lس9h59o1ɀ=ڠ9/ڠ9@%QPVWhز9 =1ɀ=ڠ9/ڠ9QPVWh9 1^_Vt$V dЉh9$^WV D$Ph9ϴ u:$nfsu-Vh9hز96/ Vh١9h9#/ tWj 轃1F?t[hܞ9h"9h\ %jPu>9 %h9VWhز9 h١9VWh9 1 ^_SWV=P9hUQ9u(he%Q\u9hGY9h %U=f9t h%˵=HX9t hg$%赵|$hP9h %hWL h9"WƅVWPh %j[h#V[=KU9thKU9h %Vy[ h[%jj[Q9uGWPh %jK[=KU9tDhKU9h-U9hT9h %V%[=Q9tCh4!%ThP9h@!%h-U9hT9h %VZh[%jZh#h %XPh %jZ #%SWZhd#%WZSWZ=R9thR9h#%WcZ hT9h#%WPZ =R9tPhGY9h$W/Z hS9hi#WZ W~mh[%jZh!%ZuhQ9h!!%nS=HX9thW!%XShP9hk!%FSt Vmj=J^_[USWV։ϸjPPj! tCËl$hjWm ojhP9W|+ WVSY SV 1H^_[]USWV$΋$Ph% cu tWO1#V ^l$PSU آ9<$uܳ9PVUWhM#%hC1Ʌȁ^_[]ÿI#%fT$L$t$f1"u/Átu2$Ãt6u8h6h/u uhD%!w H'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjhH'$t{4$T1ۅtjSSWPjhH'q$tEhD?%V> t&|$\$PS׃thD?%j uVe Ve1ۉ؃^_[USWV(%%H'\$|$jSPa ƅt Eu$wS7!) wh#7) G^_[]WVH'|$uH't%|$ jWQ t u1^_ËL$34USWV1td։σS'PSWq t u6P1PhPPj D$PU# D$t΀8uɃ<$uð1^_[]ËL$$3w4USWVl$\$1}$hlW6StOD$SWPHDWWRt.ljFt(V$'E4%%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQh $V1VPh 95|9D$40$X@h? P@tt$45pj<>9h'3|@ 5pj<9r |9ɉt$ =1MD$Ni8D$$11t=i8,4Ȳ9tǍXUS]N݉|$|$l$$9D9ƀyH1ۉLPTXVUQ<% D9" .hQP"% VUh9% ,D9L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPD9$()1HD,048Ƃ(1 |9<59^WȲ9|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً |9ɋD$L$ӾV WO1#QSPSl$GU D9$H@ VWO1#RPQSD$BPW Ԟ9t% D9QUHDRh%%P蹎 =D9$0TơD9$p:L$*QUPVWjj:WD$ D$D$ PjvD$ t.-|9L$QP5D9 u<5D9h^R$Pdž$l$D9()8 9 Ȳ9VL9VjPc L$ D$@D$9 |9yuƇy$u4P4 44S$똋D$D9$H@HD48D$L$$<uujj7mi$t+D$xfDŽ$DŽ$6D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ46El$L$),$|4xfDŽ4DŽ46T4E,$DB8t$ 9zt$D$tj$DxYfDŽDŽ6D4B=QD$BP4D$ .D$D$$|$y+DxWfDŽDŽ6D4B1ɸhQQQQPQQPjR$Pj蠁4$1K|$$8hk$jh D$Wt$KsD$tvl4u^u3h1QQQQPQQPjt$,$Pj4ÃtCD$WSrD$lxS1H$^_[]1M4$́$<t4u/h転hPh~3 D9\31@멃=|9yu|9|9s19dL$w BsÁt1USWVD$$D9*t1G.$ )$Ph%%hVL +/%jt(heMVh%%h" j$ fV%W赢D9$PhrD%hV̈́ WVh&%虥 ]hV%Vjj\Q1PP3Ahjl1q$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S3t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$G'h&%D$P耹 &%D$&%X3|$0tPh%%hW Wh%%D$P# +/%D$&%zhj&%D$P v&%D$|&%i3|$0tPh&%hW蕂 D3t#Ph&%j\$Sx S\$W D3t#Ph&%j\$SM S\$W L3"t#j$tWRh%&%D$ P, D3@&%t>&%D$+/%D3|$0tL3tQhK&%hW WhQ&%D$Pͷ c0%D$d&%Q|3&%t&%PD$P蝷 &%D$&%!h&%D$Pz &%D$&%D3 $t!t$PQho%h4t)$j4$;TtQ)Td3U$ 7=|9t$ $QD3$t<|$t4øSWS$PW[$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh;+%U5 EtjP3 t4$9S؁ ^_[]Ê$ h+/%WrO$D$jVxù D$jQQPSVS+ 9uU$d=Tt=Tu@$x6D$8;$du)Vl$UhU+%SPVUhi+%S@$ Pu1Vt$hI+%P4$@R$ l$ShQ1#U hKUWVjPK1PQG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQM^_[9rwًz89y8rw19HUSWV D91G*ZƄ$h&%輛h9"h#茞Ph&%jSC 5Ԟ9t D9QPh '%Vv 5hC'%SCD9)\$J$WPZx$L$@PQt $d$ PVt D$@Ph'%SB D$0PV]Y"D$0L$8L$D$h:j"P}Lw\$D$H$194$h:j"WJLFuށǐW$W(t SO;t$$ *hoԞ9tPjjh''%-1PP.+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7T#tO1#$'%\$t7ȉL$7 T$wXv&%D$ +/%D$$G'O1#$uht$$P '%Pt$h'%t=uD7L7qQPh(%um$$T#d#DT#t $D$ c0% $T$hV%RWJT$ D$L$ 1@D$h6(%OT$&%D$L$ hV%RJuD7T#t$$D7O1#@te(%O1#yj(%O1#tr(%T$(O1#ty(%T$ |$$O1#t(%L$,O1#t(%O1#t(% O1#t(%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h=(%t$D?@غRPh'%t$>ClE;F{Pp\$CPWp SLt$0|$4hg赕L$0QjP4. P7WLLtVh'%t$v> S+L=09u#D$@09@@hPfh(%\$ S->h(%S>h(%S>=09th09h(%S= $ 1|$@VVPWh.+% ;wO1#r#t#Qh)%S= h@)%֕hF)%ɕhL)%輕=09t hU)%覕h\)%處1h[%WI=SPW-e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ H'he)%U Ubuh&%he)%U U;FjVC1Ktljt$f"ht)%GK$G+/%G wf"Gh)%G K${$+/%C(s4C8H'h)%C<{@+/%CDsP$sTH'She)%U UptlSh)%U f"U5FK$F^ FSh)%U FH'UF K$F$^(F48ih&%he)%U Utl&%Wh)%Uj f"UFK$F~ &^Wh)%U6 FH'UfF K$F$~(^48+4$iƷm۶|$9R9h&%讙tzh#肙tiD$h#Pj裘 SWl$UVt$t$H6HOu4$GD9Phk$h 1PPx#D9)t5PhrD%hUUt 鋔$ 1$ 91APuDFl9Ɖr:D9Phk$hJ 1PP"999ƻsRAklT421GWWjjhUt8RVx L$ $ g|$8jhah%*%h*%hh)%qJL$T$jt$oËL$T$jt$XWV׉κ+/%jujWZhO1#Vh]"蘔 ^_VH[91ɾ 9r^^VD$H[9tU@8xtlIuAH1FVVjjhhH[90QRx tjhH[9j tH[9^À=H[9tjhH[9j H[9USWV 1WWj &iP4SPj  t$ á.3D$1/dev4$D$iƋ1N/ u1FSt$$Pt/dev uDL$DAt|tER|$$t.jVj t .3L$Nj4$D$/devG4$D$M[1O4$1O1V1D ^_[]USWVPD$tPpP11OFtFhV%PQ@t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|TK*%wX*%Phn"h@%V] ^_[]Vt$D$QPbLt(D$t%t!hvhPQD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5Ȳ9.@ujP;D$1҅D$t 9tL$BuT$ЋT$P]1hPPhhgjjAPjQQh,3w 6i4WP[w AM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h? PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP#:D$1҅ӅtwU$=t\P,40Ut5L${|$P=$tL$ST$Dځ8Nut/$E t$:@Ёl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$WR8ŅjW=8{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ >,D$$@$;E tL$ A;L$tI1۸hSSh_,Shj Vh*%S> Sh*%Wy S w$Ph}Dt$VWu0W}vVNۻ$Ph*%$3 1ۄ$h*%$詖h*%P蓖L$DQh&P(= t$,04t$jj hO1#RPjV) |$DW.3r \DZ@uWQVt$h+%ht$ c 1C}$u.1ۿH_9PSWb= t$D^^^F~ FFVhQt$ ? t |$\JSjV= $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj hO1#RPjV趰 VShP$ht$^b }G8@É؍e^_[]H_9=}t'fy"~_9 _9NuEt FuXt1€1ɾ_9( Ӏu A'w'_9 ' Àu A&r  uȃsƄ\$,04t$jj hO1#RPjV蘯 $PVSh+%ht$yD$L$a!jPD$T$AjP{D$d$jP`t$,04ڍ\$jj hO1#RPjS W$ePSVh+%ht$ ` -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hk(%q] Y|$hV%u /DžtohH'6/tkDŽ$v/rDŽ$/dev,$$VuP D$/devf@/VuPe Q踃낋E\tu xt@@AED$5Ȳ9$ttt$PуuND9덬$WPU t$/devfF/D9WPV [S \asHa9aO$CQPUW {PWVD9$t(tt$Pуt Nj5D9,$1D$0$h@h? P5tt$GD9PU-tTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jWÅT$-t WVS $WD$pV l$ Uh%V* ǰD$h]"W+h#W+tyhZ#W+tgh^$W+tUh'%Wm+tChbf"W[+t1%D$tw+%tD$VPS VWS Uh%j* DžED$4$v PS} t"vhk$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=x9SWt$t$($1PWt$t$(|$u1@Gس91sڠ9@%VPWShز9UV wsVPWSh9?V 1^_[USWV |$ faa@D$$1CO1#=9th.%j9VrPWhc5%hNvD$PUBD$hN95О9h&1%j訙x9rW!آ9uܳ9QWhڠ9Vt$D$PWhD1%SR$'D$D$ =mdt2Vh9hز9 Vh١9h9v 1$hVS- t$t$t$D$ a9jVVp ~;Ƹ PVD$i jQPo e9]D$|$hYWwr&o ~#u4ha9h09J 21ji p09ލ$a9Hf@6tJu1SSSSSjSSjjUVjl M4jmoPV>VMkta9Ph09J u`~*=9t!h.%jU19Pjn)D$Wj|>\$tt21ۅ1C؁ļ^_[]h1%ho1%h'h0%)USWV|1ۀ=09t}h09h1%jŕ ue9>1%@%ز9h9VWSUQ h١9VWSh9jQ VU#N@1 É؃|^_[]ËD$L$I1@Ã=9th.%j(9Vt$ D$t PnVjH=m5$9v^USWVPWj=1F?tih9h9hp,%j讔uL9۟9>1%,%h9VWSUhز9cP h١9VWSUh9MP 1^_[]SWVPVj<>u1@;۟9,%h9VWShز9O h١9VWSh9O 1^_[ù1@t ma9It1ùtAWa9t 1ùD$Wa9AuLa9ËD$La9SWVhzlhy1$hWV2) 3WSChWWh8Wj65a9WjWPVWI4SP^;VrJİ^_[USWV|$1i/t\1tWLa9tI1r rr2\0u&1q1ur1ۃ0݃ ]r @뜃|$tB ]BB]^_[]USWV|$D$L$BJ 0uQ=a91۾&-a9B0t#1urFLa9tua99u'Cϸa99t0La9a9ta90 5a9|$QAjVPh,%W^_[]WV|$t$ Nt tuh,%Ck,%,%2tV%jjPWV^_USWV|$=س9t hڠ9j;WWHآ9uܳ9l$}QWVh\#%hUL 1PPUE ơس9t3Ѓ<PU_uu#D$=ueߋ$$$tt9P{jۉt{uh,%jz$t]PUh,%h[Z$tx9hhSjP2 jP WLVCjUh,%h VQ VtP$t|9Uhk$hi jj8uh5$921@|^_[]Ã=س9t=9tUh-%ju CLa91$t9Vt$h$VtVز9t 9(9^t$.آ9uܳ9USWVt$,VD$j$t$Vto1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44iL$|$)L$OGj$WDžuD$@P Džj$t$0|$1<$t$]D$PVhVVj D$PSw NjD$VtuK;|$0sED$ )UPt$Vm 1D$44UYA D$44$D$D$ j$SRŅm<$t$ >tV\$S A VS$|$);\$u ^_[]h0%h0%h h0%W SV531/t.T$ 39u9t La9t q/u^[V1ɍt$QQPVh$-% y1t1^USWV|$(1$PPWVh$-%T $D$(1PPWVh$-% Z$LF1d$Pj%s4$>$H'h|eջ$U3eh}Bhh1%eh~(hUeW]5$9OD$h jU5$9rI RI'PPqhVjU5$9 VCt PVWD WD$ PaSt$5$9I 5$9$5$9Sjh2%貺 j D$ PU Uohe%c D$(SSWVh$-%o $jɞ he%fMuQ1AtCjV~M u4Vh2%"1ɉtjVZM uVh2%j) D$(SSWVh$-%; u$~h8-%jTȁĐ^_[]1USWVhh>1%膣(9tPjjhS-%K199|9x9t9p93/u D$83ڃ9tLa9u@p9Q/uD$/u.9p919hbjB 31@|$>ZLa9M t9L$ |9L$j5lj<5pj<T5pj<&=9th.%j聈9996P5p9hg-%jaaس9Wj 0D$ttRN1ҋ0t1t /u oBrgLa9uƃLa991La9uAuVD$u,D$ t9D$|91@La99^/ |9Fp99QR5t9595x9Phn-%h` jj/_5$9]1[a9tvh{-%hu>h+_t$FVj/~th-%j軆h-%j謆h.%j蝆1GXa9Xa9th3.%jfhV%_L$QP؟u{hL.%_$QP趟uYD$3$L$3$ t?hQ.%hp.%Mft!hz.%jޅhp.%h.%a迪1=9th.%j訅9]$1L$VVPQh$-%4 }t|$ th8-%jTGjS"e^_[]1F]VD$FVjX-F^SWVPD$$h#h/%{at@Ƌ|$]1Ph/%S9 4$WV Vh[%S^_[USWV-< 3ta1F8 3t&U7Jd1tUhk$h] 111Fo u1tjh1@1^_[]VhK/%]t$hPV hhh9V9 x(h9ƀh9h^/%Q= j/Pp@Z/%9^SWVhg/%&]i9hPV! VXj9K59@ j9j9PVhc5%hW1? jWhP"1 hIVj< 1hh|/%WWhIjHj j j jVWWM94ƣ 3WP+ 3V':WB jjvt$5j9h/%WVx> hK/% \$WPS S`SVƳj jj1@^_[UWVj\ WW W |$ hPW j WtZ9 j9tV("RWQPh%hhe^_]1PPj< USWV=s9uj53 ǣs95s9u3Pƣs9^V=s9~GtKOs9i9W W;j9t1s9hAY s9A bs9$i9$V y))L$H 9Jx .@ SPt$ D$Phi9Ι=s9-39|uP5s9 s9QjP P5s9y s9 QjP -3D$%=@t=ut-s9D a1s9D8 bt$hV%t$ =s9-s9j9i9P  s9D G=s9VX V跬 $$s9B s9fJhcjQPĄ^_[]VPt$D$ L$ $tt$VPB (9t 4$VPB ^PD$L$ T$$RQP XUSWV$01$D$ h/%WL$Phk$QGp h/%WPhk$Q!p h/%WL$ Phk$Qo t$ \PThc$t$= D$4$L\h9"PD$\$t$hSK tt1hB#Sk 4$0PP$4V u <.=tShk$t$t t$hS;K ut$t$%t$ t$襮t3h/Ut$FVj$~t$t$^L$ t$QEjh1D$t Pe $t PU Whk$h2dU jjP$T5$9~1N^_[]t$t$VNQFZ1Njh214$#Zt$ 4$ t$ VD$FVj#F^SWVPD$$h#h0%Wt@Ƌ|$3T1Ph0%S 4$WV5 Vh[%S\^_[h70%h/%S^0%)1ۅt0"t0" 1ۅÉ[USWVh݈# PO D$1Ʌ$l$h#UA ti\$WPS 9s?hhV%Sm =w%hVSW =wjS= t@h#U3A u4$ 1jV< 1Ʌȁ^_[]4$1AVt$Vs1|TsrLc1f ^Vt$h$VtV9t ١9$9^WVt$ D$wǃr9t\x&tSPQj+ V5pj<*V5$9*V5pj<蓝V5$9脝5pj<V5$9H5pj<5$9 ^_WVt$ V u.>v0PVWhg0%h'37 0%^_WVt$ 0PpPGt$>FFVj< F^_SWV=3/t/t$3GtPVLt /u?É^_[USWVj$t$ <1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$Vƅu1؃^_[]VPT$ D$t$4$cVP ^USWVӉϋl$jUgtMƅtPt$Vi SFOVUP tP׃SV^_[]VPT$ D$t$4$VPv ^À=k9uak90"h91%91%l9$9|$90"9SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPy $LL $UT4L$ L8L$T$T@Lƽ$$hVWU赸 uD5<w |5L Ku1PPD$P袠 )ƍD$Phd@V |$D$|PhedAV V+f$1 GaD$P$,h1%t$Vϴ 1PPVҟ $C]su PUhhk9t$蚤t.k9CD001 k91 u=k9tZF9|4$<ja$,h%;%$0u EPP" jOhl9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$褟t$$,h%;%u虳 EVPhP$P胳 EtE @E w-G$9@  VC؁^_[]1D$L$I@PLa9wʀuWa9AuLa9 La91USWV$$1$hWV E jShWWh8Wh5a9Wj jPVWL$4SP)V=%1Ĭ^_[]ËD$1ɋ0t1urLa9A1ËD$1ɋ0t1urLa9A1USWV ։D$ $E1$ } D$$ ,$D$ 2%貱 $F'2%uC2%D$$2%62%uk2%F\$$9X \$\$$&HD$\$$)|$=9=9=9$ <$D$D$2%<$cq|$4$D$ 9D$@%蟰 |$D$ 9D$9D$2%=P9u$AyD$1Ƀ 3\$ 3C|$D$$$ջ$D\$$({|$!<$D$9D$ 3z=3O1#|$l$ D$D$v2%$kljl$4$ K=P9u $exD$|$D$$.$ջ$C\$$'|$u1="9=ܞ9=9$ <$D$D$2%<$t|$4$D$ 9D$@%ծ |$D$ ܞ9D$"9D$2%$juLl$ t$<$D$35%i$ \$<$D$n5%i$ l$4$M > ^_[]Á=3ftp]I#%=3PFSWV|$tyj9GO4VStRV3 t{Sy5j9j9Vhi95j9h%hS % jShP" fG 3~"P8ptVtVd1^_[ËD$ j9Ɓi9 s9fH t9fH1SWVt$j9i9V~)S4:Q Fs9Ft9F1^_[ËD$L$01ÐSWV1ۉShPS$ {tD$$P t V8Vks81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW(3V虗y 81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=x91SWt$ t$L$ T$D$T$SWt$ t$D$ ׋ 9t$ t$(23%L$\PSWt$t$,t$RPPQ! $x91WSt$t$(D$T$WSVt$É֋= 9t$Ht$H迍$PWVSt$t$3%PPPQ $VD$`Pjhr1@USWV u C(D$|$8hjWI wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0Q^J<$L$ PP@ǾhI'|$D$u$I'B I'BI'BI'QP׾I'B@ tu ǾI'pЋ$+L$L$8L$9Ǿ(J'HQQQQRPRPjD$hPPjjj VjMZ4%SP/WCVUSWVt$vv0P! ~ N$ t ~N)É9|11ۉn$^ FV1^_[]USWV8] RsPQL u s s$s sst$t$0)x" 1Nv9} +KsȉC S$1e^_[]ËD$p( 1ËD$@HpL1ËD$@HpL1USWVl$0EH|$SPWH 1SWWVVjjj t> tj.31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSP薯 EHHLSWV t$ vDhz&WS 1WSSPPjjh= SٿFDNHA`1 ^_[ËL$Ahh1USWVL$Ay;9~9h09P;9~9h09P;9~9hj09Pƪ;9~9hB09P螪;9~9jG0 9Py;9~9jH/9PT;9~9jI/9P/;9~9jJ/9P ;9~9h/ 9P;9~9h^/$9P躩;9~9h6/(9P蒩-99~9ŋx$t;11ۋ@(48.PZ-99~9C ;X$rɃ-9\$h|$lCD u9kwi$XI'N4F8hv~4l{9F FN$Nj5x9QP T onznnoo*vo5f|59Uh4%sFH@Hth4%sFH@Hth 4%sgFH@Hth)4%sMFH@Hth04%s3FH@Hth<4%sFH@H thD4%sFH@H@thL4%sFH@HhQ4%s\;T m8m,p glhO1#Uh3%sxd{91F( { 9FH@LPt,PSUh3%W{9j5x9vv{9j5x9v$v 5 9RPSUh3%WpT{9FH1@LQwFHpX5 9PQE|FHp\5$9Uh 4%FH@`L$Phz&jQ h+VjP P5(959h3%s*Vbn+~V|$jPWRUvPQd@( m4 +WP59h3%sT1hh*P5959h3%sh^_[]Ës=(9h*PWUh3%VҋFHP59UUSWVP $1jlv bD$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$v<D$F@ F5̲9me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|~94$ukGllPwGX FPvt~C $i)ىQRP? 1D7D77pfD7 D7 ~4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A fOu\$ t9fA |$tApfAA~ 1AA tAfAA A 1AtfAA) 91jEVVhhhrjJVjVQPhXt94C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*ChV%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0&ƋEp&PVjWPUCƃu4UtU&ƃuEtDjUуƃu:C(C,SPs{,1s$@C$10s$%C$s(JC(1ۅÉ؃^_[]hK3%h63%hlh2%USWVt$ kFllPv-Nj\$FFi )tkllklPRQy ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ f{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh-- WP1^_USWVD9t$ 1$V[/} Vٞ$T$GD$ pjVHD$D$ 1ɺ<t$t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$1K&L$t$ 1L$t$ QVM؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VWO1#VO1#RPPQ`O EHemL$ U UWRPVQ0O tD$8h^L$8jPPQx $l$P tR/L$8jPPQ Y0ƋpǸO1#<$u hL$8T$ RUQPWVSjjA$$jBP$ L$+5 9PWVQ jCL$5 9PWVQ j-tL$5 9PWVQ jDThEV褖Ńw-,9W艖ã09~$Uj-Pk ň$E Eۉ4$~Sj-P@ +@$t9PhZ4%jPS, -,9509j.SPWVt$UD$)PD$:PD$KPh4%hhXt9 0hջ$F)^_[]USWVUu @(D$=49uj%49]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;Xt9D$0BD0 Cfd0 j5x9t4LdI9LhD$$r1CExhIPSt$t$h4%WMA9Xt9D0 tfMCfL0 L$ D$$x91RSD$PL$QxD$T$t$,|$(1PSVWZD$T$ t!|$ t$jSVW9T$ D$1L$0]D$ uuut$@t$@ij2j3j4CNj $Ut$TBDL|$D$uCD$0 ttt$ Vh3%D$DP) D$8D$ D$8t$XjVt$(1IQjFj QPg D$89D$ t PV$P |$YtZVzB MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơx9}] aVt$ zt$n؉e^_[]USWV D$ 8t$8L$j QP{ $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP脾VGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋x91щT$1)΋EM M1WRQP跽ljT$1Pt$uu蜽)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VS\D$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h $jV C `L$rL$DPh3%uL$DPh3%jQ D$D---D$D$s 9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh3%P$ SVh3%P$ V"WSx9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h $j$P8 t"?tt$ Wh3%D$LP8# D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PWi{{ t|$uuxD$tF ~,1t\tW J' D {u6H L> HL>@D> >jhEV> wE%rhD $uR1jPPPhyhPj jjj%VjMo4x!t$PEWYV1@^_[]h3%h3%hh2%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ J'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; J'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh_#jS t$]E%fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=T9t@u.1}h[ju tEx 6%rt6%t6%M u@=Uu,>t'D$ L$D9;\M`|ˀuK(Ѓt tu tPjbjW!DƍD$(PV詐$1 $$QPVC $VD9$ul$`=u]tP$PS^ $5fǃU'V2DWhk$h6% uRe^_[]SWV0\$@1҉1 F FFF =P9tjP4D$VjRRS/<^_[USWVD9(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h6%jkt1e^]USWV8=P9EM 0~klP1ěËE E8؃lklQSPR ߾4K'D9$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSP F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h;%hu;%heh*;%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$9u 4j9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$K'd$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uthzm1Ot1L$D1 L$8ɋT$]t"9tjQP[M T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(9u Rh9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$K't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nhz11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQeK |$ƄE C ^_[]WVt$ hjP[ ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut;%1^_[]Ãt ux(tth}ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVwH >uD$ D$iousD$fictO4uQG4 t51ҋ5.3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD= l$(Ph<%U8 h9"UI [Ɖ$Uh<%jqu D$Ph<%V^u wXw\w`h=%VGuPwdh3=%V)uwThD=%Vu f1ۍ{aE4L'WuWuWhO=%Vt E< t<uEMPWQWhg=%Vt$<IL=%9|""PVtC9z1h[%WltV· D$PD$Pt$\$4Sh=%hv=%WSM 1(^_[]hP<%h8<%hBhh<%h8<%h1h<%h8<%h h<%h8<%hh<%h8<%hh*;%iUSWVhjz{1O1ۍD$ShPS$4]t9+ōF,PhedAUs l$$4$0$($<$8у|1҉$$d: F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$ıt98t4 .jPL$QID D 9D$ u D$4$P,$F n$9Љ} 1F$F )ЃF n$,$G9t$ $$h=%jP& r=t31>t9>u 9>t0uk9uV~V~OV~U@ 1@19$,|;ЃV~t$ ؁^_[]USWV@D$1PuRhjw;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dL'u_7 FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hP<%h=%jg6hh<%h=%jh(h<%h=%jih<%h=%jj h<%h=%jkh*;%>D$T$ L$DrRQP@ ËD$Djt$ P$Y USWVl$j/Uv 1NtbNj\$)CDWPUA4 uHD/t(t+t!u GF "u^_[USWVPӉ΃=9ui"sv<9 99tx(9w4Ju1AQPtã99H 9k4+$1 4+Vhz&jRצ 1D+ <+ hrDVPh%jW誦 1D+'<+(D+($D+,t+0^_[]V΃=9un9) 1t(@"u9t 99t 4Hu1^USWV|$4L$0Rt$`VQW) ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=9u U9~V19|(1@@89|~@w1A^_[USWVP=9|$(L$111=L'"\$uӀt0t u@tӋ;L'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hL't$(t$(t$(PPt$0L' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWV]nhhL'h$9VX $9jԛ9411KjUcƃwDM'DtGCuޅtH=9Pc9t)1ɀ<t M'AuVhs^_[1V 9t(91t ҡ9 9F9r9P s^fUSWVPt$L1h;4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hc5%jQQWRjjh=%T,1^_[]USWVhu}WWPHD$T$D9L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhvD9@u ǀ@>1t$(F F>D$,Vt$}|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP3|$4r!1FD$0P2F;t$4rD$0=0ԷD$p÷D$6起D$v覷D$  O1#1ۺL$#PWVSh0RQ/t$kPWO1#PShPV D9VL$'Qt$t$t$ t$PPhyg$hջ$D9$0$D9$pضFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCChffC C vCfCC=9rC fC*C,G1ۍD$(htSSSSSSSjjWPh48Pē@,ot$VW賅WǔFuQ1K59ilt PWlt$肔59=l1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$%HhD>%h3>%hh=%oUSWVXT$1HD$D$D$1D$D$9A D$ |$ 1ۋWSVPL tED$0t=L$49u4D$ |$y) t$D$ L$$D$L$L$D$(L$,L$D$C;^ rD$ tR|3|$y,|$tHt%l$%h>%hh=%*iD$L$I1@ËD$@1ËD$@1ËD$@1ËD$@1USWV։ϋQP\Ëo tEjW]t9\$t$t6t/1FfA A Q9s^9։r 11uqfA t$T$9fA tApfAA A A1AAA tfA*A,a)0|9u >^_[]h>%h>%hyh=%gUSWV$(E]0ƋEpجljl$E@ t P迬O1#PWVSjh]1U5x9|$ ww,^4%t$R5 9RPSQV U5x9w$w ]l$45 9RPSPU貏 G\$skhSjPD PVb9j!h?%VG VH&hϫ %L$5 9PRUQ) h被$5 9P %PUS hwPSD$Ph/?%hh 9ӎ 1҃9Q9A \߉$4-PWh$#j$W莎 hWh 9& Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,Ŭ9$EBL$ ;QU 9VhA?%Wb& Vh9WS& hջ$Rİ^_[]USWVX] E81hO1#PPPPhF?%PP譍 9_ vSL$QSWPL t@D$ tWD$8uN 9uh 9D$9H*hO1#Vh%#Ep[+D$8u RPt QPVW҃x91VSt$t$"[D$$VSt$t$ [L$8QRPt$ t$hF?%Ep[D$V9p1h$YQVu WPTtY$UtOwGD$VPb#)vVQj PKf W@ )Q$YQP# H LCF;puD$VPhk$EpZZ e^_[]USWVLt$`T$d\$1*kvs0C41GPjh3  9u vEL$QVUPL 1hPPhh hj6Pjjt$(SP4ōt$ VPwUƆS^~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 593^|$.9L$`ʉAfAD$ 1Ƀx fJ1O S]1L^_[]USWVpU t$01^F4jjV1AǾM'D$ǃ@9P;9~9h 9Pr;9~9h9PJ;9~9hƞ9P";9~9h螞9P 99~9x$t911@(4cP 99~9E ;h$r˃ 9$F89~.wy$M'C 99v-v*)NjVl$hURWv4PQd[=9@( I4踝UPWh3%SqO{9- 9j5x9vv{9-9j5x9vv N5 9RPU<{9FF NN59j5x9QPN5 9RPVSh3%WNDC 99~?u 9F u97#VRQh3%PN^_[]USWV$$x+~8P(TjsNVUl$URWv4QPd@(1ɺRUUQQjj4讥 UWv4PQpu Wv4QPh 1^_[]SWV\$P,ǃjPKƃt E Iu1PPPh PhjPj j WVPy4ǃtSWkC=WzVSR1H^_[USWV8] C4t VPQRL u s ss3r SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3'SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQ_ D$\$1hSSVVjjpw ;tUSP@u54$1hSSVVjjp7 |$u^WVD$ t$tL$ HPQ0vtpvhhyPhk$V4K ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV h@%1jx$@%xtD$PV H$#@%KtD$PW 1yoh#@%螙hPW D$PW 1u!h5@%nPWh)@%jϿ1EWh?@%j.A hW{ h@%W͘$hPS' D$PS u"hI@%W藘PSh)@%jY1EhR@%טhPW Wh5%j* 0l$ShR@%h\@%j t D$@%PV$SPWo hh@%V)@%1PWQU豾h@%VЗSPW5 ht@%V跗PW)@%PUy@%PV藗Ph@%U[ ah&%VrPh@%j5 ;h@%讗hPW h@%V0PWh)@%jh@%khPWk h@%V1BP$h@%VΖPh@%j葽 h@% hPW  h@%V茖ƻ$3Wh@%hU$y 1tVUh)@%juŃ|$tjh*'$Ą ^_[]USWV ։Q 1Ht L$ L$$W $f} r= jh@%U u&USh@%D$Pl uhm#Z W Ņu>L$4t&t u$Ut$ t$ h@%j t$/KW $ ^_[]USWVՉfD$/D$jhe%nD$5Ĕt&軔8t豔SPh@%hUuw VSU 991j/U^E t5ÍD$9tK9vH8/t@P' CߍD$ PW% D$%= h$PW) FƄ$/u&Г$QPhc5%hUv /h$PU" hhe%U  e=@uW& x*|$VW$P 9r>S?S0|$W WS01Ĉ^_[]hUFn t}/u }$$tcD$U W Ɓ`|$tVhV%U 9=VWU 9%|$W x(W7R>1F1SR0jh)#jm SWVύD$ PQs 1xVD$)tOjW{x@ljj PW' W< u $=rɁ uƉĜ^_[USWV hڐljPhW@j0: \$hjSN jh@%D$ƍD$ PhW@V9 t$1hUSM ,$dN'tWP\Cu- 9D$C *E,$ !u1L$PPPPhdjPPjjj!Qhm4t$t%jit$VW_Wn6V ^_[]VD$@t(L$ 4@\N'VhW18 F$91@^ËD$ 9fH $9tPPQQQh@%j϶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj ^>D$48T$y:D$ػ˺ :$L$~D$<P t3O1#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$O1#t$DRQPh;C%jVlp D$ T$Bj5x9QPv>O1#tr%t$DQRPh;C%jV(p D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5 9t$hc5%jt$hVD$XP1WWjjj0ߕ,x9|$4D$0D9L$QW<W,D$DPVs~ljӍD$DPV?|$߉څu D$$H؋Pٸ"D$<h,%t$>|$,] {t+[1hV%S>t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$hc5%jt$hVD$XP1PPjjj0k,j D$DPV D$׋D$@t.3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWs )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5x9PQ |$ RPh $jWk ; 9CVpSjP jPPh'9| V?(^_[WVt$ 5pj<K5pj<=~$uFjP8F$1O~(1h'9QQhhhRjFj WjPv$h(9e4F(x;F,VPWv(fv$`>F(F$~,v$>>F$1^_USWV4ˋA@Pjq$D C{$t%K0 u G fG lJuO'fG G5G\*G G,+G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPd+{$4^_[]V$j)ÆNv811Fu >tlIut5t.j+j,L$PVh]U%jPQLi 'u tEj,j+蹅L$jPPQ h""cj*蒅L$QjPm6 hջ$<j-kt$R5 9PhP$jFVh j.FhO'PVhBC%hh(9h İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5x9RQg6L$RPh]F$jQ)h G<(\(|(Pu#]j#艄L$>PSWh4%j&Q%j5x9SW6L$t$>QRPh;C%j&Vg $F|(,u)|$hf)PhaC%j(Wg <$1e<(Ou*?D(Ltۍt$hPWh^C%t$t(Tt(P/PWhP$j(V-g 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhmC%v*5t 4$:|$|$upd^_[]1؍L$>PWhWC%j&Qf  $L(4RttD(8tPQ҃lj$uFt(Tt(P6lj$FD(Lt&h谂t$PWh^C%j(Vf 4$h节VjP  lj|$D(dphYPVhfC%j(We *USWVD9$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPváD9H1WjHDWWQZơD9$1$ D9@u <@TX uDHXT=|9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W WO1#WRPPQ1ҍD$*W QO1#QRhQPD$$W QO1#Q1Qh0QP&)ߋD90D$pL$$QL$.QL$QPt$SPW0 D90NjpL$$QL$.QL$QPWSSj'[0 hջ$F0W|$pDG$DŽ$$T$0<$tT$@BfBBE.ffJ B S.BfJBa.B fJ*B,o.=9r~(uB0fB:B<}.@1L$0htWWWWWWWjjPQhZ\4t8P/\@,o$PSNS/]$X(؃u D9TXK$O'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u hV%P/T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5D9)R t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!P L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,OhV%D$ P&t5h,%t$ &u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$VfGT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0p9)ދt9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4>S tt<1^_[USWVGD$5Ȳ9l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 199ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX6AL$D$~@ 1ø11OT$LhtQQQQjj PWWSRh649tBƍ|$WP[(Vo7x#9}x9k<4LE1UЍe^_[]USWV19T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=l9t*=@911M<t9\@u 9DDMHEr=h9tO9D$PP1ipt$1t9 :ut$P9t:,@uލEpr=99J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@@9D WVu)y8u.q$t"y8uqxu Hu^h#h?E%hm hD%p D$x8u@h#h?E%hm hD%I V 9; D9tDȲ9t99t‹9u€Ȳ92t Ȳ9^WV΋$tRttyu)Ȳ99tЋ9uȲ90u1H|$5Ȳ9,1C1҉T TTCD ~k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D ~$kt$$t$$OƋD$&$4WVPhE%hS4" M$4jt$t$8u"DH $4jj hO1#QPjS#pSW"?D$5$4whG%Pd w01k,Cy uC,1uSPQD$=P߹ PhD?%D$=Pǹ 10u?x@t$5wtiD$Pt>ShH%h>T$\$ 9$DL$4L$090|]t$VaPh@%WS 9( ( PQVhH%WSt$\$ CCa59.> >,>(>$> D$)Pt>ShH%h,S$$(t$,t$(r Ԟ9t P x91`Ԟ9tWWhF%COWhuF%h'3q Ԟ9t8WhuF%PY Ԟ91Ntjh'F%P= ^_[]1N=9tt$hD%jPMR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ D9V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$$ytP-ptYWtDžtFE tWPV u WVDjVSe E t VPwVq1HPPS| ƃxx90^_[]h#h?E%hm hD% USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4T'jP8 D$$tI t1$?$J1$@( 1tiu`$A,\$ D$4hQ1#US 1USSVVjjt$" SK xL$1^_[]WV|$ 1uOG Pg t/1; }O"h9x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h]t$hPV5 $$$`S'D$@{tUhD?%V蠓 USV蕓 8Ouڋ$xhKuhLSPhE%V}C(~PhQ1#hV }hMHC,~PhQ1#hV }hN#C0~PhE%hV }hOVPhE%W^_[]USWV$T3u*11IhtPPPPjj PQQjh43P4T3Nw'$Q($tS'WP]1N1jWWVVjjhP lR, S0D$4hQ1#QP 1PD$PPVVjjUv D$PH x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP Qkd)QhE%V1 ^_USWV$h]|$hPW $$$S'{hU VPhE%{hVvvPhE%W;[hW\1~,t[hX?1~0W[hY"ǃ4V~ uh]V0FT~Ph#hWZ shZ[h]1~`{h[vXPhE%WF\~PhE%hW sh\mFd~PhQ1#hW sh^HFh~PhQ1#hW sh_#Fl~Ph#hW sh`WPhE%V/[ha1~pPPWhE%S^_[]USWV$@1N R$eT$S' 1jWWVVjjhb|Gl=OlD9,1۹cWS<S1,G,10G041jWWVVjjhdI 1`G`fX"g\hd ihD$4hQ1#QP 1PD$PPVVjjU D$PD x1pGp1^_[]1wwVt$F~|F Pt t1@1FF^SWVT$1ۉZBr 1Bl@Zp蜇Qkd)QhE%V| ^_[VVWhE%t$ < ^_[]fUSWV$8tW衊ƅuWh"j$$<$4D$Phd@U谺 tg1OVhedAUQ F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh$t$T!1 Sh("U蘾 CPh9"U6 C PhE"U$ CPhW"U CPhk"U $@D$t P1-Uhzd@$<WX t1 VhedAW= hjU$ D$ P$4K D$, 9L$ȺL$9u0$S11:{ 8tx$0hϗ"p b$11҉ $ƅ*ŰPmj PU ^_[]$0h"j讇USWV01ۍD$,ShPSuy1NtAljSPSWuWauMU D$t$$$Q1e^_[]f>=9=9 á9th(9Vt$9uh~(99w1 k<9^Vt$=9u hK(1t*u9 9t992tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hqI%hZI%hhH% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F\V'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$9uh)9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IQ sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWߟ .Qw$$$(T'@21^_[Ã!t*Wp1@<QcWPV rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$PhJ%Qc D$D$uPhJ%j_t1ۉ؁^_[]E@USWVt$ $=9$Wh5L%jP 1t t^_[]Ë 9 ÍD$TWhGL%Pj1~jDj&tD$$""Vt$X[Vj[D$(D$`C\$\C D$XD$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1hB#W ƀ8tt1tCuVL$ D$ j jV{` É$qj jVg` t#D$Zj jVP` D$T$C\$ \$D$|$u\$uthhD?%Svp hVSgp \$E61ۉSt$,j SV_ É$ tbD$ ʉ $tQD$ D$tGjhw$t$}V8 tOjh$V$ tdjhh$V te|$ush""jYD$(krT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j hV'l$}U~ hj\$tJ@j`PQT$cn T$ $B0Z,D$B8D$B4D$Du0|$\t)Ѓt$XP T$uD$DЋL$Ht D$ D$,D$ T$HD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPvH*W߅uv ^_[h}L%htL%hhH%Ѩ D$phL%j iSWV=959t^s譤3裤t#$t$j(PVf 4$a_u9hr|$0VPhP$jxW WVV &t Ĩ^_h"%hCI%hhH% USWVσ=9u h 1t0?t+9t!-9E WP tt/|$thh%Sa !hvSxa u4$$$$$St$hK%j ^_[]SWVD$Qt$RhK%Pj h""t$J$jhV'P,T uWh""jJ$tAt$hB#W 8tjt$2h""juJ$ut$g1ۉ؃^_[USWVӉ΋|$|$tBhK%S蔗 hK%S~ hK%Sh hK%SR hK%S< hK%S& hL%S \$hH#S ǀ?t(_#pV'WPӖ uE F@j`WVy^ -j(W|v tj)Pkv t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU; |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3hQ1#WUN WUUjUx H>wѻPD$x0hQ1#SU SUUjU@ H=wˉD9DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRPю 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á9tp.9Vt$ 9u V. 919vFt=N9wu1wT989^ËD$Hs-s \'.h#hM%hhGM%詖 Vt$ =9u-(t;u2L$ rȃs4\'$tu 91 89 :^WVP|$t$=9uH-j PV =v1t-h[t X9t4T9^_Ë $9u։^_-=P9tL9ù^-D$1ËL$T$t$ h4.WV D$$s1!t$ T$L$7GWhS. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jhO-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh?-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh,^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phe,D$PhwG,1\$}UM;t;Gs} ShrD%q} ~ShG%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWg L$D$ T$VQPRt$VhI%h$P0 $L1QhPjV肁x`WhydP D$V/|$t;jWSR \$;MU}hM%hM%h hGM%ۑ 1e^_[]RSQIR Sh%%RQ臺 ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS/x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS螅 )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋HT9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV2 )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SUOo @$\Cǃ1:k0hWVz D$4WhPW$XCgD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(tÉ|$U c#D$0jPUQt$(1 Ⱦu#\$,hPt$ W W3s|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P* PʢD$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjZitFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14oFuUot$D$l$x Ptn{ C K$;}sL$4QjSPL t_D$HtWT9)1ɉAw Puu2S"j@jPu fdžUSn1ۉ؁4^_[]h!L%hP%hhGM%r USWV,D$D D$HhjgƋl$P\$L|$@Z'W"( F|11Kn^؃N$F Fdž?džjh>USi @džPWwt%D$ D$D$D$F11,^_[]h!L%hIP%hhGM%q USWVhED$$11@D$ ljd$D$L$ыt$ +t$T$L t CuT$HBD$<81He^_[]ÉNjL$L$(PQt$4t$ xf ƉT$D9DH1ۃ|1J1ɉT$PWL$ QR7f t$VRP(f D$|$ ȉL$3D$3L$1 T$T$L$$ڍD$PD$4PD$|$ t&1ɀ8>@,19QzvPW# D$vP6w# 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h1P%hP%hxhGM%oZ USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]fUSWV0$H$D7赻15\:5X:5`:D$D$ D$1D$haP%WU' pu <<`:e~ft$lt*zD$ƒbtCeubD$벡<<D$ ChjVV5<<hlP%I\:X:zVhVV5<<hJ$D$Vu=!39}4D$$D$l$ t%1PPU D$yUhk$IL$ tHt$(UhwP%V) h^"6uRhP%fD$0Pt$;A #D$8=$$ \:X:jÍt$0ShV u UPVF UjD$0F \:X:Sty hP%t$(S1|$P0y hP%' y hP%vuWjt$:01St$+04$pt$dP%Sh e#PPot1hP%t$t$/4$&t$5l:5h:p:\'3|$t'3t:j'3t'3=l$u1HL$(Qhht@PE PtL$* x:t$AuhP%lʼnP/yhKQ%T D$ yhQ%@$uBL$$4jP.4$Dt$8V6蝕6hQ%jPh j GY j|$WUt$ x>tq1.SPt$ p y[ 19u2h:l:)u[ 8t1FVh)Q%1FVSh7Q%VQt$hD$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u [ 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj W UNPL$ɋD$tPu V,Y P hO1#PVhWQ%h'3蛀 jqu V jVW jR VP^Ð=X3u X3t:@=u1HP1;X3USWV}uCjh:6 ::::::: : ::|$(jW 5:5h::l:?X+=::@1;:)ω|$$\$ :95:T$s;D$0:D$(L$, :::D$:D$$D$ =p:EtQ1$w ww7wwVWV( 7www ww$PWjW M$m1~~~ ~~$PVjvW 1@F ~~~~WVWW( =p:B5fDŽ$ `:t$Phk$hQ_z 1F\: X:ƒ\$\$xT$T$|l$xY&ݜ$݄$ 4Y&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Whυ$QPy x:9|ӡ`:tPL$n L$)΅~DQ4))hO1#Shl\'Rhօ$QP0y Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4T]'QPh$SWx L$(+ :T$,:NjD$0+:x@B‰L$hT$ll$h\$@l: h:1F؃D$@5DY&|$vqL$`\$dl$`Y&ݜ$ܼ$`Y&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4T]'RSt$Dh$QP9w  \:X:ȃ||=l:h:݄$|=s4;T$D$r(|$$\$ ؍4)h$؍4)h$QPv ƃ}u 4)h""QPv ơt:@=u1H$VQP e^_[]+: :T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$PpU"u%hQ%SM 8tM 8#u$SjV' tGtV $1E48FB$)Ex t$7@[hQ%hQ%,FM hQ%hQ%/M 7hQ%hQ%YS^_[]$Vj$2t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPEuhX%hQ%oRÉhPKt4Vh8jPAEuhX%hQ%!R1H^_[USWVp $$$!19L$PVW1Hl$U ƃU聐 VD$PW1 tb$UtM$dt4k $dPU t$jW, tu)$-j4'WU 1Hp^_[]Ë$j-UP D$L$PjD$L$PjSVt$ t P닆t>PD]džW1ۃ1ۋt9P`Ddž- t^[VI Vڎ 1uI 19^SWVlT$|$$VPC1Nt/ǍD$P PSWQ t W_l^_[USWVӉjh0joQ ǃt{jjjVyE L$ F#tO1#g#tŃ=R%O1#O1#t 5R%؉O1#te%|$uO1#SQRPhER%jhVk ^_[]USWV$=~H 71Ha~B11ۋ$4V <(Gs@ ,PVQV" C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)G jj6ƅuƋNtHNO N uFF9sSP7tVF^ St$Ps! ^GNON1wOWhPw o@v<V<1H^_[SWV$uShbR%h R%9M $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6~F 8 pF 89hR%hvR%{LNF G8~ ~u3FVhjv G?uhR%hQ%'Lt6hWv  t%uhR%KPWVu  s V^_[WVp׉$ftPh%R%h R%K jL$PQW| jjP PjW tnjjW t\PjW tHD$|PWV t2Phjp >u6h%R%hQ%J"h%R%JW h%R%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Saڃs tAt1t% t&%S @ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV?t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jWwjWl5^_WVPt$4%5@u^t8tW%Vi$%8Vh#j?#45@u`V,&<jP,m u hR%G,dž,shR%pGj ?3 t1t3u5i$0)R$ i$1PhY%F )R$ i$1PWhY%F^_WVt$ h*"dG4r%t8t7 uhY%W㋎8 84^_j?>^_USWVD\$\t$XFpt+NMT$PQhj@RuhR%FD$n D$SPU6Vt)ǍFtۉ,$t1j@SPM SUhS% F SUhS%E 1KNދl$Xu0^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFD~ uC t<6@u,uVr'F@ ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ jn#(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P0 w_ǍCWt$P ;)QjP9 hY%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhRZ%Y> SWVt$~ t^_[ËD$|$F @PWDh( ~ t͉^_[gV6uYh}Z%Qw~LtV@t(t NHt8<#t;S%PV.^WVt$ >~Hxw16tЄuOF$uItV@u hZ%)=jjAV? u hZ% =^_vF$ljjVW? ZUSWV|$$\$|$|$ D$PjUSQBWPAǍh UttAÃx tC Ph!T%;G$C$G>C>>-ك**PWQ WtAt[ƃx t PhS%e;T%KFNtTHNUh T%;5 1O5 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh7T%:@1ۉSSD|% 1G|$ ~UVt$$%? { t S^\$ HPtQPV P <uV *US?^_[]USWV׉΋A PhZ%+:11BUY%tPVVUU0n 6ujc1^_[]USWV $ D$PQhh# t$hZT%hKT%9$1PhnT%91F\$ MbihS$( EuVhT%49u 3 87t 3 8 uF띃tVhT%9D$$ \XPW>&Ƌt8t* SV=uSj$( ҋ>$ 1GOtHONG Pt=l3uFGGtIO9tA t3@UUD" 3WQjj~.>jV't <t$VtS< t=VS< hZT%7 ^_[]Vt$N Qt<tNH9HHu^v$QP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/1 7 VhT%he"7T$1|$`F(f9t(~ tωӍV QPRhT%6ڋL$tf~(^>8u(F*4$QPωcU ~ tcF D$F*|$ <UWSPωT$P\$Sh U%6 <PUt$WPSh&U%5T$ V>t*4$QV H^_[]WVt$4rDD$ tN8tCt;D$ jP,A u!hCU%hvR%5 j-^_Ã~+ajjj ̓khU%h|U%hTU%4 1m9hU%hU%hTU%4 <5RhU%4@hkU%htU%hTU%4 111dhv%hU%hTU%d4 @+X1BWDPU hkU%hdU%hTU%4 11G1=::6u PW+:zhU%hU%hTU%3 t0SvPhU%44WV>1PPPVHCD@PjV/N48@t @ sfyt ‰48WV>K^_USWVP$t8D$ \$9}$w ŋD$4V tE9u݋D$ 9t9 uZ<$hZ%WZ1PPt$$  UVWX WIW;9t>G 1PPt$$ qWD$$ W1D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1,G@8u^_[]USWV \$@l$8;hU%Wc .h V%WM !hV%W7 D$$D$h*V%W |$t$<t$1 ǃt1Fl$<4 GF9uW$t$<l$U WUD$P E t=1FߋD$@D$P Wt$UT EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]' |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWr tFt$9t$VЃ с u VWVz^USWV$ 1t$t$,$|/xhGV%WN hU%W8 \$0hVSm j#ǃ0`V%\31O$(0@4jVB9u11@PP*u1Ajj $$ uL$ D$l$,D$D$D$$hrV%tqV%Uh<`'PSVW?u$hulM44tN6uD$륍HvH w<$]'<<$`$p]'D$U%D$dD$YxPD$wU%D$; $hd$ 'd$ 1@D$D$D$$l5<<I $lD$U%D$D$U%1@D$D$ x D$ %D$ D$D$FD$ 9!3t$ft$ y($l($t$p!3)$$ݍ\$0Su1VVVS6$U$ PjSA\$h[%y D$ 9!3$ 4$|$4W>!31VV4WP6I$ $ Pjl$@U1AdD$D$hS\%!y 1hS\%$hu($huhS\%x $dL$ 9 !3%$0gV3 U#|$tO1#g#|$l$0$the%QVhV%j+UA $hh]'hNV%6C h+\%)x 1O1#PPPhV%j+l$DUA  $d$h$d !3|$$tD$9tD$Uw <$Z$d$ht@4$  t% Љ$h$d tD$ @P%$d@gl$0$hV%7<$uhI"hV%$p$jj m $Uh5jh]'vVv(|$t`UɸHrFPt$h W%# \$SVn 8$$Ub $d$h$d$h!3T$QR$4 $ $dhI"hV%l$0<$rD$t<t,<ulh\%u D@U uDh[%u LHUcK h \%fu TPU!r D$1D VhԳ""4$hI"hV%"D$1Cl$0$fu UuhI"hY%J"D$PUR'$tCt)QqtrqpQX#$PkDŽ$WU9$ t P $3$$U#q$ U# U@$;\3t P$hP@1uhY% $ht3$\t'L$jQP药 uhI"hvR% !$o:"$lXh\'3& $<$h ؁^_[]Ë$ r,u'!3Qj$4 $ u*$d1PQQi $  $g@u hCW%$ SU; hfW%~$d5 $h$d$hUhmXjj$#t'UhXj$,$hI"hW%hI"hnW%Vh(W%U$-hk#3 8thI"hW%!$d L$ i 8 [$d$h$hl$0$hhW%谘 u!s 8thW%hI"hW%} hhW%x u!; 8thW%hI"hW%E U9tUhI"hW%Uh"X%1]$dr;$h@ щ$d$hUٳtePhI"hqX%KD$$Pjh0j, h~"}UPhW% @$d$h҃ ց u$d$hr>1r!3$ L$QPU@ [$d$hX%r !3$ O1#O1#tX% tX%VQRh6%:rUJt$01D$[hPTu hX%jVh!Uj$$UuhI"hQ%5$u($dr$h$h$dL$$PQV!$&$1l$0~O$4P t x uX%X%$4PF$$9|t$t׃z  Ru$hh!Y%PFD$0PJ$fh;Y%-h%vD$$L$($\P貫Uh/Tj$h$ uhI"hQ% $hhDX%o$hD$$L$($\QUh/Tj$h$: uhI"hQ%V$D$xhI"hY%]\hW%hI"hX%6hI"h9X%'hI"hX%hI"hX% $2 PhOX%$di$8l$0t+1 tVV$ uދ$|$WPt$8VN WV'D$$f@t D$0P$1t*1G{ tSu΋[uً$d<$r0$1Ʌt z uRl$0<$l$0<$u@u0$h@hbY%P?D$0PC't#%@tD$0Ph#Qj$YWD$4P/$01~ tVh-jj$vS; WVjh#%苧t*VP uVhZ%BW>h#%h#%^_Vt$Vt$pApdr$PhZ%CjjiVhSjdju ^WVPt$D$uPh8[%h R% jP,n tuIh8[%h8uM, ,Kdž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS F>)^_[USWV$lt pvh`%PWn t=wM$lD 8th`%hk$h$u)hE`%h`%hh+`% $$l~>1ɀhL QSP ƍl$hUPt$ ٵUX =wfD @PUhh`%WAudhE`%h`%htI{>tA,$fEC(ffEEK*S>RQP C>4() P"1pČ^_[]ÍF PhN`%n tt {>u[[ht h`%? ~>t$fF(ffCCN*V>RQP F>4)mC Phq`% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#b 1HXjbu V >8t~L$ T$pFhf@H X@fPFM1^_[]ha%hQ%hGh+a%hQ%hHh`%P D$tFL$tt 9Jt    1HBH@M1@ha%hHa%hh`% USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jZDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$ha%ha%h ha%ha%hha%ha%hh`% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]ha%h[a%h|h`% D$t L$HH@Lha%hra%hh`% D$t@Lha%h}a%hh`% 11WVD$ t!L$T$t$|$x0p4P8H<1^_ha%ha%hh`%j USWV(l$<\$߾^'1|$ |$|$<$E4t.1FM0 I?r E4  G9rՉt$@Pja 1Nt91D$ D$D$D$9E4t$1E0jS4? t G;}4r1(^_[]ha%hV%hYh`% :tD$ :Q::WVjPj1tMƃPjt t/1vN F NN F N$(F(N,FH V^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PNSv@1F@FDFMF t@PtQPV P[؋PtQPV$ P:F uPtQPV, PF(uFN^_[jt$USWVu-~L =:t':H ::N8tv|x| @t,'\$$'3SVU% Uj 1 `3 s SVW> ^_[]PL$T$ D$$PXUSWV։ $VhU SPUhe"W ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXád3ËD$d3SWVhS$ ? 1OtFƃ ||t Q +D$HPh3Phk$Q] h3^_[á`3ËD$`3@PS hjh`3h'31f=`3à M jSP |$t V1H1@[Vt$tNVBV7VbV+-jViVO6d^^SVt$ V,1Kt=jhjҧ t!jhj趧 1ۃۉ^[陧 Vt$t'P蟎džtP聎dž^鹄D$t$t$t$ SWV$hjW C jPW1 Whi[ 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyHutUSWVTt$h^>tv w 7 j V1H11Ʌt7? $BD<IG9uލ|$$ ^ F>L$jPWV萃 uF>*PWV 1T^_[]VD$0tVjVv^USWVD$8t$\$ 1wG oHt/usOWtjURQPwVjS$IOXxuP uf@ wQ jUPSVt$,Vj\$0S! ?O^_[]ËL$1t$ËD$t 0\ VD$0tVVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjVR Fjŋ$@VnU $1WT$ȍD$l$C txuD$ Psqt uCutF L$0QPQ tًv\$~;1$D$0Pt& tF9u19D$$"$8ЃD$P1~11TjT$4R4 t GP9|PX~11\jT$4R4譞 t FX9|XD$ 9D$H$~11LjT$4R4X t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$腁uVhb%t$ 0|$w$H5D$hjQQNj$G jVP^ CG$C D$ t$jVt$dV5 C yQPD$|P D$lD$ @D$pVhi$& D$m@L$ AGA<<y4$<$4$D$0P$0a X`~,$d1D$0P4+ nE9uD$t$0V$~l$wVh-b%$]4$w ɺ@r <t.<5L$ 1@ut$h-b%;11@fG(t$ FG>W*$VTPRt$` $6@utWI{t^WfG@GȉGDWH~t GLGDw sW}GHGMO9Et$hb%WA$AD$l$t$0<4$t t)|$ jVW w_ jVS r 1N^_[]j:Sʿ t/@1UQhQQj QP G8mt (G8GjSPl O t .3DPu:pKCu1l$PVhVVj USH G0Et=it.u1@1QVhVVj VP <$ O4G4USWVP!D : : ::hWe%!D: : $<  O+VQP蹢 9v1 LJ\$ I;<j,jM@t ǃD h/e%~j,jHt ǃL h/e%Oj,jPt ǃT h/e% t$$Whg'V D$9rh/e%h;e% YH$|$ 7D$PWMD$t$hB#D$P6 ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWҖD$u?\$SV J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WmqD$t|#t3=w&AL$0h/e%he" HD$1D$S0W=q 1ɍD$D$$D$ 01D$ύD$PD$$PCD$hB#D$P0 ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hI$U hb%U h#U $D/'hc%U 1Ʌ<$t$Vǝ H9t- t u!H\Ht$9u1@$D$$<PS 1Ʌ $1@D$U$@tXtT$@S $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd= t6ʼndt$U `Dd<t A`Nh/e% <$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ@l$Uf'0 tu;uHUhfe%g'D$uuUh#Ft$$t$$Pg't$$^_[]USWVt$ t-tQH  8uP/|$t-tQ  uPtt*t$1PPU茳 t xTuXTj卆jPW5 $@DtW,Du싾@WRHLtW,Lu싾HW PTtW,Tu싾PWX\tWi,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(!3|$$t)`#L$# $ 1CƋl$ \$18rV%sqV%Sh<`'Pt$ujt$\L$,1VSWPVDjt$\t$ VSWUU&jt$\t$$VSWUUjt$\t$(VSWU|$Xj=|$\W Ê@tC< t< u CCu1j hg%W複 Kj h$g%W茇 jh1g%Wt 5jhXg%W\ )jhQg%WD jhGg%W, jhDg%W jhzg%W jhg%W jhg%W̆ }j hg%W贆 L$P1T$XPiL$T$t$XV(1Kj/V膪 uD$|$PjP\ &L$r L$rL$T$t$XV (1K6j/V uD$|$P jP L$ r  L$ r  L|$XD$P04$PTt$X*(T D$P@|$XAD$P$;\3t P11j|$\W{!ƉD$VӻjW>!t>th#%Vv NV $ǀ3D$P #|$Xj L$P T$XjL# D$XD|$PjP vqhe%he%D$X t$P jPZ hb%|$X D$Pa$<Qt$X谄  $<Pm D$P|$Xc hE#|$\W 1t$1VWjWWWWPބ L$P9>t$Xhe% |$X t$1VWhWWWWt$t L$PA 9>t$Xhf% |$X $;^l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV#$6?mjt$\D$ 0USWVO jt$\t$$USWVOjt$\t$(D$Pt$P1t$X#džD$Xw 8n j/P襥 1|$Pt@j/P菥 tƍt$Xp#t/F1VO#x |$XG t$1VWjWWWWt$tۂ L$P9>t$Xhf% L$P ЉT$jt$\[] hb%|$X j,|$\W蜤 d ƀxX 9l$Ps%ƅ |$1WShSjSSt$tA ,9hwf%GT$P |$X|$X4t4u t$Pt$P6tW6u @WQF t u VFu9냃|$X|t$1VWjWWWWt$t L$P9>t$Xhf% |$X7D$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1V @jP  V L$j < t< lGG|$XIt$P$t$XI $he%,|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$Ph$Ɛjt$\V3u7D$0#K@h 8Ut$Xhg%|11IT$P  D$PD$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆ_D$POf$6l$Ptu|$Xt h7h%D$X  @Uhh%'D$P|$XD$PD$PD$Ps|$X$6t$Ph?h%l$P@Dyl$PPTd*|E$ U|$XB.3E$$(y1|$Xl$PX$\PD$P`D$PD$PD$P"lD$P YD$PID$P 9|$Xt$XVp@ $d|$XO|$XG\$PH  @D$PD$PD$P@D$P|$X$;wl$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV8$6?mjt$\D$(0USWVFu8jt$\t$ USWVFujt$\t$,USWVFt$Xhfe%'D$Pl$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tVz 9]HVhh%cD$PD$PD$P |$X"t$P jt$\}' D$PD$PƀD$P@o|$Xt$1VWjWWWWt$tJy L$P9>8t$Xhlj%|$Xtut$1VWjWWWWt$t y L$P9>t$Xhj%D|$Xt7t$1VWjWWWWt$tx L$P9>t$Xhj%Qhj% Ct$Xhh%W à \$S训ƅ|$PPhf%SV  jV*j/t$\Y AL$1|$P# QD$ɋl$t t OGuhh% N|$XwE1j:W贙 l$t2At$1VUhUUUUQLw 9.Mhh% j=Wo  ED$(@1 t H@Wh]f%=D$Pƀ 11t$P # D$P1t$P D$X.U$ D$L$t$X;d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu Nul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U膗 \GSVhfh%xT$P   Uhye%OD$(he%4R Ɔ hf%1 D$Pǀhh% 1K$d Vh j%hd%D1DDD DDX.u he% 1D$(1heq$Wjhq%W1xhi%Wh$Wzqh "WdYhgq%WNShrq%W8h#W"hq%W hh"W h~q%W h hq%V/ hq%V h5q%V hh%V hq%V hq%Vu h#V_ Vhli%  t KC  t KCWh h%Ɔ  1t$P1$ƀhhwh%]ttC< t< Cuh'i%5ǃhe%!D$,ǃ%Ɔ 1sFL$PWGt$P jW n &ht%W6 t-hn%W$ th%W t h\j%W t@hK&Vֱ thbj%Vı D$P@tsFH t t@@1 t H@ttC< t< Cuh@i%Ƈhh'j%vsF< < F1$SUj tUhg%'1C CC$f8l$1USjxSjSSWyn $D9]i$ƃWhg%KttC< t< CuhVi%Ɔ L$P1S<eF D$PVv  7ƇhD$Pǀ1&S #؄  H@เrƇh%D$PǀFt< t< u GGu1L$l$S# L$1W F <$WÍD$PS#CUPr#؃8L$QP_#t$PWSP QT$Xj 6t$PjPja 1Ӄ  (jVtl$P  h+"1F؄t  H@hi%1K؃<^_[]ù@D$PǀcǍ0PVj_ xhGj%F -{X< < Ch`g%y11Kh@߉ ыD$* * he%_ C{L< t< tC C{< < Cht$1VWjWjDWWSj L$P9>Shg%Bl$1S 1K;4$(ƍ|$WP FWPv 8UPg D$P4$VP bL$PT$XjECut$PjPCt+j/S9 tIGC1L$P 1D$PVSj u7tb\$1SVhVVVVWqh L$P93tQUhg%tGShg%豾1F FF@dD$PƀMG =6 @/@(!  t$ %|$(t u$Wh}i%t$νt$1D$( s$t %@uhi%蜽?suhi%{tF1tC< t< Cuh$Wt)Wuf Åu"81rWhi%=1ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP] t(t$Qk,1҉T(T$T T!he%7S蠫IV(D$0D$ FD$(F^ t8Uo ljD$FWUP踏 >)QjP 1FFL$TT$`r|$\Zs7I@29USWV׉ˋt$$Vn >"u y"uIFA $Vj`ct*Ń!9 VS7c ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=.3DWtCT41Fu|$ D$ |$jjD$PZ T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$PY T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRb j=P̄ ,$|$D$ Vk 1ۉ\$t?t9D$ 1j=S芄 )9uWVSY` D$\EuV4$a t5ƍEjPt$ 8 4DL$hj%Uhj%hj%$ |$$t#4$a tzSTD$u 8Vt h9l%ňjjU u jWU u Gt ;D$TG9t ;D$TWUqWVmukGTL$tIѺ!! t=m%Wj3u!* 8t 8t hm%4W9߅81SSVAt tLWVQqWUn9t!ˡ h"l%ާWSSVs Džu1VD$PVD$ PD^_[]t$ t$ ËT$11;T$ tэ HUSWVPՉ΋BTx tt /4u$UhtEPXt1^|${H&t[m%lG|E|GT;ETUWyGttEtuGMQPUupG8M8QPAu\Gx;Ex$UVktb@tt EtGT;ETu8M8QP1Wj^1u 8t$hsm% 1$Uj)1uǟ 8thm%ۥ1ۀ<$tWVoW؃^_[]ËGx $;ExtUj0uj 8t hdm%~$=hOm%hHm%hh2k%跘 fD$t%@<t <u ø /1hm%hm%j;hm%q D$t%@<t <u ø͞ /1hm%hm%jQhm%. D$tBHt*t u#xÃxu x uxuxm /1hm%hn%j}hm%Η D$t>Ht4t uxjhLg'P  /1hm%hn%hhm%o D$tEHt;tu&xÃxu x uxux諝 /1hm%h(n%hhm% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^. Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=:uD1FFFF FFGF:SVrVW_uH:މ^_[]Åt 1u19[:Rt1hm%h7n%hhCn%h7n%h'hm%讕 USWVP|$G<t<$ $ l$W)Ã|WhV t(ٸF|$\$$)؃|PjVӗ 1=:u+:W9u!:c /1N^_[]hin%h[n%hnhm%跔 SWVt$|$~tuV\t1WMu;^G8u-8rt!1ɀu,r)É!rPWVw ^_[hn%hn%hhn%hn%hhm% USWV|$t$)Ã|UhVs t(ٸFx)PjVD ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmGSyKWVPQ ^_[CPh\$WVӻ 1t߉h%hn%h{hn%hn%h|hm%ɒ D$tL$tf Hhm%hn%hh%hn%hhm%脒 VD$t&L$ t/fqPp QPI H^hm%hn%hh%hn%hhm%+ fVI$`g'Phn%B u^USWVD$t$V1Ij0V1|$/ooo WV*5]'t-1C ]'I?r    DE9u֋-]'t/11C ]'I?r ߗ   DF9uWt$V|贗 1ɉt$\T$\RVQ2PeVPt 脗 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjPՏ tbL$1tHht7NH;S%t &8<#tÉS1ۃ1Ct:tV?tXtShPo%t؉8txt@HtPt؉CjV&t.Vt!thXo%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVL 1H^_SWVD$1t^|${t苔 1NA~0jheo%W_B uWWM G9rh\'3l ^_[USWV |$ 7u ;l$$Ujh{o%UA \$C UPWho%NS$t^DžtnjSW? ~ 8thp%h[#荙9hjo%~1HzSlt$hp%he"R tG11CGt0WJ ؃uhjo%ho% ?Ņu1 ^_[]Ë$t|$u%tPWhq%hp% =mQ臟PWhq%hq%辘KUSWVӊB D$ L$$t Wp *QPh]NjD$$7@uMh݈#Uo%tQho%W A Pho%We |$ t$ho%W@ {D$D$hp%$Uh t$ hPo%UN UJ |(6hXo%U$ 1>h}Z%Q h8<#$U 5h;S%Uׂ hZ%U  h &U諂 hT%U蕂 hY%U 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Php%W I4g'hp%W +7$@D$o|$L$ uMD$@tBL$qPShTP%W@TP%D$I|$tShTP%W <$tBt88t/SIt"D$ pHpDShTP%W9M|$ tSW3D$ t7t1Phk$W D$ 0uWf WXǀ|$ WD$(P D$#tp%Ph!p%W; vKHxS%t$&tRh2p%W AsDh?p%W 'CLPhKp%W  s$hYp%W SPhdp%W {Lt;CMt$(spPhhV tVhmp%WT {ttCtPhwp%W3 tr7@OǀD$(hg'PWt0ts~ t!V*t&PD$,P9uvhp%Ohp%B1OĨ^_[]D$D$D$hp%W t1PPt$0V^ tc1PPV ^ 9thD?%hk$Wı oET Phk$W覱 QjUt$0V] Ņu1UVWU hY%$V#} hp%V } h}Z%V| h8<#V| h &V| h;S%$| tzhZ%$| p%tn|$"D$<u D$xuT|$t Su@|$ "$<u D$ xDu'|$ tjS up%#(##D$##tp%Uhp%W Vhp%Wv S8E%tPhp%WP 3E%t= t1tVD%u vuPhp%W ?D$ thp%W|$"D$<uMD$@tBL$q PShp@%W:p@%D$S|$ "$<D$ @LL$ qPPShp@%WhhwUSWVl$t2E1Ft/׉˃PWhp%StEu11N^_[]USWV\$l$|$ttUPW-B 1tk<.tghz@#Wz tUh,p$Wy tCj h)q%W5 t/tj.WY tUW08 1t^_[]D=|Vt$ 'Bءd'3H d'3;t'3h\'3j  \'3H \'3 Fut$d'3H d'3;t'3h\'3j а \'3H \'3 Fsh4q%跪 Fshh%衪 Fsh$苪 F sh"u F;q%Bq%Hq%Pq%Wq% _q%@uwxnqq%rhg"r]}q%rR$ rGq%rG$t$GMEl } 1 ^_[]ÿ| 8D$t)ݿ"USWV$$${ t;$tu:{LtDD$@-KMspQhhP~%W3Vo6 18c| 1H(D$ q%tq%L$QSPWV胞 Ą^_[]USWVt$HD$DD$L$UjSon C@G jPS, fC $4CCD V$4PK UShipZ C O*W>RQPK UShipY q 1N^_[]WVc t u<^_ËD$t!@~1@Åt1HËD$1*HLh,s%h!s%hhr%sj D$@$u1ÃxHVt$V FMP1ɃtNpDM^SWV$։ωj!jSl Shi1Nu/D$4$t!!r mp 7L$SQPIJ މ$^_[USWV$$1ۉ1 jRV* Vh8i(CX tlD$th#D$=uX1D$(j!UPl \$LhUSl jWS) D$(CShiW 1ۅ1K؁^_[]USWV$1\$s ss3fs$ l$hVUk jWU5) ]Uh:iD$ZW ut$Ĩ^_[]USWV։ϋ$hjSk jVS( kS$V Ĝ^_[]USWVHE %@T+02]|$HhjWj G_@t$GE HtΉOG ǃ8D$ P}ǀGPD$TuUt$ L$ L$ u=M AT@fD$LD$TAXP L$ u D$T33 ȹu ȉL$PE @| t L$PE @xtD$hD$xD$|1G$|$u ωL$TU rT1ɉL$(L$$L$ L$L$L$NfL$SRPF tKC؍u} |$} t*f D$fC1CCC CCCC jL$ T$,PQRzF L$8 yu(|$4uD$5$PRQ E ~u~uF $ tUjW` $x1{ujS 1N^_[]WVt$xu9@t'G uG*SVP tu[ 1^_[]ËD$fx(t1ËL$ D$fx(uD$Z V1ËL$ D$fx(u D$Z V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWSrV |$jjHYƋ$(h@hs% ljFuJ1ۍl$Shs%j U,| h@UFuCY 8tǍ\$($PhqB@WA f<$f|$ jUSi ShlBWA txD$PhpBW|A tZ$$VЃuBD$PhfB@vJA t(D$FP>F u+ ht%_Ft PVXN1ĸ^_[]USWVt$fFtV)vv v[ AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ 1 FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP? ^USWV L$@T$ `^_[fUSWV!x%r't$Ph@#y uD$t_L$1۹tU1ɋ|$;t A,9u9u'u uh#t%1y PUD$C,9r|$t"w 7h#t%x PW,Nu^_[]USWVL$$wU 1H^_[]Ël$ |$ $9;l$ tWj 蚋 L$tu!s^+9ED$tSUD$ P. ݋D$1PsVPhm%Wz aunsPh4%Wz $P3Wj 1Ƀ H*T "USWV$ vS$$AKtGu4|$QPhW1Nt8Whk$SP u!"S 1tS 1F^_[]0rPhk$Vy 1Ntҿ9tB$Uj t$487rPhk$UHy u$j轉 HVPL$ uEt9BSu3 PVjp] t<$uffDw D1^USWV(t$@1ۅ@hHL$@D$E_l$u$D$T$Pjyt$  tO1#3EoD$T$Pht$  Sx%L$T$ sQ 1K41ۉL$$$ s09t$@耨ōGD$ t=VPǍD$Pr+ 1HȉD$ 7΋IL$uEtD$D$|$@$D$ PUEL$QPԷ8L$QPUt$@Rt1CL$$9΋l$'1#"t$@1Kt$@l$t>*@h t$ VhWx%V $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@趦ËD$D$ PSxCL$QPg؃8L$QPTSt$@9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU誵EL$QP虵8L$QP膵Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PlPVh+t%SK1I/ދ$0$4Wj$@U t|$r $,84$GP\lP$0Vh}k|$`$0PDL$L$QWhPt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhSt$$@$@$L0n E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P/8|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V! t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$~G  qG V1(^_[]ËL$DtD$L$tPVQ.! D$ƅu&G SWVD$ L$tT$$wG .11t$|$X+9sF "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p|@v\F\^VF`t# PH@v`F`^SWVjh0jN 1NǍ\$PSPhW5trjSjjW5t]jSh@hW5tBD$$1ɉ $L$ L$L$D$fD$DtD$jPW+ t W/^_[USWVt$+VjUAChu,$t#tVh!PjNA^  rU%st%PSht%cPSht%VJ 1Bh4! ^_[]WV΋tF>rD&0 GTt tB9tt9BTtI䋆tÀ~>r QVh{x%/J ^_ËD$$PL$1Bh4!` SWVt$tgw]VhK!je@^ w$wbPShx%H GLhyN ^_[USWVhuD$D$G$D$GH t-w8GGGG G _G_1ɉO OG_T$SPwD$@tGHDu%_0wF SPhgu%vH _0G89+\$8D$<l$8 dY&|$ D$ fD$l$|$Xl$ D$XG8N PQhu%H w$`w(<PSVht%GG0GHu% w$`PVh u%wG G0GH=u%c1HG8G4 w$~`PVhLu%>G 8\$0D$4l$0 dY&|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( 0Y&|$D$ fD$l$|$Hl$D$HG4N PQhu%F ?G0D$ D$$l$ 0Y&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pc_w0PVhv%E w$D_w0PVhv%Ft$6u$HujGtGht:?+v%tP2v%Ip%GHPu贫jV=c@O;Au<t (z%?u$v%GH0ts]ShK!w4Q<Shi(w8P;Sh(w0P;C w8w4Ph8v%D 1HG8G4]@uPD$u>C wiVPhfv%D wwhV34uVh|v%DOhD$L$u2wHS{3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;thR%"DjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]hx%hx%hhv%6 SWVt$^ Shx%BG0+G8PShx%A VhyNj)91G Why%ANhFL^_lUSWVӉ΋9 6uuufEt @M;AtTtLEdPDE`t3VhOjPR4uh@y%hQ%2A^_[]h@y% A^_[]$USWVPt$E $u a01E E9t~WSVx5 ur6jSVY5 t jP_= $WEWSV.5 u(h?w%h3w%h hv%3 PPV5 tSE EdP $PEt]U$uu h+CF Phv%?6uv%EHPVu Vhv%? ^_[]WV։h,jN(t/L$ PǀcSc tfǀ 1 ,^_ËL$h+VD$tF9tAtIdtI;u D$ thZ%P^USWVPt$t1t+l$$# uVjjO5^_[] GiP6VAtAt;<t5^ w$/WPShJw%= j1VUj4/w x-o owg-GOGO oo_H,$uGdGhSVc VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih D$ɀT$wȈBBV*QRP T$(  D$tz tA<t]<tYD$PPj@5D$ 1SPD$XP / 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Phz%9t$0)]tVSt$Dj0e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP\ ǃL$D$؋L$؋T$B)Á+),PjRc' ,L$1OAhT|$ 1|$CD$PjsǃSt$ P G D$G D$ GGDCff_f_1ۉT$SfGEhz fGG@D$ffGSf f_ t$WhD$ p\WF Phy%.0* ΃]w'6uhA&V Vjj&1gydA$jD$PVo$ D$D$uD$HwK*PQt$^J u)C Pt$h|%* ىt$ t$ [u^_[]WVt$ Vt>www  W6ttt9uq@苆t'P艻džtPkdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h}s ƍG 4$D$,$5\Y&D$\$$w%(WhAVje^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0j* u&h4j@@`GH}Z%GP_iVjhSZtSE0茭 LJ  twAQ \ BjWhR^jPh}%hQ%'sY EX>@PX UB( A J*R>RQP  ]rts4 t*Mq @T$hRQPPV]hJ}%2C>t2Mq M*T$hRPQSPV]h`}% & Pj"!1wLw w wL$u]rruG XixiF SPh}%% D$h$PS6.NRh}%%@u3EpCP t: @ NH M plYh#}%%u Vh}%p%ht}%$'3=u1HL$h$QP t=w:F h}%Ph}%4% w 1Ƀ8tmF SPhe"$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP} h}%$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6ȨL$ <G cSc{ ni;`CLsu &1C &cMScq s$L;PVh}% " M1CG V`e^_[]ÍG(Pt$ VM ËwVvGt.Vw P@ GG_dOhju6Guph}%E!u[j !уt+D$O0T$1)}0uF Ph-}%w w j1G G\$"O0)G4)G8uL$YME PhS%b A}w s$9PVh}%@ WuWVt$ VhAjtht j6t ^_[]Ër^tuGMEEVF $PE}t\$G$u=EHu%j7ruHW,댋Et {WZtstـT$sO$tPЃ8u)ʃAr  N@H@USWV׉΋D$$E t @9u ;M$^ Px6PShL~% EiP6Ң$u!}@uHhjjWV Džt jWVjj|$$tDZ%EHPV观#8#4 u2j-1Vhjj؃^_[]ËL$hyNWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hNSWV1{\t^_[Éjh Q裻 C\t4WhOjpuhXy%hQ% 8u"5l3hKy% WhXy%he" 1NcD$T$ PUSWV$$($$$$_\ftPhey%h R%[ ch$USV t'sPUV`t3_\t,Ct$?tF Phey%he" V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPhry%h R%i t `jW0v tD$ WV hry%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ7 t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P1PVhz%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@s={%n1ɋl$ T$Et*u4p{%& Vh{%m"{%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ {%t$\$SWVStǍF WPh{% W}} /6uh{%VEiP6.VhuPj EP'L$E t3MQWP E@Vjj?h-|%E&u_EEEE E MEM1} }p%EHPV_vWE\HEPTUSWV։ˋ$($$h{%R- \$ t$t;ED$P)PP $,uzh}|%$,tKP Í$PmSVht$ P袉V-1$,$t$Vj6S >uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S t$'4$teSPh"Vt$Wh|%t$( "ۋD$t$0$ P'4$L$ t/PUVt$Wh|%QSPh"t$Wh|%t$$ $PUt$ Wh|%Q|  h}|%`V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjjK AuA jQV_ t=Ht*ub 4$g&PVh|%' OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph|% v n1F FFL^L$h;^WËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Phv% v%GHPVq^_[WVt$ F Ph}% OhGL^_D$ȅtȰ (1SWV\$C r 1H4t${GPhV ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0hg'D$(PEdx t]SYƀH|EdH #HL$|$WVhEd@ D$WPhF9VD$(PAY1VVP" VVP ƍF8Pbuz3WMhVPj SWXG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WPgFWPgF8MdQP|gXMdQPggVD$(PWS蔭1PPD$,P toVD$(P~xF| uF|FXMdQPgVt$|9tVcUVT1PPD$,Pi ƅuC$t$xhg'D$P#1PPV6 ƍC D$~dVaSn8Ua?1PP$ 9tC9t?UWCd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u& G 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4&ƉXEFD$(F 1ɉNON1wL$ˉF ~ uL$( Ʌt ѹ )QPhm%jW ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]hR%fVD$t:t0t!PtQPV PV^WV|$ 1u7jt @1H1N^_USWV $ yr t$ $ q>Ypi@D$ \$fl$Ӌl$ hH%WU迀 % 8thu%h^%4t$@s"j@ {Dž@7= D>1ɨ1QSV PQFRC F CFKN\$l$ c9 ! FY9 ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF oUSWVD$1tW8tQ\$l$G@tjUPe u8u@$1VPPW^_}USWVl$uE@jPV t @PuMT D$} M$ $t 1HE$E M4 M8u}<t/}4t$ WP E$t$ Wu E MT1^ O1#s%UXRQSh%PWE M$tt PQSh2%-tPSh%QSh % Sh%oUjIETs;M$t4} t.@tUhvQjET1ۋ $M$} ET|$uWhatGhUP* FG8~h[%=$E$} 1K؃^_[]h[%VD$ t$t+~ t3N@jPQ u L$1@tNTuFTШ(u1@1^USWV|$\$l$USW USW@ 1ɉ t&tuttNIDP;JDrƉ^_[]WV|$ GT1@ur t3uh@uDu HuLtPt$W(wT9t WG1WVVGT r1NGT^_USWVE1t$t$4$tC1;PSKu"KtHKUJS*ue^_[]USWVM1D$D$$9?CTEu} t!KtOKUJ9} t&CѾ!! u } tK@} uStPSuVCjQ0 ƅtF;Ct SC## ut PV^Se^_[]SD$t1tKt:t4z@u ZAtz@uzDuzHu zLtBPuI볉[USWVD$$L$ut1t$(PƉ( |$,VD$IT$D$*tE@jWP7 tmu11D$ D$4EP1ۋD$ $t*EMHMt`D$0jPWVPuE$E E0EVu4jjt @H hi%M1^USWV0hjƅT$PL$LD$H|$D~Ӄ^TNdžu`P VLPVH@FDV@PQS5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU\ n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUktNj.PUjF t:NXVRPhm%j.Q @jPW t&@PFPNT#h %V1FPFPuNT 0^_[]WVt$ 1WWV t1@WWV8 1^_USWVD$$t8tb\$(勇tK0tEFPUrt.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]SWV|$\$L$ Ƌ@t9Xu9x t)jetXx N HF 1h%J1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP t&XPt$ h%t$,I1Ƀ H1ËD$1t' t!1QT(u QP uSWV|$uuu jPWV t$H:u @PPjPVWtaQPAHT1IH H$ǀjPj791FuhPo%W/K1N^_[11SVt$ ^T؃ FTFPu uhF Phw% F NXQPhL~% u2 tQT s((thPo%PJ^[USWV |$41G$ujjW t ^_[]ËsWt׋trNf(@_>t .o*Shxr'U Shr'U D$ 1L$A AAPj@QW1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU' U V1N\E@M U\$SWRQP<D$D$]@D$ (tE@jPS t=m<$Xj.PSj@ 1T$ JO9zPWEPt.tRD$@D$,$KU5E XUPh%2 4$ f4$ 1SWVt$\$Gt!PtQPW PC1jPW>tt2jP5%W1VPj3^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPU tKT(1tD$ @PCP|$u%CTtC KXQt$(Ph*%CP tt#CT ut SуCT$ CT|$u2CTKTy#KtHKT$JS0t4$ 1H1^_[]SWV\${C KhQPWƋD$dž͋uC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPU?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPu t u"GPt$,hق% GdD$ D$1xG O4SQP2u t $tsOTtYG |n%t$OXQRPh%pWj\u!Q 81tG 8t h%[w$w gTװD$ T$9rхtȱL$D$?9$t`7G$SPwmt t $t8$C O0QPh% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhhQj覾D$ t;t$(h'%j6hXo%V-e^_[]SWVt$Vjj葾tj11G9quƁjmمuިt?5j6x  shXo%V-^_[USWV] D$@Cxt$rj.VL$0Qj*% |$,wVhR%"wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%hu%e^_[]T$rRQPh%ߋL$@T$ru_L$(9ujIu_yjjPXL$ tjt$,VQ@ t8D$ L$rQPhQ%p RQh% \Rh4%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP9 L$  uhjËD$CNC KFCF CCj.L$vQPx Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj! $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh hq%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHTGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h%|$$HL$Xpx jP$Pd D$<t$hR%|$rst$h%$p΁Vt$ h%t$$K$x|$D$ƀt$h0%B1|$t +D$(t$( 4XPjQ Vt$D$`P薕 \$Zt$h9%t$ 谿 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$hʆ%轻|$$t$L$U@AH|$u D$&D$6D$t0t$ t$tC FPj,t.t+@JAH *RWP tF F^_[h.%(^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Shn%誵L$jQE u h%$BHJAWhjj2G Ph>%3WhW iSh%脵Yjt7UhjP{@h%hQ%W)h%Ed^_[]USWV׉΋A1PUSիFVUS迫t!NtHNVJFxUUt$PRt$PtQP PvLV^_[]USWV8|$L_OTȃ GTGPtTk GX$PUhL~%) t#@uUh$%/ S0AC $1E9^t 6u(Fxt1ɋPT8t9tʋхut4$h|%j봋4$VUh%6 WjEu!O 81tE 8t hR%YL$o@G WQSRPUdtDD$GTՃGTD$ j.PUj t'OQPhm%j.V he%)h  WhPj18^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW uFTt|$tF$61^_[]USWV΋yx1t>1COTШu* uG@jPw' OTt OT tY?uŋFuhXo%PkhXo%PUt-u~`?w#F0hF Ph%^_[]jt$bUSWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h R% jSW @ tD$ SVk h%豰p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhш% PUz"D$C,9r|$t"w 7hш% PWD",Nu^_[]WVt$ tqwgVh&j苦1GGG G XGft^_# Vh%he" ^_ËD$@|tHT(tuðUSWVD$1t(x|t!\$l$SUW u?u^_[]USWVD$t81t9\$l$tp|tSUV达 u6u1^_[]1USWV$.FX|$ j.WUj \$wWhو%荮$$tXjVWR ÅFD$Pjt$ L$QƋ ulp|$NjSWB tL$9uPWV t0 D$ PSh%3 ^_[]h%觭jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh'%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Shm%$ WShG%蟬 F PSh% t){4t#D$} t*tu Vh% Vht%蜫jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E%fs'9t Qf9Au<< <\$H $r'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%wD D$ PD$p Vhʋ%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh`%D$`$T$B"pF L$ QPh%X 1Br&$F  $QL$$QPhԌ%"<$tD$x%$l$ |$$ PD$$PVh6%蛦D$w 1L$ T$t$QPR SWVPjh0j֨ 1NtKljjSj hP诐t $jSjj)W蓐t WQ7^_[WV jh0jd ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQWǾD$jPV4 t?jWj$j)V׏t"$jWh@hV赏u%hщ%覥Vj6 hщ%葥1N ^_SWV\$|$1tD$r'1ۃ ʾrft1ۋhDj襍H(H,| t1ۉfǀ<fǀ?WjhP!jjW蹮 t W G Ph߉%WhW輼 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh%P E]1@EEE,E ]$z t(Vhfj jWh %he"|^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$t'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh[%hQ%̡$1ۋ6<$tD$D$$t;F SPh}%֠ D$$hPS6b&Ch[%>Jht}%蠠'3=u1HL$$hQP0 Ã37@$:VL$QRP& \$\$TSj9j@ D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph-}%膟T$E|$wDoS~GDtL$$SQPs _Hbh%̟ߋ$t|1QhQP/T$R6$\$sD1CDCH,ۅt}u2C 8tn9 8tdD$ Phs%he"> FD$ u9H|t;APt"ftftATu y  Љe^_[]1ɉH1BPP@ H~ Wh%dot/Vhj j1Whߒ%he"j vF Ph%p*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPcE <$L$ V蛠txEtptk8] 1ɉHH@H HH$7E^%$P6C"11Ӌ$P**uLBEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t%tPV*ELPu4u<֋U͋dž6ttFtu7@t'P$,dž ^_[]à Vh#%he"L$1jSWV|$WhjltxWhSFWhS/WhSWhSws^_[SWVt${Du ?~ Wh6%P 1@1ɉKCCS(C|S KtHT sHTit xt^_[WhT%he"s ^_[ønL$xtBL$4SWV|$t$_u~GPux{ ur 6ugtXuG@Psmt3O WhjPnjuh%hQ%觙t|t$WPV?^_[D$T$J P(USWV$1@|$D{l$Hw& C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1W{C,$;lrD$Vh%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P: D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hOWt$$t$$t$PD$\0 t0L$ D$ PQhOVt$$t$$t$PD$\0 D$ L$)1Hΐ t$T1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s e 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP茅G4 w$r'ҏ   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPX D$Ãx3 t 11A9r1Ë71$1 $s'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHTu= r x t1:t,@Ptftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph,%衑1l$S qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N L(H L(H L(H L(|$ t*G>r!D& D$H<D$@> VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh{x% D$P4 uOt$ pffBfBpɋ<$tXQlR|d ڃ p7t$ffBfB<$tD$WVPR:d ڃ L$t3D$fffBt$tVWRωd ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPc |$ ߃L$I|.,$YT ry t$>APtftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHPctKWUPX D=l$_D$ fǀ<~ 1fw s')h7%虄R|$Qh#%j W謠 D$l$ f9<t1}~ QWhK%PMt$sf<~ fu.Wh`%肃L(Ex L(EtL(EpL(El6tj){D$0^_[]USWV΃|$$w Vh%ƒ1H׋k} 1ۉt$$S1ItUF} $]h]d]`\$,Džu\$Sj}ƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%蚁k(UPh%. ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%<},WVhՏ%Ё ^_[]V΋QhjNx1ɉHH@@ @ @$.t d^D Vh%he"2 ^WV΋Ƈ?tr1BhXwLppGDOHGLOP1ɉODOHthZ%V|P6BVjjhw-wx9Dth'%V u Vh0%D^_É1jVUSWVX։ϋtu'C|t@Tu1ɀ@ƃ@L$ tG uVPh%Q}1'%8Wjj^vD$$Pjz|$w$Ts'8uJː%=ǃ8%%8u+>%8uE%8u Ґ%8{`G D${|tat$ްGTu3N`W u u1!1t9wGXPt$hڐ%~ ؋?ut$u {`|$ui s`t$h%~ 1CdC`|$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$hr%v:fD$D$D$PjUVD$0T$4)̓w!p t$h%vfjPD$DPYJ D$LȉD$LD$PȋL$LD$P9v)Ep t$Pt$Pt$hގ%Lvl$4D$h|tjD$@PU upmjhD$DPt$ǀfD$ $BE0JM,E(EL$E(ETuET$%ETBE<JM8E4L$LM$E T$P9t MTU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUV(K|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%t|n t$h%%t|$ɋD$,u ȃd^_[]USWV|$_T؃ GTGPtG OXQPhL~%t wE tu{E|1ۅt5HT(tgGPt ftftGTu tǍF Ph%@st}u^_[]8VN6*^_[]SWV΋y Wh%+s 1CCCC CC$t ^_[:WhB%he"+s ^_[Vt$F PhU%-s1B^L$ Vt$?N Qh%Pp 1B^L$dWVt'׉΃|jt$RPt j6q^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV趇t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhj>h1CC C XCC~ ;u WhZ%0q Wh%pt^_[Wh%he" q ^_[ËL$Vt$VhjgF Ph%p1B^Vt$?N Qh2%Pn 1B^ZL$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPhh%h R%p tjS0 tD$ WSV hh%o`^_[]ËL$Vt$?N Qh%Pom Vhjf1^L$.L$@h%P1|$L$8jQj*j)5h<Ku ho%<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5h<Ky h%Q <t+DŽ$j$Pj&j)5h<JuK1ۃ|$$p3D$,tD$t3S?<uhݖ%h–%ƣ::|$$tF1FFFFF  F)F.N,::9rF t$ƃ|$t.t$EL$Aut$h%+p3D$,|$,tF)F/p3F  <@;DŽ$jjjJ y h%<T< <X<$<\<(<`<,<f<'ud<0<|$tjt$ j.j)V>I=p3ujh<V yPh%UPhp3Pj)VHuY=p3tjhp3j j)VHth_%$Ph<Vs yh%h %h=%VXD$ t3 | h%$jPhh5h<9Ht$8jVj$j)5h<Hy h%YjVj%j)5h<Gy h%3<H H r8r t30 s~|9~ h%؋t$jVhh5h<YGy hƗ%jVhh5h<0Ghܗ%d8t3PQh-%z <Ѓ1۹3<PSSQVRh<}H3<t"QhH%Az <ЃPSSPVPhL<7Ht"Vt$0tWNuVjeS VjZS 1<<L$?V1Fh'3Vhh%) Vp USWVX <<t91ɉ : :1GH < <<f < r+rm ]1sq : :Y : :T<:X<:\< :`<$:  : : t1: |<x<: :f:t3Uf: p<ff :f:=l<u"t$@jV ȣ:Fȣ:t3:L<:1L$@A A:Y ::Ph:5h<M ƅx9t&y h%rVS5H<hY%w <uWh3Wa <<<<<<<< u2ء<<<<<< P؉+<5<D$8t$P$l t$ wg$Xu'h%L D$$f <L$A <ȉπ1@<<D$<ɀ?$u'F}|$ $u'h%<<<<x3vx3<D$v<ȉL$|$fD$1@L$|$(<L$ωs< <L$L$ |$(<L$ǡ<=L$|$(ݜ$Ѓ3<P1PPhWjRV9t"t$|W|$Wh%k t$hљ%k <1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃ3<PWWhVj$XP8t"Vhڙ%Sj t$|$\$,=l<u ݄$\$$%!j D$D$(t h% j D$|1|$ ;|$Dw|$D|$x :8j@9uD$ g Ȉ<|$<t$Ѓ3<P1PPhVjR7t"VWh>P$ii t$Ffff9fDfPh(% 1@Ph3P:Ph,P$h*% h5% hD% hT%w hz%m hb%c hw%Y h%O h%誝j.$Wt$|juj.h"W Wh%ph j.Wt$,jߨuj.h"W Wh%"hĜ%3h hH#&h Nfy%fw u'Ph  <GNju j.$Pt$ j6]h%<hL%g hH#g Nfy%fw u'Pdg  <F hB%Ffff=fhk%fPh;%FffQPhN%f sFPhS%f L$$T$ /Ftc|$ umh%h%f Fz$u'h%t$Ɖt$ t$QRPh%Lf hxO$:Phl%`4u'h"f  <F<<y%hؚ%e  <tF%s%Pe K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( .3D$0LA $s3%PQd F9uEPh%c h% hÛ%h؛%c |$ FPh %c 6Ph,%c |$ "hܠ%h% hL$hM$芘L$$ 'j.$Pt$ j٣F$Q4u'h%Th%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"PM $@D$@|$ PhO1#hc5%b t$ 9|$oh8%h+%lb D$$$T$ $@WjWh R$R=&P#b Ft h%b d'3H d'3~\'3H \'3 h\'3j g )L$|$$t1 q΃j.PL$Qjuj.h"$P $Ph4%Sa |$u"tVh#%9a  h%*a d'3H d'3~\'3H \'3 h\'3j f t$GNjL$+{h%Εihm$`  <t$Nhot$` Ntuy%R=&P}` 1L$1΄u j,|_ D$H%x%%sVQ/` D$9D$t$uKj,7_ h% ` D$4L$:D$tHj,_ D$4WPh%_ $D$4D$ uj,^ h%_ d'3H d'3;t'3h\'3j)ye n\'3H \'3)h8%hm$`_ <؋ d'3Qd'3~ \'3Q\'3 h\'3j e <z|$h ot$dc~)/F1#ty1hJ%n2td3hj%^ ^ F N t$~WRQPh%^ \$Sƅx*Vh%e^ 'hZ%V^ N h#%<^ D$@Ph6%&^ ~`1St$t:j.$WPjzuj.h"W6 WShN%] Sh?%] C9u\$,t$ |$d|$h19wƉ΅h\'3C (M<T$p1Ʌu9QT V&jV6 3 VPjrT 5H<ho%] 5<h%\ 5<h%\ <tPh%\ <tI <9~h L$\ 0D$D$L$d$ 4Y& \$$CL$\ d'3H d'3~\'3H \'3 h\'3j 8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"57<t$PV;hD$$HL$L$ 1x1PPPW& jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$+ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$'_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$7<D$PVPH L$@D$D$ 1 G|$<$D$=3$TD$j=h &|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h &S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=h &P Ņt$,], 04$Q", 0D$$u'߈FHGNm&Þw$v':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4f& "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H % dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=8<u t11jNt8<18<8<t P[1@h^"h;%K 8<1USWV1=8<MT$ l$(L$DžD$58<hh8<X  |$t$"j h8< D$8<h"VQ8<tUP uTWVfQ8<WVWQt7j L$QPQ x#L$9u 8<;D$ D$uL$us 8<8 8<APQ~ PQ  8< tuQhh8<W  |$u8<1^_[]8<<<<<1Ҋ+~,u"1t$L$t' t" t΅tAL$=8?<u8?< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=8<u#8<8<tP7 8<t 8<1^8<8<tP 8<VtJT$1Aj<ƃ=8<u#8<8<tP 8<t 8<1^t 8<t D$8<1@1USWV D$,L$(l$$~ )$1H$`t 8<1A\$9|ωL$ tgp9tX tt$ P t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$8<8<tP 8<D$,L$$ ^_[]f11f11Ã=DžtA=zC<t ^_Épxj Ph E" ؀=xC<u1F1=yC<t| 1맋53 O1#QQhY%Pփ USWV1ۀ=C<t ؁^_[]) D$ |$GSSPh|C<jW u |C< C< C<r1HC<O1#1ۃt2u3hWhO%K D5C<~ȍQ2w$$v'C<PAu C<?$D$-3 h"L$Qho%PՃC<3@C<3 C<I9@3 C<I9@zC<xC<yC<C<C<yC<pC<g3 C<A9~WH3OC<F3|t%ƍC!t2)É$)t*D<L$ D<$)PD$p xPhC<=C<=C<WjD$hpj Ph E" 53& O1#QQh%53  O1#QQh%Pփ 111{PZDWhVy ESWV 1L$ |$ ru\95C<s(>tGǀ=C<u.;=C<rN;=C<rDC< DžtVjW =yC<t^ 1ހ=zC<t& ^_[À=xC<u1Ffu]pxj Ph E"襧 뺋53 O1#QQh%Pփ NUSWV|$4t$0Ë C<9s&C<9 8Ս1ʅ/C<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95C<95C<H_ŋ C<!9r؅ C<9s9s_C< 8!9t.M9wI9rEC<8! 3!9u!=C<=C<C<Rf ʼn9rPVU  8!!ōD$p C<PVL$ED$PVt$8SC<Pt$jUVthŋ$L$Ai QhC<X=C<=C<u=yC<u 1=zC<tM^_[]t$hC<O=xC<1GDu3t몍D$0xhj Ph E"n 53r O1#QQh!%Pփ[ 9U7)SjZP)MPjS :9/ $)QjZP)PjS tƉ111USWVˡC<!9ta)‹ C<h t u9=,$)<l u=C<OE$)ÍFu\wlw'xD$X C<PW PW!=C<N VD<5D<w(w' ww'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=C<tGV^_[]ÃWUT VjZS vjZv  VjZS V t$=zC<tt ^É01ɉHHj Ph E"衡 ҋL$SWVȋC<!9t+)֋ C<| u 9t%)D @A QhC<%@D^_[USWV=C<t^_[]þO1#VVVh%3Vh""hj"hƢ%3##=C<u#%=C<u7 &?"=C<uPK&RQPhҢ%3K%=zC<u%G"=xC<u"%=yC<u, $%=C<u$VRQP33$ |C<|$gfff̉ҍ4މ劄14#GO wһO1#""SUWh%T$t$|$f4SUWh%33$ C<Ggfff̉ҍ<߉劄94#FN whO1#h""Vh%T$3$ C<|$gfff̉ҍ4މ劄14#GO whO1#h""Wh%T$3$ C<|$gfff̉ҍ4މ劄14#GO wҸO1#PPWh'%T$3$ 3|$gfff̉ҍ4މ劄14#GO wҾO1#Vh#Wh4%T$VVVh9%3USWV΃=C<tPt C<3!1PEǡC< C<!)ȉ9r1UEC<9tEuótP-C<!1PPjhjUP蹆 t(D<t D<=D<= D<-D<1ۉ^_[]V΃? D< ; D<v$1u D<Ɖ D<^USWVPC<C<C< 0trƃhw'PF,=C<=C<4$t|n011FEEhw'PwـEECC<(9r:53 O1#QQhw%Pփ=C<C<11C<9s[ $,0EEhw'Ps+C<CC<]ǡC<C<(9rC<9$sj,Ѓ0EEhw'PC< C<s C<)ÉE;ǡC<C<C<(9r$^_[] L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡC<D$C<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9C<s$5C<!։Ņ9C<v6J Љ  ȉ  F1r{@p9C<sBJ Љ  ȉ  FC<C< 3u%1I#5C<!֡C< 3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=C<t=C<uVj1^_[]VhU USWV5C<1!-D<t ED<1- D<E@;D<v@uW- D<E@ D<tE3t,ÉE uUhC<=C<t"=C<t!D<E-D<^_[]VhVjS, USWVΊ C<T$ T$FD$t$V$D$9Btr$u$…C<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VSSD$x,t @,KZ C<tjNjD$G GC< C<)ʉWOT1Nt TtWt$K-C<T$ C<^_[]1USWVȋ5C<!) C<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡC<94$1PPhC<8 Åk jSC<W SW.D<D<;-C<r ;-C<1WWjhj\$SU} t\tV9tRSP{| uE^ j@\$S0 -3 h""ShX%PՃ=C<1lj1C<4$9v(C< 1QQjPjVQt| @wg1=C<j:ŋ5C<!Ɖ)tP:C<9tut݉<$/C<u1]4$D$x PhC< tA<$C<C 9r09$v+jSV SVD<D<uɉD^_[] V|C< C<r!1F<u. C<|C<F9r^USWVP $1N=C<1!׉) C<D$)ot +t=C<;C<v|u+HL)͉ll+;C<s| ullD +lD;G,$vuWVDGWV;_s_u.G WPk=C<u.M,t C<-},^_[]jPRٶ 5C<^_[]USWV@׉9 C<95C<j8;C<u >9uP8;C<FjWVb *1ۡD<t  D<8 D<H@; D<v@j D<H@ D< 3H C<HPhC<C<9rWVx u= j@S0N -30 h""ShX%PՃ=C<9=C<u]D<t  D<6 D<H@; D<v@u, D<H@ D<t=C<p xPhC<@^_[]9C<u)C<C< f3ø3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á,,3kD$t$P -WVL$T$ ‹q~y ;q~ t 1~9 QP ^_D$ .3DAD$ .3DAD$ .3DA%D$ .3DAD$ .3DAD$ .3DAD$ .3DAD$ .3DA%D$ .3DA D$ .3DA@D$ .3DA%D$ .3DA%D$ .3DA@WV1F|$ 4x'W tF u1^_ËD$t w$x'1ËL$1t9t1ҍB|uËL$1t# t|$t.3LH1H rËD$t .3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ |.3DAD$ x.3DAWVD$ O1#O1#tƀ>t4% 0PWVh;A&h'3 ^_Ð1|$w L$t9tø3f|$3#tO1#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$ѣ%9 (vt.3fL$%9 X(v!3føÃD$L$L$ L$D$Vt$ t$Vh'3D h/R"Vt" 0kPh R$h'3 '3Vj )V ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP% t 0 1$^ÐWV|$ W4T' tFu1 ^_D$ftL$Q'1USWV$п$$ u Vp  X)jL) ŁTUUrP$@@D$0jPD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#b/4$({111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$D<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFFD<D<C><% ^q{t|~F~F ;^r~uFD<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFD<F^9րրw t$rI{i9s <$=.3]D_\,<$t~uF FD<D<Au~uF D<F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A.3IDJt"m9~~uF D<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF D<F"{u@9s .3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup .3DAu f'tf`uW~F=@9t8}@u~uF ~uF D<FЉL<$USWV t$ ^h.\u/;nr~uFFD<D<EMŁ'$~]$̅'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFD<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFD<FωωD$$xt~uF D<.n~EFx .3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2.3 DJt"r 9~~uF D<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF D<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFD<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj|.3TXL$21@u"x.3TXL$1t$1ɅtT$T$1=,,3E9Efl$0|$L$=щE pX D$ t8(;|$w,7"1T$39u!E HD$8uD<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 .3LAtx x.3u|.3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQy F^_[USWV1y19sC11-.3D]t#=k)CB9u1Bt=|yuA D<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$(')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FD<FUSWV\$1=,,39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}|.3Dh ,,31҃9v1B ,,3x.3Dh1҃9v)1BuG D<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFD<D<D<^_Ã~uFD<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFD<F1^_[]É؉D$ %\'t$t$UH| u U苇 t/uՃt~uFG롋$USWV 1=,,39v413A8 $A,tI |.3L$ x.3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQϦ o^_[]SWV1G9Qs7ӉjRq tF^~uF D<F1^_[USWVP1N׉$1+t{`tswsK$t'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=,,3|$ r3GtD$WT$ou]t$St |$Qo ]GtD$wt$wt$wS1 |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4襔 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$  ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf .3>|$u l$`\$\z .3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" .3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA .3D$¿!DQf_֋D$ !DAf|$$_8tV|$u.3L$ DHuf|$$_u3|$u.3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4o L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf .3>|$u l$`\$\z .3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" .3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA .3D$¿!DQf_֋D$ !DAf|$$_8tV|$u.3L$ DHuf|$$_u3|$u.3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V5< @wj/VT 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPh E<蘤 E<ø}%Vt$1Ʌ1t э^fffffUSWV$[D$1dD$V׃1diՉƃut" $4,rƃu$UVjjy |$09NjL$4sD$D$8T$<UVt$Dt$D; L$D|$ t$ 1Ҹ$|$(RPQt$  |$@tjjdUVD$ ƉRPUt$  D$ T$D$L$ |$֋$)&URt$T$2WQPt$HD$HP$RPQt$8W^_[]SWV[Æ$$u^Jw $OhPV7 u=uk+ W&hPV`7 OhPQI7 t&hPQ,7 OhPQ7 e&hPQ6 hPQ6 5&hPQ6 PhPQ6 &hPQ~6 ,hPQg6 &hPQC6 PhPQ,6 t.&hPQ 6 &hPQ5 Pz* Ą^_[USWV[D$$L$ ttD$D$&D$UP薨lǾUD$PuDžID$8t۱|$;D$ T$$75PPWnk E&PWVk  PPW>k &PW&k t&PWk |$D$ tHOPWj &PWj OPWj i&PWj t&PW}j |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [E$ @$ $ ,19r 胼$ t+$ $$ FhPW/ $D$ D$jD$$ xfD$4D$dzu /$$ AfAfIQPRhW芗]t$ VPj $D$ $Pa1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VhPW. j:WF D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPet Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃKD$ $t1L$ L9s ዄ$ @<C8L$|I't$tjhQPR*D$4 ]qPh$P薔$$9s|$$$9s$$[1 $L9s D$HL$H P 'RQt$ Ph$P藓$$9sD$4]qPh$P-${$_9sD$hI$/9s狄$ @]PQh$P袒$$9s獃k4t$Ph$PJ$$ o9sD$ tW]QPh$P$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ `$$$9sD$dL$HL$P'L$pRt$t$t$$h$P脐D$L$HL$HL$HL$,HL$(HL$$H @ 'T$0PQt$,t$4t$ m 9u8jj$^ t P聪 1 4~e 0ǃ $Wǃ$ƃ tJe 01^_[ÐUSWV[$01 uut!j/V7 uS tƅujc ƍ|$ )VPQhW =rd ?h@VǍD$ jPWC id D$$WJtLD, L$Pjhjjj QD$(PNG Ƌ<$t'Vu D$8 td 8 d L$^_[]ÐSWV[~ u܂Pv6ƃ $tj/V5 uAb Ɖ獃 )VPQhW贅=rSc ?$t" VP"U tEF$u7hh%@V $ hVP  jj$ \ t=jjj$K !ƒt" P$9 1ub 0vb 0^_[^b 8#uVt׉?b ƐS[}>[ÐS[|t$[ÐUSWV[|u }a D$<$a t$u$$D$P:ut=k<T$JL$|D$x$L$x$PQ2A$$$Pt$@lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$81DPu@4 $((9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$(_ D$@j PWe _ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $W \$ 8u$$>$0։V D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ5|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR~ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6PnW8G4jjdv6=6 jjdRP+nWPGLjh'v66 W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJAt!G t7t9uӾ^_[]ÐUSWV[kOGt@#l$#t$P@t!G t7t9uӾ^_[]ÐUSWV[NGt@#l$#t$P^@t!G t7t9uӾ^_[]ÐUSWV[ÈNt$0t$,Ǎ&VP‰t$D$(%D$1틃<$D$l$ @tn|$$RP?tG tD/t;L$uЃt+D$ t$jb…<$D$uNt$0t><$9tR PUW >&t1<$W(^_[]fffffffUSWV[;Mt$D$hEt'1PV>t'D=u狋19u"VPjD$@ 8^_[]ÐUSWV[øL|$ D$hEt$1PW!>t'D5u狋9^_[]ËD$@ ,0tMU1 D$jPU $D$18tX&1 $r!"u%%9u4C"tt$:]4UWPjу$E"WPjISV[ÍKt$ v&v &V&^[ÐUSWV[HKD$,8tD$,1퐐8@uj0JƋ|$(WGF$$jUF D$ D$,F>&D$Pt$O1}nu1ɀ}ouL$D$j=U tǃ|$D$,t1PU;tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8!8t 4$j$Va$1^_[]Í"UPjNfffffffUSWV[ÅI$4$,w. 04jPU uj:Ug 4jPU tKt$}/3t$UhV( jVPU" Pt$UD$P|<|$ "jjWjjVP mt$ jjWPjV t$/PD$PVǍ'JD$t$jDžjt$W uj$4$4jWtƍD$Phzd@V VD$(Pt$ u5P$0>r$0VPW} FD$ GL$ "jjQPjR tqVUW R8, 09$0X", 04k, 8uj/UfŃt$ $0UW + 04QPW 111+ 09$0P$4 11,$j$4V$4WjU0PNPWKt$t8HPQ&E&,+ 04$0P$4 1,$D$P U * 0^_[]Í5,$UPVWM1* (xWP$8$8LVfffffffS[kED$D$ $L$T$jjPQjR yD$[fffffS[ ED$D$ >$L$T$jjPQjR yD$[ÐS[ëDD$D$ ?$L$T$jjPQjR1 yD$[ÐS[KD$L$%5jjPQRQyD$[fffffYCT$u,ÐS[Ct$CSWV[ìC|$Wt$t$ 9r( ?75WVPj^_[ÐSWV[\C|$Wt$t$ 9rA( ?i5WVPj^_[ÐSV[ Ct$ Iƅu5Pj^[ÐSV[Bt$t$uƅu5Pj^[ÐSWV[ÌB|$W ƅtu5WPj ^_[ÐUSWV[KBl$|$UWƅttu5UWPj^_[]ÐSWV[A|$Wt$ƅtu5WPj ^_[ÐUSWV[ëAl$|$UWt$ t& 06UWPj^_[]ÐSWV[\A|$t$WLƅu46WPj ^_[ÐSVP[AD$L$T$$RQP ~ ƃuE6Pj^[ÐSV[@t$t$t$} ƃuE6Pj^[USWVP[Ê@Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1Z% (Z6t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[ @Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1$ (6t$,t$,t$,t$,t$,t$,Pj ^_[]fX?L$"wÍ[ffffffUSWVDXX?D$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjjE~D$$<$|$ D$81$|$ <,PL$4"GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjj= $~D$$|$ $1\$4WRD$$Pjj= $ˋ\$4VRD$$Pjj=1Ʌl$<릋\$4WRD$$Pjjo=~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$Pjj8;D$$u|$0L$$tB;L$s5T$ >#\$4 L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[^2jt$t$t$t$t$[fS[.2L$T$ Pt$t$t$[ÐUSWV[1|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuU| 8uF1t$ t$Pt$t$@t$'t$ t$ 0 [ÐUSWVX['t$lD$0Pt$t諑l$tFN $)9ŋF|$t$0 |$uƋD$ L$|$l~24$l$RPVWlj`|$|l$uPt$W/ Wz1X^_[]øSV[-&0t$t$V\/ tt$t$V ^[ÐSV[%t$ t$t$V/ tt$t$V ^[ÐUSWV0[È%L$Dl$Lt$HAQ$)9ŋA|$ |$uƋD$ L$|$D~34$l$RPVWlj/_|$Tl$uPt$W-. Wx10^_[]øS[þ$t$ t$ 0n [ÐSV[Í$0t$t$V- tt$t$V& ^[ÐSV[=$t$ t$t$Vp- tt$t$V ^[ÐUSWV4[#l$Lt$HAQ$)9ʼnʋA|$ |$uƋD$ L$ ׍L$ ~=4$|$l$QPVWlj]|$l$uPt$W}, Wv14^_[]øS[#t$t$t$t$0[ÐUSWV0["|$Dt$Lt$LW , l$Tt$PGO $)9ŋG|$ |$uƋD$ L$|$D~94$l$RPVWlj_\|$Tl$uPt$W]+ Wu10^_[]SWV[!D$taH8|$tFH8<1@:u8t@Qj<< H8 H81^_[þD$t@:$ðfffffffSV[M!8t Pt㋋QXQP)& |t.PT$<06躹^[Í(7Pj fffS[î D$ ~ L$u [ËPQ2  [ÐS[n D$~ L$ u [PQt$ [ÐS[. jt$ 0 [ÐS[jt$t$t [ÐSV[0t$t$V( tD$~ L$u  PQV ^[ÐSV[mt$ t$t$V( tD$~ L$u  PQV ^[ÐSV[ 0t$t$V<( tjt$Vh ^[ÐSV[ýt$ t$t$V' tjt$V ^[ÐUSWV [ht$4@|$D$ L$jjjjQQPPt$($[ÐS[t$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[$\$Xt$QPX%$ % $$`t$PR&$  $t$PRԁ&$  $$dt$PR萁&$  $$l$htD$xPRH |$x  T$xtD$PPR |$P  T$P$t$ptD$(PRЀ |$(  T$(tPR蜀  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[e$U$tvu $ 󥋬$$tvu $X tu[t$ $ 󥋬$$tvu $0 tut$ $ 󥋴$tvu $ 󥋬$$tvhu $ tu<t |$h |$h 󥋔$$E@mHt ։t |$$$$Xt t |$0$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XgD$D$L$$$\$`l$(D$@D$ D$ D$HT$8B$L$D$4Qx$h,1T$L$,؋ $LIfDL$9$D@4dL$$LD t;hPu$h,$D@D T$v$D@L$fH|$p1j $LII HLIA 9t$ u‹T$$D@ʍ f|$yS4OD0 0L0Rw|y G, $@fD0f|0$vxt$(Sx‹O,$L$@t$)֍ L~;|$ _L$LJ<LJ^LJvLJ#LJ:LJ'LJ#LJ#LJ#LJ-LJ-LJ_LJ|LJoLJ-LJ-LJ<LJ>LJ*LJ!LJf2Htc$t7tjtgx,܋$t`vQjPR 1 LpLLtLLxL L|=u׃^_[]ÐVZ1L$tp4ttttxtt|t =u^ÐUSWV [øj+%7D7D7(ujjQP_ u[Pjj3QP|$ej>j<j^jvv8j#fj:V0j'Fj#6 j#&Hj#pj-j-`j_j|jojpjrjyjzj{v@j|fhj}VLJ!ǀ+LJ!ǀ,LJ!ǀ-LJ8!ǀ.LJ%ǀ0LJ%ǀ`LJ0%ǀaLJǀfLJ ǀgLJH%ǀhLJp&ǀiLJ%ǀjLJ%ǀkLJ %ǀlLJ%ǀmLJ8<%ǀnLJ%ǀqLJ`#ǀoLJ#ǀsLJ(%ǀtLJP$%ǀuLJx4%ǀvLJ,%ǀwLJ%ǀxLJǀ~LJ#ǀpLJ#ǀrLJd"ǀyLJe"ǀzLJ@ǀ{LJh`"ǀ|LJǀ}D$ $2Nt_t5l$ t!zx|LՋt`T$ rQjPV$p1L$$l$<4( L$ |(t( L$LPu ^_[]ÐUSWVPXJpL$ $1틘<+ $4)+(T)( ljPuЃ^_[]ffffXL$fǀ ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[Ît$0[ÐUSWV@[X|$T|ED$G8$u!O9OuO9Ou @9u_uWEt W|$XE3t:<10[Eǀ3A@^_[]Ë3tUQ33DL$X@9tÉD$ D$D$ l$jjv@PUWUV'뒋@D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$WN$|$T3T/1j ‰PD$<x-.D$8|$AG $tJt PwWG W"G @t; 8u1E3t%<10UEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$uo*E2$t L$Xu$ L$Xt$AsiSV[0t$t$V, tt$Vj^[ÐSV[ít$ t$t$V tt$V^[ÐUSWVL$[d|$0|D$(T$ 2D$ED$4D$D$ f#tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ ff:f)|$ t)`Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4 ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ D$4Pjjj 4449)4L$ 4QWPt$u4;4}2Dž4t(D$4PVt$ t$, 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)`Q)R[* t$VeF @f|$tW&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f lf1jD$` `4rփփ19‰4 4f lfAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f lf107Pjj!Qi jOS[.t$z[ffS[|0t$ [ÐUSWV$[|$un2t PP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(R7PtjjPm ,GT[7PtjjPm GX!2@@xGX GXO <W$< OT` @2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PD$$<$$u$P蓗 HuǐuU~ PiD$$鐐<$$u$}P# Huǐul$Ut$VZVtUk$|$D$H$< H HT` HX@ Hl 2T p2 t2 x2 |2, 2G[ÐX| tT$QX@1øSWV[l1t$t&D~fx닎f8upσ>~"14觵;>|蒵V艵^_[ÐUSWV[lfhǤs$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$#j T<TV$2@#4tV x =wlj<$hVt$ Vx Vw 1rNj2Z1퐐T,jj L,LNp9u^_[]Í7P7j!S[0[ÐUSWV [|$ |EG8$u%O9OuO9Ou@9$uxW_/t Wr`@8tUEHAIL$WW9uOO 9L$u-O OQRt$ PHGGMIAG GAE3t4<10xEǀ3 ^_[]Ë3t*Q33t@8tVW~‹@D$89L$u G8W<ut#u%'t^1Ƀuk1g RG4$&=u8 $A @11 $<x-D$8 $tQWtL$|$u $E t΃2t2u΅rhƋ $a U2 8uE3 $tԋ<10vL$Eǀ3뤐SV[0t$t$V t V^[ÐSV[Ít$ t$t$V t Vr^[ÐSWVP[K$|t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[+T$|9D$P=r 1rƋ2~F1퐐D$(jjmL$ )LOx9ul$T5t$j+T5TW 21^_[]ÐUSWVP$[E1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[ø|D$ 0>ƈ2L$ȉT$ D$lD$`D$D$t$#%fG 9 D$f$t|$u!|$t'QL$)RWŃuRG @tG 8u=D$ 3t.<10IrD$ ǀ3G @|$tmG  f Hȃ L$ fftVW=Vt Hȃ 9 Hȃ f9uL$ff АT$ftiLjfx_ɋ4f>t%fG t~t- 19Ɖ ɋD$fD$DhhA Qʃʃ19 ɋD$f^_[]ýG @tBr 8u8t$ 3t)<10oǀ3g 룸7Pjj Q# j SWV[|$WƃuOG @tDͳ 8u:|3t)<102oǀ3^_[ÐUSWV[k|tt$339}3AP3)t' 333343;33PQRPaY 33t331^_[]ÐUSWV[Û|tt$339}3AP3Yt' 333343;33PQRPX 33t331^_[]ÐSP[$|tT$ 2Pjj $[ÐX| tT$QT`1øUSWV[FTAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhdto DHDHDHDH uǀD$ FF^_[]ø7Pjj7,k7PjjQȂ j7P讻jffffS[~0[ÐUSWV[X|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ|uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[0t$t$V t VN^[ÐSV[Ýt$ t$t$V t V^[ffSWV([Y0Wt$<2WV0^_[ÐSWV([t$8Wt$@2WVd0^_[ÐSWV([0t$11;3}:tt3PpT^_[]ÐS[^T$|t$t$ [ÐUSWV[(93|$0t$,T$ $u[8MDH@utl$4D$ U> 鐐t$ D$PL$ QD$ P蜍x)t$tL$9D$)<9u AT$)RU3t( $4T$4R7D$0D71^_[]ÐS[|t3t P[ø[ÐUSWV[è|8D$ $4VjPj趍tSʼnt$UyiƅtMD$ $t$UD$PVztT$t$$V Vy^_[]ÐUSWV[|$3t P 3~/11퐐440Gy0;3|4+y 3ǃ wwLJ3j0j&r4tW2Ht<@xX3~3,ZP<72@HX3@$4Ƈ31^_[]ÐUSWV[˝t$3t P3~/11퐐448'x0;3|4 x^_[]ÐUSWVXHt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W8 1Ґ$t$V|$(WD$0P荇t$$ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V{ $4D$)Džu |$ $tR1VT$ X 4$)tWj Vz T$L$ (^_[]ÐUSWV`[H14t `΋43t42NzRЃPWVPVXhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W6 PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P^D$T$3;4}D$PRjQD$PRjQxNj$D(PD$$L$ ;47&ffffUSWV[K|$$D$hjjUЇ t)ƃ|$t:L$tVD$ tNt*T$19tL$  11fVUl$ U芇 D^_[]USWV[Û|$$2t$踆Ƌl$r:D$0D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E9tL$ ft M}Wt$UST 1^_[]ÐWVY=D$T$ t$w4  p@^_fffSWV[ܔt$VO~~tyы9uv0Cov,8o|9p9p 9pt PtnVn1^_[v4n9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29P6nffffVX~t-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[þ|$uT$ L$O[ø[ÐS[Î|$ uT$[ø[ÐS[^|$uT$ L$[ø[ÐSWV[,|$u<t$D$9% ƉM1^_[øSWV[̑|$u8t$D$|$% Ɖ81^_[øVXn|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$u9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZž_L$1~t$ ~|9J$u9r ^ÐUSWV[[_D$|ǁ31~Kl$~C9A$u9i t9UP;Ƌ9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[[T$L$ Aq D$t$jVPt$ ^[ÐUSWVXZ$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$|t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[XT$L$ Aq D$t$jVPt$ ^[ÐUSWV[ûXl$1t>|19)Rju uuu0tPU^_[]ÐUSWV$[XXt$D1Sl$HGL$QL$T$ jt$t$t$8[ÐUSWV[t$L$F +A QF(~~Xn01N,,NT$+JR, AEQUM vPw;E;~}F(^_[]ÐUSWVD$XX2h P8ցp8x;{ umueP8x[$u9uxu p8x9u6q ~t-Iu!ut duP8^_[]ÐD$t @:$1ffffffUSWV[ûOD$L$Qq +P+p yijUWjjVRQP$^_[]fffUSWVH[hO|$\|$`L$lT$ht$d!1D$xt$t$p)xՉ!)D$xL$T$x!$x4$)t$`v9l$ ,$)׋t$\v9| T$ 9|$|P!)l$tD$`H9͉L$)D$\@9Ɖ|9~jt$dѦ1H^_[]Ë $ًD$ D$D$D$l$!|$Fl$9tD$\@,|$x|$D$L$D$ 9w,$t$)D$ Pt$d"t$;|$ w|$|t8DH@uUVt$hV D$(GD$ D$$G tqt$$T(@xL$$ rjfffffS[M0[ÐSWV[Lt$t}|19pHt.1F:tVtFxvvv vP}u-F9u"< Q+Vy1҉VI+N y1ɉNA^_[øS[^LL$1qqq qj [ÐUSWV\X&LIX1ۃyL$4D$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV YD|$4t}\$\$$Pjt$,YT\$ D$L$ H HD$4;Hϋ@,L$4pH FD fFVP }![D T fNT 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8QpQjP-ɋ$KdPjQQ f~$~gD$@u]D$(t$Fh2u&9u%$PD$805;\$6>v t6>vuD$@tt$ t$tNF$j=D$@$ $jP Ktdt$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ \$ uL$L$ T$9Q|$ $UjPa>\$ |$0t$t$$@$UjL/>\$ uT8M88PQhrR $ USWV ["D$41\$t$LL$H\$DT$@|$8 ,!H@!t0t ILtPjQ8 `@9t#NQP!P@#Vt;tH(t&tQjP7 H@t;tH8t&tQjPS7 H@t@TDt'tQjP 7 H@ t,@tQjP6 H@ t,@tQjP6 H@@t,@ tQjPp6 H@@fy,@tQjP?6 H@t,@tQjP 6 H@t)@4tQjP5 H@t)@tQjP5 H@ t)@tQjP~5 H@ @t)@tQjPP5 H@@t)@tQjP"5 H@t)@@tQjP4 H@t3Ht$LtQjP4 H@^_[]ffffS[î0[ÐUSWV [ÈT$  <9t #BH$$BrD1B|$9J~B,|$xD$G97u(ftO!; $u tN7fGG! $GWr|)tfG;|$r[fy벸jRpjjV! 1 ^_[]fffSVD$L$ ;u@Q;Pu8Pf3Qu+I P ÅǸ tttu t1^[Ått;uIRDžu ѐS[þD$ L$QPQfPQfPPq [ÐUSWV[{|$t$O tR1ȋHvDžtYujUtpG@v1ɉDžu1X1tRiQuG .1t(@yQlu^_[]SV[íD$ tpP,u^[ÐUSWVP[jD$H~D$@1L$I$9}Z~L$I,$ i19}ƋM tyQuD$@Ń^_[]ffffffUSWVD$T$t/L$u+1t 1%t 1^_[]ÉӃ1 9t<1lj1D1ǁt%1ƐUSWVL$2T$119:lj1zlj1zlj1zlj1zlj1zlj1zlj1B؉ǁt %1z 5É1_É1_É1GÁt%11^_[]fffSV[D$ L$T$t$ 1c1^[ÐSWV[ÌL$ D$T$t$|$ 1^_[ÐUSWV $[5 79| 9|$} <ANj ʼn ș t@ 8D$j ~RD$8t/@@tUjPP- j @@ltUjP!- 릋 ǃ <9| H 9|[H 9 }B 8ut@xhu ǃ $n <9 t qNh9}uuJ Bt> PQK t*NjD$9 t#W脯$~ 1ɋ$PjW+ ^_[]ËD$tL$ <;> MIIlttt$ jQx+ j D$uǃ USWV$T$ [T tD$PBpL$ t$tIT$$ t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$Pjt$* ǃ ǃ 11ҋD$8 tlj)D$ >$D$8 $<t$u; } t$Ћl$)$t$@@9 9<$PjQ@) @x H$L$T$ t$<ՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃ D$ ; ;T$ 9<$ to j PYx) @ltQjP5( F t3 j PXx) j j }  ǃ 1;  $l$*ǃ ;  @@ltWjPf' yA t`j t$Wx )ȉ }u D$8o@@lU8 LQj pu ;  "UjP& ; ~U   @@xuă tjWWx) j띍 ; ~- @Uj& yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$Ux) j t Hlt htðuu냹tt u1ÐXt@ xÐUSWV,^ƈtAP8gXD\D$Alt huu =|$|L$h|$r]D|t$ $1V\^`fFd\$ ҋL$tPjR D$Aҋt$t1PjRq $p2< !A@D$Althu uT$l2ǀh2IyTt#2IITth2!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"}~ 1DŽp"DŽt";M|⋋7f0p"Qf0r"I0t"T$ 2D$&DD$$%9uҁ>ȃ^_[]USWVY|$xv|9{`|iT$t$p"fr"f1l2u@>_w-s y(f>2~w-s q(f ^_[]ÐUSWV[L$|:9O\~~l$t$Ifrftt$ fvtR ztC2Rt0D$T$t$ VRPQW7QjP8 1^_[]ÐSWVZ,L$x?|9J\~2D$t$|$ Irftf>vf1^_[S[|A9t'D DŽp"DŽt"8tD1[ÐUSWV[KT$L$|l2uI~w-ss(w!(ff ffffVF>t,D6f0p"f0r"DŽ0t"8tD1^_[]ÐX_|h2ÐUSWVP[:t$8t<@@1|EHd9l2p"fx fr"yVtRt6<$PjRy $!A@Ep"f@dfx0ɋ2@Ql 4QjP( Er"Zfp"fx fr"yVtRt6<$PjR $!A@Ep"f@dfx0ɋ2@QQ3QjPo Er"]fx*ҋ2@R43QjP0 Efxd<#H@ H@^_[]ÐSWV[ |l2tu6t@t!|$QjP !G@f@d^_[ÐX|f@dffSWV[|D$| yOQW~ ;O~ t Q WPW覵^_[ÐSWV[ |$D$OQW~ ;O~ t Q WPxW=^_[ÐSWV[ì|xWt$1W^_[ÐSWV[l|$Wt$Wȴ^_[fffffffUSWVX+tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$@( $ș)l$T$ $L$$$D$wcx)ʋ=T$P;xl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H(D$g1fT$t$j .xŋ@0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ +T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K(Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K(Й~ ƃQWT$H ^_[]ÐSWV[Ì|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(<jVjWP1^_[ÐS[8jt$t$t$P1[ÐSV[8<jVjt$PF1^[fffffffSWVP[{|$tt t9t QlQ $PjW t$F u @t  D @x^_[ÐUSWV[T$$ L$1tJ1ɈL$D$t>D$PҁL$QjPW6L$N|$kK)l$kK) 8;8i)<*PUt;y t0q$t~fuUvٹu1 q @*^_[]ÐUSWV[èD$$L$t@1D$D$t>D$P诀L$QjPW5L$kL|$kC)l$kC) 9;9i? )d+PUt7q tAy$t+nuUw蹸u Ah+y^_[]USWV[ÈD$(L$1҄t@1D$D$t8>D$D$PL$QjPV4l$-?L|$ ) i)ʼn) i)kJ9{J9lj*SiŠ)Ǎl,PD$P贷t1D$Hp,<tzp t:h$D$t}suPuYD$uދ} مt3l$,t+Et$WP-uVq~EЃ^_[]ÐS[t$ t$t$ [ÐUSWVH[t$\~lD$PĩND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P 6ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U }L$QjPU 2L$ȿNt$kK)kK) 838i)<*PUL$D$$@*ED$j=UtƉH$$D$<$|$W |L$QjPW 1L$Ƚ-?Lt$) i)) i)KJ9sJ9Ɖ*SiŠ)ƍl,PW6D$5tcL$f <$|$WO{L$QjPWN0L$ȽkLt$kC)kC) 939i? )d+PW蒳tD$Ep,E!D$h+D1w $$D$}tPU-%PU8PUo%PU(PUͲt8PU蹲tr8PU襲te8PU葲tX'UPU}u^O1<5.' D$UbyNj$tPPy 1L$;D$v==wL$L$Qt$˯L$uD$ 9D$ tf, UQ,$t'UWp|$BU4+1t$ 1 t]|$uf, FM $QP 4$Nx  $LD=uVQV&x $4D$ H^_[]1|$t4$M1USWV[Öh裣WT$L$ $L$81O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG)M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$茯 1Pʋ$H $$$H $<<$Rt$W[ /$//$H $>$D$^_[]ÐUSWV]h2~:^^t@\|,$n*^ÍxЃs.ÉD$$8D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%8Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[1l$E<%uEpuEπ r?获уstlu~;|$~,|$tc릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[ L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$h轛 5 @0t$E4}0u"$h腛E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$謵σstlu7D$ ~ ~$肵DŽ또fЉ9N1ҍ$1$$u>D$$hjPF l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,_E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $t?ȉىӉl$ |$uGD$1l$뀋$8DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $@$t"A$|t+H$D+$謲1$uՋ$葲1ڃV$PB!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,¡RE,}0M4T$$V$0PRQ1$E4$o1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$P!iP=D$π$O6\`D$TDl$H$th$Vh9r‹E0M4ʃ9‰\$WE,y$H$|T$8t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$Z1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,rE,u0M4tڍqu4 $谬1$P$萬$}1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,辛tRE,}0M4$V$0Pt$QE4E,M4},$m1^_[]ÐSP[=T$ D$$1Pj= [ÐS[t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$8ÐUSWV[x|$(t$ l$uPnƅ>l$$uj蛌hjL$tfjVP NjD$uj(PC/D$@ x |$(uW9VqE\1F489P1D$tGuP|$(8x |$(tF|$(m9V|$(I9Phht@U6 t$t$tL$t RB(J8tR0PYltjjPN IA(;P0ltjjPN IA1t^_[]Í8Pjdl9VSVP[,T$L$D$tRQPVƋ$t P/^[fUSWV[t$|$t$jt0ʼnV:UB|$T$V Ÿ9Pt$WPt$<ts9Pt$%tg9Pt$t[9Pt$tO9Pt$uW21* @hTWta^_[]ÐUSWV T$L$[]9PiŅt'}/u~L$$ t$  4$9Pi/P'UPV^u4$UTDžjW_W)tsL$v u_D$ VP,tLT$ L$$ Pt$ ֚Vh'u! $91VB'9Ph$|$ $~:s1퐐Nt:t됐tÍMwUPWy~ D, L$$ t$ [tuPgtG9T$ PQhR~)T$ L$$ t$ $9t$ $:uw1퐐Ot:t됐tÍMwUPVy} D, L$$ t$ [tu$ $ȁ ^_[]Í9䐐USWV[l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%n\$L$ A ZAthhP谞+jj!4G(hhP臞|$ Gt\$h(jPh|$ "\$jhސ|$ G9ouG)o\$UD$pڑ|$ Go\$UVP{ W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP% ~ gC C$ދ\$POF$ދ\$P4~ F$D$\$jWSF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V]mt.)9uUt$V t6u0,1(VRT9ſuUt$Vۿ ^_[]fffUSWV [ȵD$48H L$@ 1퐐/t <,tEPUWPqt .,v3l$4uWEED$\$cD$:D$|$j|W8ltD$4@ T$L$ t[17t<,t\$RT$RD$P~tDl$VWQvs Ut$Pds [1<$WRNjt$D$Pl$8u)EW|$WVr W蘎D$D$D$ Džt$v\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$U|\$8C k$K($fC K(K(|$T$ t$49P<>p1\$91\$-4$K\$9P<D$PȌD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$t ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q袋 ^_[]USWV[D$t uy[:|$ 1퐐/t <,tQL$N$Pzt2ƃ$UWPoo 4$t$P[o a1^_[]ÐUSWV[+|$ t$FN,9vtU6 uCu;Uzt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[Ê|$ l$1wPWjuLt}D$x@ȃǃtVot$ U$)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$ :WuPt$D/WLpr%:WuPt$D1TL$4xT$$s$tntfuσ1} t WPV_i l$ E|$f>t WPV=i }t0EfEfF}WuVi f},t&E(fE,fF}(Wu Vh f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[[|$ t$FN,9vtU6:}u]uUU7rtHnNT$l$f,Ninf|FFWRPf ~F 1^_[]ÐSWV[ìt$FNy9vtW6|uCu;Wqt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[(l$D8EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1B:bGj|U{D$tL$j|U]t L$UD=rUPt$P 10^_[]ËD$tPbDL$ =rY:"D$t+P>DL$=rv:QUPt$T^jjPytt$ $@ 1D5t <,tFPoD$4 VUPhd D5$(L$tSD$HtJ11t <,tFPHo Vt$Pd D5$h|$t+D$Ht"t$79 $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0r$@,t'<$O 1҃ ҃f91wуu`<$O G$1҉L$‹O(Q9T$0RD$p r$D$t$HjjjPjfWjQ:VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[ړ|$t $88ftGt 1WG(fLhwUu2 =waL,|)ƋtVPUB2 9vD|ŃƋGtVPU2 9s D|ŃE$^_[]ÐSV[ݒt$ t_vgmv\mvQmv Fmv$;mv,0mV'mt191u ^[ÐX_t@ÐY?t@u[fffffffUSWV[$(lE$$4D$$0j:WHtrjQP$ t0V$0W  NjE;$^_[]Ã\u 1@tMduHt6luPttxXf$O:t @t@uS4$l$w$D$j@UP/ <:t$EF<:uEl$4$D$D$Otu<PpH\PQHǃ< ` D$OP$$,PQhW: t" ǃttD$u&@u \tl-[P[ÐS[D$u&@u \tk-[t$ PbN[ÐSV[Ít$ j:V=trjQP] tt$VLRk-^[ÐSWV[,|$t$j:V1=trjQP tWhV WhV ^_[SP[ͅD$ L$ $L$ƒu&@u \tj-Qt$P [ÐS[^D$u@u \t1[PL[ÐSV[ t$ j:V<trjQP tt$VLi-^[ÐUSWV׉[äR"jj fD$UWt$@  t$j f19tG4$\D@5DŽ\DŽ@'i^_[]ÐUSWVL[lD$D$H1,<jU\ u} t @u D<@u^\@~DŽ\DŽ@phD$;D$HL^_[]Íl$ E< us{Uh8|$jW\ u|$ u}Fu\@DŽ\DŽ@Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:$ D$t$DRL$D$ A @`? ;19<$$ D$D@ @`ƒ?;91$ D$D@ @`Ń?+;9$ D$D@ D$@|$`D$?;;|$  ՋL$$  <$‹D$Dp$ D$L$ D1 <@4$T$<`Ń?|$_u+;19QL$ T$D $L @`ʃ?|$_u;19 l$ D$L(D$<_D$$D @`Ń?+;19 ՋL$ T$D |$_$D @`ƒ?;9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;;;D$(Q,^_[]É<$t$D$$ VRPQT$T$L$ t$ ?3;|$D/? ;D/ ?;D/D$;/T$T$L$ t$ ?3;D/? ;D/ ?;D/D$;D/D$L$ < ;L/ ?;L/ ;D/D/ $ <$<$ USWV[%{$lD$$  ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ @$ ${3d{4t2tkƷ< sԃ1@tt$ tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ %{|$| t!qtAD>1tBD>׹@$ ${D,|t.tkŷ< s݃1@tt$ tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ %{|$| t!qtAD>1tBD>׸@$ ${D|$t=2t$Fi%I<<fw1@tt$ tlj瀍 ; 1ttD~t$ {  fAB{ w~4AB{ w~4AB{ w~4AB{ w~4AB{ w~4A{ wʼn41 @tt$ tlj瀍 ; 1ttD~t |$Q{$A$ {$B$ $u1 @tt$ tlj瀍 ; 1ttD~t⍃{$ 0pK~QPK~QPK~QK~u$ D$p$ D$l$ D$h$ D$d$ D$`$ D$\$ D$X$ D$T$ D$P$ D$L$ D$H$ D$D$ D$@$ D$<$ D$8$ D$4$ D$0$ D$,$ D$($ D$$$ D$ $ D$$ D$$ D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فL|р3ʉрUɀʈǃ% ǃ% ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ΀$ D$$ D$x$ D$t$ D$p$ D$l$  ʋD$h$ ыD$d$ D$`$ D$\$  D$X$ D$T$ D$P$ D$L$  D$H$ D$D$ D$@$ ʋD$<$ D$8$ D$4$  D$0$ D$,$ D$($ ΋D$$$ D$ $ D$$  ω D$$ ɋD$$ ? ? ։? T$ځˆ $T$ 1$ u$ E$ Qu$ ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ  f 4$l$T$ L$ Ń4ƈ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]USWV(]iD$<X%UUUUʁUUUՍ4P᪪ň Ō x   x   x   x   x   x   UUUU  $؃ň Ō x   x   x   x   x   x   T$H  l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x    x   $x    x   $x    x = = $x   x   ȃx !  ! x ! ! x "  " x " " x #  # x 5# 5# x $ $ D$@P1(^_[]ÐS[+dD$1ɐȊt tT Tt t t4 uP1[ÐSV[êcD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[àbMlD$$D$DD$@D$9\$6D$L$T$@jjPQjRqD$HPj ]ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP&$jPD$0PjF\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pj0Ft$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]7USWVd[u_$|lD$<$`% hjD$@P DŽ$@D$Vm$@8$u H$@D$]<$@UVqljD$P-t;uH;WP5;WP5uD$;WP5D$UV9qljD$@jPWa D$,u:|$$@PW#x$@L$,UVpD$l$0&t$\$UVpD$ D$D$ D$$$@&D$ \$UVpptt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWoD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V51$xUV$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-;PQRe_h$DUt$@V j jW] hjUM hj$P6 D$@hjP" D$<;$`u`d^_[]D$RWlD$tT$@PQhRMal$ ${fffffSV[ýYD$ h`rƉP跎)Ɖ^[ÐUSWV[xYl$0;jD$PUV theh`) $)D$j PUl $l$1}$K1D=t<$t h`tt$,-ō;' 4$t$L$QWPjbV`' L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃|$tl$ t$ D$ tKWV(tD(1t$[ t$ O UF T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[ø1t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[0jt$t$t$@[ÐS[î0jt$t$t$[ÐS[~0jt$t$t$[ÐS[N0jt$ [ÐS[.0jt$ h[ÐS[0jt$ H[ÐUSWV[/t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[/t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[(.t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXO-L$Q##wÍv@ÐUSWV [-|$(l$$t$ D$4AD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[~,D$ hPt$  [ÐS[N,ht$t$1 [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[ý+D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[D$plML$LjPt$lv D$h|$df$D$VL$)L$D$PVWKD$ |$$v=D$t$.D$lp8L$ QjjVVQ|$)cƃPD$2PL$Qؽ ? $ $$m=|$D$lp,t$ jjt$>VnV|$)Ƌ $PD$2PL$Qk  $ $,t=D$D$lp(t$ jjt$>VVv|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>VV |$)v#Ƌ $PD$2PL$Q蕼 sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7jL$R)уtuÐWVt$  r!̐cw^_fffffSWV[<t$|$G@hjPT lj@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[$l$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV' h$$Vk#hVU< hV1;$u Ą^_[],USWV [hl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP$ 1 ^_[]ÐUSWV_$hRP޲ RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ WC hj$P| g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ襣 $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV4 D$hWD$$hPD$;$xu D$e^_[]uffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[(|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[kD$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*\E E(}$uxM$뉾1^_[]ÐUSWV[ËD$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*\E E(}$uxM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]($lD$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ 1tPfDwttPfDwttPfDwt4PfDwt9uGlL$PD$XGpGPGXt$Ht$XQjt$\j)D$EA$al$L$GL$$9؉T$ t$2>|$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$A4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$xA$FQ? T$‰ً$|$D$G<uD$ $@ $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4踑L$ |$ )t$)t$$t$,)wD$ L$?? nA T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E8BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍!AFL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N AFL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$QC l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj @&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B @Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?(ፅ^GPGX ^GTG\GG?$L$u aD?@FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  4BFL$Q? BFL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$A$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tBD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$A~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=^A$FL$Q?P$@$NL$Q?D$T$ ߋ t$^A$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $JUSWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRPvw )t]D$)WPu8_w }43M(U,E4E09w)RVP.w E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[ܷt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[kL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU v F4n0)Pv8Uu 1tN0^_[]ÐUSWV[۶t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[øL$(lD$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RRpT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXůD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$LL$@D$?? u)D$(AL$(AÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+T$D$tq01t ^_Átփ*tUSWV _ǸL$ y y$q9NQǃ8|$d|$$N9l$(4$Jى\$!4$f ؉\$V_?L$1)t,)9멁f*] ^_[]ÐUSWV[Øl$$t} t}$t }t9/t ^_[]ËGHǃ8HD$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPHo )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[X|$$ $w9>~NQǃ8wH,l$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw sJ o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoUo9,$Eo9wŅt0UD$pw H o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw E o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQaE F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw E o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQDL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU|4,$Eo9wŅt0UD$pw C o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUc3,$Eo9wŅt0UD$pw B o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw A o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU1,$Eo9wŅt0UD$pw `A o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVU2 $FlF\iU~0l$E$ыj9wŅUD$pq ? $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV?0 $FlF\iUh.l$E$ыj9wŅ(UD$pq = $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaV[-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$XHp$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPU_uElE\~WGn9wŅ$Uwv + n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv D+ n on)n)ouGGD$8xw1)Ћ$jPQU5uElE\~W`Gn9wŅt)$Uwv * n on)n)ouGGD$8xt1$^_[]ÐUSWVXk$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV'F}9wDžt)$Wvu & } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu & } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUcmAlA\uVF}9wDžt)$Wvu $ } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu $ } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XcÐUSWV^bL$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[Þ]t$t$t$ [ÐUSWVXh]$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX\$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX[$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐUSWVPX[$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Vt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX/UÐUÐXTT$J r )ыS[TD$D$ P[ÐS[ÞTt$ //[ffXTL$ \ $ p, | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_QT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXND$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$ PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$<~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$Y=L$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كS\$T)4f f9Hxl$ $zvt$|$ +P)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~]H $hMH $) $XhMH $ +(f l$|$xt$ +x)9D fHxoh9xXkhl$ (f t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX;9\$T$L$o>o4>o>tB4fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[ì2t$VGR=yaratV=tcidu3VuVStt$PF Y81^_[ÐSWV[<2t$VQ=yaratV=tcidu3V;uVtt$P@F1 8^_[ÐSWV[ü1t$VWQ=yaratV=tcidu3VtVctt$PF i81^_[ÐSWV[L1t$VP=yaratV=tcidu3VKtVtt$PPF1 8^_[ÐUSWV[0t$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$VD$PWU 1u](V u B(^_[]ÐUSWV[0t$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VD$PWU 1u(V: u (^_[]ÐUSWV[k/|$Gt,/D(UwUZt D$0 41^_[]ÐUSWV[ /|$Gt,/D(U蘚wUt D$01^_[]ÐUSWV[ë.|$Gt,/D(UHtwU蚓t D$0 t1^_[]ÐUSWV[K.|$Gt,/D(UswU:t D$01 ^_[]ÐSWV[-Pt$ t$  t6D$t7<$D8W`t$WtD$ 01^_[SWV[i-Pt$ t$  t6D$t7<$D8Wrt$WAtD$ 01^_[USWV[,t$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$VD$PWU t_VD$t<<$D8Wrt$WgtD$(014 <8&3!8Vt^_[]ffffSV[+t$t$ePzK=tciduL$1=tcid^[ÐUSWV[Û+t$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[<+D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[*t$t$Vt$t$f D$V^DD$1^[ÐSV[Ý*t$t$t$1dVPP^[ÐSV[m*t$t$t$dVPQ^[ÐSV[=*t$t$t$cVPwQ^[ÐSV[ *t$t$t$cVPQ^[ÐSV[)t$t$t$qcVP7R^[ÐSV[í)t$t$t$AcVPGR^[ÐSV[})t$t$t$cVPR^[ÐSV[M)t$t$t$bVPS^[ÐSV[)t$t$t$bVPgS^[ÐSV[(t$t$t$bVPS^[ÐSV[ý(t$t$t$QbVPS^[ÐSV[Í(t$t$t$!bVP'T^[ÐSV[](t$t$t$aVPT^[ÐSV[-(t$t$t$aVPT^[ÐSV['t$t$t$aVPT^[ÐSV['t$t$t$aaVPT^[ÐSV[Ý't$t$t$1aVP'U^[ÐSV[m't$t$t$aVPwU^[ÐSV[='t$t$t$`VPU^[ÐSV[ 't$t$t$`VPV^[ÐSVP[&D$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[|&D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP[&D$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[ü%D$QPGt&Pt$t$za D$V?D$1^[ÐSVP[\%t$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[$D$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[Ü$D$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[<$D$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[#D$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[|#t$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[#D$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[ü"D$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[\"jt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[ "jt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[ü!t$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[\!jt$Et&Pt$t$] D$V:D$1^[ÐSVP[ !D$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[ì D$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[L jt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[t$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[Ýt$t$5YP*?=gntsuV!t L$1^[ÐSVP[Lt$t&Pt$t$[ D$V8D$1^[ÐSVP[t$t&Pt$t$Z D$Vd8D$1^[ÐSWV[ìt$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[<t$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[t$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV[{t$t$WP==gntsu?VŃU\t$UPV t D$8 W1^_[]ÐSV[t$t$VP<=gntsuVzt L$1^[ÐSVP[ìt$Xt&Pt$t$qX D$V6D$1^[ÐSVP[\t$(t&Pt$t$!X D$V5D$1^[fUSWV[ t$t$SP;=loobul$VzEloob^_[]ÐSVP[ìD$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[\t$t$Vt$t$ D$V4D$1^[ÐSVP[ D$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[üt$t Vt$?D$V24D$1^[ÐSV[}t$t$t$VP@^[ÐSV[Mt$t$t$VP@^[ÐSV[t$t$t$aVPWA^[ÐSV[t$t$t$1VPA^[ÐSV[ýt$t$t$VPB^[ÐSV[Ít$t$t$~VP'B^[ÐSV[]t$t$t$~VPB^[ÐSV[-t$t$t$q~VPB^[ÐSV[t$t$t$A~VPGC^[ÐSV[t$t$t$~VPC^[ÐSV[Ýt$t$t$}VPC^[ÐSV[mt$t$t$}VPD^[ÐSV[=t$t$t$}VPgD^[ÐSV[ t$t$t$Q}VPD^[ÐSV[t$t$t$!}VPD^[ÐSV[ít$t$t$|VPD^[ÐSV[}t$t$t$|VPE^[ÐSV[Mt$t$t$|VPWE^[ÐSV[t$t$t$a|VPE^[ÐSV[t$t$t$1|VPE^[ÐSVP[üD$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[\D$QP`8t"Pt$}D$V/D$1^[ÐSVP[D$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[ÜD$QP7t"Pt$ }D$V/D$1^[ÐSVP[<D$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[D$QP6t"Pt$N|D$VA.D$1^[SVP[ÌD$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[,D$QP16t"Pt${D$V-D$1^[SVP[t$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[|t$t$5t"Pt$zD$V,D$1^[ÐSVP[,D$QP15t&Pt$t$x D$V,D$1^[ÐSVP[D$QP4t"Pt$>zD$V1,D$1^[SVP[|D$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[D$QP 4t"Pt$yD$V+D$1^[ÐSVP[üD$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[\D$QP`3t"Pt$xD$V*D$1^[ÐSVP[D$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[ÜD$QP2t"Pt$xD$V*D$1^[SVP[Lt$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[t$t$1t"Pt$awD$VT)D$1^[ÐSVP[ÜD$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[<D$jP2t"Pt$vD$V(D$1^[ÐSVP[D$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[ÌD$jPD2t"Pt$vD$V'D$1^[ÐSVP[<jt$1t&Pt$t$s D$V'D$1^[ÐSVP[ jt$1t"Pt$cuD$VV'D$1^[ÐSVP[Ü jt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[L jt$1t"Pt$tD$V&D$1^[ÐSVP[ t$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[Ü t$t$T0t"Pt$tD$V&D$1^[ÐSVP[L jt$0t&Pt$t$q D$V%D$1^[ÐSVP[ jt$/t"Pt$ssD$Vf%D$1^[ÐSVP[ì D$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[L D$jP/t"Pt$rD$V$D$1^[ÐSVP[ D$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[Ü D$jPT.t"Pt$rD$V$D$1^[ÐSVP[L jt$.t&Pt$t$o D$V#D$1^[ÐSVP[ jt$-t"Pt$sqD$Vf#D$1^[ÐSVP[ì t$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[L t$t$-t"Pt$pD$V"D$1^[ÐSV[t$t$EnP(=gntsuVz t L$1^[ÐSVP[ìt$Xt&Pt$t$an D$V"D$1^[ÐSVP[\t$t"Pt$oD$V!D$1^[ÐSVP[ t$t&Pt$t$m D$Vt!D$1^[ÐSVP[üt$t"Pt$5oD$V(!D$1^[ÐSWV[lt$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[t$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[Üt$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[<t$t$TYt"Pt$mD$VD$1^[ÐSVP[t$t$Xt"Pt$amD$VTD$1^[ÐUSWV[Ût$t$jP(%=gntsu?VŃU|t$UPV9 t D$8 W1^_[]ÐSV[t$t$ejP$=gntsuVt L$1^[ÐSVP[t$xt&Pt$t$j D$V4D$1^[ÐSVP[|t$(t"Pt$kD$VD$1^[ÐSVP[,t$t&Pt$t$i D$VD$1^[ÐSVP[t$t"Pt$UkD$VHD$1^[fffSV[Íj ƅt%PV FF F^[ÐUSWV[;|$tzj C1tcPV FF FW;ŃPtQP~n VX1^_[]Í CBBPQhRSV[}t$ tV贠P4^[Í CLCBPQhmRSV[t$ tVTP^[Í CLCBPQhmR_USWV[øD$tfL$ L$QPjj1x@ƃ$Pt+ǍD$ D$Pt$ t$W1ɉV.ʼn^_[]Í9CCBPQhERUSWVP׉[\PQj t}ƍPV n~L$N uq$( U( VPc9tBPUˁ$u vV1uWU蔁^_[]ÐS[>t$Pc[ÐUSWVP[ t$t 9.t 1^_[]Fu V5F $Pt͉NjFu[PW\PQ讃j t!UP$ F~$F qWaUSWV[8l$1t 9}t ^_[]ËE D$P tߋMu[QPD$\PQj t'WP_E$ED$E y4$.iZL$1t 9tËA ÐVYNT$1t 92t^BBtu[^ÐS[T$t 19 uL$ tB ;D$v1[ËBu[PQ[ÐYD$t 9t1Ê@$ÐUSWV[{l$1t99Eu.E PqtNjEu[PW2^_[]ÐVYT$1t 92t^ËBu[^ÐUSWV [|$ 19t$$9Gt{o F D$D$Pt[$W[ȅtЋT$ՋVtэoQPRt$t$VOwo tQ1 ^_[]ÐUSWV[l$9ED$ Etp} P$PtM}D$u[T$ $oRWQP|$WM}u tQ 1^_[]ÍCfCBPQh+RS[.D$t9u L$ t9t1[QP[ÐS[L$t 9t1[ËD$ Iu[PQ[ÐS[ÞL$t 9t1[ËD$ Iu[PQe[ÐSV[MD$ t9u L$t9tf^[Ëp[ЅtItRPאS[L$t 9tf[ËD$ Iu[PQ[ÐUSWV[Øl$$|$ }$tV 1^_[ÐSWV[Ìt$NtFt_V9wwu QPhtFVL$z~ ^_[1DDEDPQhRDDEDPQhRDDEDPQhRcSWV[t$t$|$PWtu^_[ÐSWV[|t$jVt j V~1^_[ÐSWV[t$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[Lt$|$ʃ>tXVt j V1^_[ÐSV[=t$ jV)tj Vt jV 1^[ÐSV[Íj蝹ƅt5h芹tFFF V1^[ÐS[.t$[ÐUSWV[D$ t$tP;D$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋<L$qD$ tL$9QWP~ 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋ8H vHN15t$F FFFFU=tP w싔Nx"u+1Ҁ8t$FHt"tV x>t1^_[]ÍEEEDPQhRUSWV_Kl$D$P1 D<&t0<<t;\$rJ1ɋ@B닀ztuTz;uN<szuuuwXtEuW(1^_[]Éw񐐐USWV[UD$PZ>L$QPjjj$0PD$PZ$$_HtыxnUtUt띐$$QL$ QPƅtׅkUŗtT$$4$tz1U蚗$ƅt`L$HtыxnU_utUPjQt t뫃tX^_[]ÍAvFEDPQhR]FvFEDPQhR>&FvFEDPQh RAFEDPQh;R&FFEDPQhERFvFEDPQh RS[.t$迾[ÐUSWV[$x4$tT}tNU(t H|/t鐐9/ 9sf$.VҁH r?fD XDXXXXDistX/.plV` W$P\ 9ucV^tUjPWVat)V^Ut$V/`u-88V^V 81^_[]É9tE9t qy/t)rVUPQ 4USWV[5j\j91 Ɖ|$hj$] tLǍD$PW蜩t.L$Al$h($#$V9s&W]VW]V<4$D$ l$t1jjWjjQj G,$EWX]tFjVWa D$D$ u;jjjhj|$WPFt",$u U詻1Č^_[]VU F4$ڐSV[t$ jv6Ra v6EVQ^[ÐS[ÞD$P֒t[ÍFEEDPQhRD$t1S[>jt$t$ [ÐUSWV[$4$0$,D$PStED$$;t 1^_[]Él$L$QL$QRUWVPu=VU$8P$8PD$ PT$,$0릅4$t$$8$8D$ PRt?t$ $,|$$0D$$1;<$4t $4jj$8W$8Ut$ VJS$,$0PQjjWUЍNF0FEDPQhRS[ND$P[ÐS[.D$PP[ÐSV[ t$ vV蒸^[fffUS[EM L$$D$e[]ÐUSWV [Ö\2PQa( W^( l$UV赍tPW}^ ^_[]Ét$Wf^j >thʼn(PU|$GEOM,$EV#^W|$W5t(P&V]4$Wp1l,$UW\9uVMFFFPQh@RUS[eEM L$$D$e[]ÐUS[%EM L$$D$^e[]ÐUS[EM L$$D$e[]ÐSV[ít$ 1t(9u V^[ËD$@$ÐWVYmT$ 1t (9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ¾L$1t(91t^1^ËAQ^ÐVZ~L$1t(91t^1^ËAQ^ÐVZ>L$1t(91t^1^ËAQ^ÐVZL$1t(91t^1^ËAQ^ÐSVPYD$t (9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY,D$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY D$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t(9u@H@ty1ËT$ BÐSVPY<D$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYD$t (9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t(9u@H@ty1ËT$ BÐSVPYD$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY<D$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYMD$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t(9uBJBuy1ËT$JÐSVYD$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYLD$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY=D$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t(9uBJBuy1ËT$JÐS[ÞD$t(9u L$ t9t1[QP*[ÐVY^D$t (9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t (9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t (9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYnD$t (9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV[uD$D$ D$~6~$,F0tW-ukճD$jPvp T$ D$1ɿ9薳8"xxu}D$jVjD$jPv T$ D$1ɿ9rG/8"u=%jD$Pv ` T$ D$!Ѓu 8"t7L$d$D$F!jPV tu L$e^_[]ÐS[Þ( jPNH( PQ}1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[}D$0( VP߀V1^[ÐUSWV [8t$4L$8AAItGQPRj W^!UVtWVt UVR1 ^_[]ÐWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[n\2PQpO( PL[ÐS[.( PWL[fSV[ j@ƅtCXPVjPeMF,F0F4F8F<^[ÐUSWV[Ùt3PjZtjj@荔DžuUOj@r1t=XPWGjPLo,w0G4G8G<1^_[]ÐL$WUSWV[t$1X9nUxLN4 Džtbl$~4<$tC1퐐F, 6$1VD1^_[ÐUSWV[[l$}t^_[]j@ZtƋ|$XPVjP>F,F0F4F8F<}$t7htL$7PUrVPbUSWV ։L$[Ò|$ *jjWg qFjPww Ht(ut$$MjD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t#Pjt$(P6t$}.t1t$$.U  ^_[]ÍKJ GPQhKRޘS[>qFPt$ [ÐSWV[ ltyPtWD$PVQ tEVt8>Vt60VR1^_[脞0Wt0SWV[\t$t"ƍqFP6VF1^_[ÐUSWV[ t$>W0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(GG GPQhbRQGP;W1^_[]É.MGG GPQh`R蘖MG GPQhqRyHG GPQhRZS[þL$A4tPQ4I,Dt*P1[ÍAH!H GPQhRH!H GPQhRޕUSWV$[8l$<|$8uV9}4tMqFD$ PWtj WctXD$<9t6$V9$$V9qFPW,^_[]ÉL$jjztNOHl$NPQ@6( PQ3[ÐS[( P'3[ÐS[ޱ( jP2 ) PQa1[ÐS[ÞD$L$ PQ~[ÐS[nD$ t$PR[ÐUSWV[;l$}tQX97uGW3EtS90uOH<1;M uM;H4w\t @,4ȃMW3^_[]ÍHsI GPQh{REHH GPQhcR&IH GPQhhRSWV[l|$wV3Gt$X9uG@WUPk jvDžt!PWGwo 1^_[]ÐUSWV[Hl$19}EuBM1tDm $t: $Uvt^Ut$D$Pj U-;1$D$jut"WPT$ED$E E^_[]ÐZL$1t 9tËA ÐZOL$1t 9tËAÐSV[T$ t19 uL$t r ;t$v1^[ËR1ttVRQi ᐐUSWVP[úD$1t 9t ^_[]ËHh t( $tDUtt؉Ut$Pfi ątKKMKPQhR̈KKMKPQhR譈ZL$1t 9tËAÐS[ީD$t9u L$ t9t1[QPj[ÐSV[ÝL$ t 9t1^[ËT$19Q ut$tRVqN ֐USWV [Ht$(~$t  ^_[]ËFnjQvPt҃~ t D$jPvE ʼn$u 8"tD$NN 9u8"t=KKMKPQhR,1jPj N,$Ur7ǍFPD$PU tcD$;$uZTjPV& tD|$u Wǂ1,$j5rƅt-PV譱F~n W节t WxD$$0USWV$[õy11T$G=w ⍋jAPQf u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5D$L$ yt QP[ÐVZL$1t91u T$ t92t^19^ffffSWV[üj@iƅtEWVD>jP"F,F0F4F8F<^_[ÐUSWVP[Ht3Pj strj@ 6tp1V蔦1^_[ÐUSWV[ël$}t^_[]Ët$j@_tdǍVP7t$jPG,G0G4G8G<>}$uL$UxUSWVP $[*ts֋|$jjWƥ tC,,jPww 諩t(t1rjjPUt$wt1U&^_[]ÍOO)MPQhBRrS[N,,Pt$ ë[ÐSWV[|tyPСtWD$PVQ tEV衣t8>V袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%MM)MPQjfRqQ.mGP=Wm1^_[]É.MM)MPQjdRpMM)MPQjuRpS[D$H4tH4[ÍxN]N)MPQhRqpUSWV[ؑt$(l$$~W|~4tH,,$PU胛tj Ut 9t6$W6$W%,,PUU^_[]ÉD$jjet|qLrHVD$~T$rL$9F9(u:G@D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[(t$@|$t$t$jt$ 3[fffffS[t$t$jt$t$t$3[fS[t$t$jt$t$t$2[fYXZQ̀QQrdS[Þt$t$t$t$d[ffffS[nt$t$t$r! [ffffffS[>1;D$[ÐS[1;D$I[S[~8t jAb1[ÐS[þ~8t jb1[ÐS[Î~8t ja1[ÐS[^~8t ja1[ÐS[.~8t ja1[ÐS[}8t jQa1[ÐS[}8t j!a1[ÐS[Þ}8t j`1[ÐS[n}8t j`1[ÐS[>}8t j`1[ÐWVX }4) ?+ RH4ѐ>t1 @u~H1ɐ>t 9u#:T$4IHDT 4N)4) D$ 1^_ÐX_|L$T$RH 1ÐX/|L$ IHÐX|L$ IHD1ÐSV[{t$ ~u T$F1^[ÐUSWV[ë{l$|$t$8t j^UWVw t {`1^_[]øÐS[N{.[ÐS[.{j^-[ÐS[{j {S[z8t jA^1[ÐL$1;L$Ð1ÐffffffSWVP[Ûz|$t$uRSjV^D$#jt$V Ƌ44a<$lD$,$ltAL$t$t$$U u͋D$|=uU X9,$}d)tuDur;MDMDMD MD9u#1 ^_[]ffffffUSWV[%s$/L$(^L$,EL$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$OD$ 3Ot$DWl$ Ut$ ʼnT$ O8t ONL$ ҋD$0|$4u $\$9 tE9ŋl$rD$89؋|$<s uM"EuD$8tV؉*W9ŋl$rL$89ы|$<rЉ^_[]ÐS[NiL$T$ t$(t$(t$(t$(t$(t$(t$(:[ffUSWVh[iL$|$l>|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPjB =S[~hL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[6hL$u"uUgU,UPQhRDGt$uHT$D$t$ 9Љ,UWt$Pt$Lt$Lm11҃^_[]Éȉt$,9ы|$0}Ut$49Ƌ|$8}!UWVRPt$Qt$Xt$Xl 맋L$<fffffY?eimNA90%ÐXeL$ffffUSWV0Xd$t$Du%$bVXV VPQhRCL$H|$PL$u)$pVXV VPQhRCL$X1|$L$Ww.D$ ؉D$ )t$D$HOL$|$ T$/,T$D$H9wԉL$Lt$9s,D$$PVT$XD$x ͉ƋL$L|$$WVT$XD$H\$tt@1ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$f! T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$L7D$4D$9ƋT$L߉l$9s.*D$$PUT$XD$x ŋT$L|$tB1ɋt$D 9u)̓|$nЃ|$S1ɐT T TT TT TT TT TT TT T9u|$uO1l$ t$L 9u)\$T$Lt\$|$$Wt$T$Xt31T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$1Ґ  LLLLLLLLLLLLLL9u.$t$ g91$C0^_[]USWV<[Ø^l$X|$T|$\|$T!D$u HD$4tǃǃ T$PT$$9L$$[T$, T$0\$|$ =$D$(\$ ǃ|$ l$XL$1L$u8D$4;L$$fD$T4>-u FD$,t$0E<+<-n L$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő HD$t$t$t$0P [ÐSWV[ HD$8pP"tWփ1^_[ffffffUSWV[GT$l$t\tE0~-},t xr }$t jr2U:1Ƀ^_[]ÍsY֍YPQj;Rz&uYY֍YPQj|$t$u^^M^PQjYRF)F31uF FF^_[ÐSWV[L>|$t$ua^M^PQjwRQ~uP\$wGN Qt^^M^PQhR~~uр~|$^[ÐSV[ =t$ t ~t/F^^M^PQhR~uN .wu^[ÐSV[Ý<t$ u"^^M^PQhR1~t^[ÊV u.wL$~9|ԐSV[-<t$ t~uQ(^^M^PQhR3~u'F u <.wL$9^[Ð|$t1ËD$ÐSWV[Ì;|$t$u"^_M^PQh.R1u6T$L$9w"QjV FfFF^_[ÐSWV[ ;t$u"^!_M^PQhMR~u/L$Fy |y|9IL |F1^_[ÐUSWV[È:t$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍC_0_M^PQhhRN_0_M^PQhiRwSV[9t$ t~uF(^Z_M^PQhR#~uNuV9r ^[ÐSV[í8t$ u"^n_M^PQhR1~u(NuV9rT$x 9v ^[ffSV[=8t$ y___PQjTRG^[ÐUSWV[7t$|$u^__PQjbRl$u___PQjcRMϸwG)o >1^_[]ÐUSWVP[Z7t$u"^__PQhRh|$ |$u"`__PQhR;cUL$$Hn 9uЉ,$)1!)1։t$uFAPjQ D$0D$8t p,$VPQ@ D$0)p)t[uQNr-a $`׍_PQhR)L$JBQjP D$0)r&!`_֍_PQhRU1^_[]ÐUSWV[h5l$$|$u"^E`_PQhRr1>0L$(#4W 9u$)1*!)1ׅt"uGFNPjQ D$ NjD$8Ћ $)ȍx)t_uUOr.aL$`Ս_PQhRL$JBQjP $D$8)r*!`E`׍_PQhR2L$Q^_[]ÐSWV[3t$|$tt1)tW^Y`_PQhRuύl`Y`_PQhR)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SWV[ì2t$|$tu)OσO  9 9tj9tly9y]^z`_PQhWRAil`z`_PQhXRB 9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1VL$t"T$ tփuQ^ÐUSWVP[*1|$$"T$(D$,<ȸ9D$ 4t)щʊD$$L$(l$y1``$_PQhRT$L$8D$4t9|$tl$0|$ thu[r&``Ս_PQhRcGRjP^ D$$L$(l$0O}^_[]ÐSWV[/|$L$1uLwt?;t$w6)w*t$uQRjQ ^_[ÐSWV[\/t$|$D$Vt$P8 ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [H.|$$D$(t9D$ L$,ň̍`L$`L$_ $ut$t$ht$ d$<EtM9w'M )9w 8t9rD$4 ^_[]ÃD$0D$4(+T$ ܐSWV[<-t$|$D$VPt$  ^_[ffffffS[,jjt$t$t$t$z[ffS[,jt$ t$ t$ t$ t$ t$ [ÐUSWV[Å,lD$$$$$7$$$ua+aPQjlRI ft$pPQj VI3D$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6!6PnqvPVQD j]aa+aPQjiR $kaa+aPQjjRW ${aa+aPQjkR* D$@t%P, hPV $0$$,]PQX"e9x\F;P(D$$u"kac+aPQhzR $$u"{ac+aPQh{RT u"c+aPQh|R. t$uc$T$@PhQRW<$D$Pjjjt"D$PjjjD$Et$Nt t$ >jjWu t$&L$U$$$t$D$;$uVĔ^_[]ÍccWPQVB 뺍cc ccPQ<t$胤jt$%xjjyccPQ˲j t$8ujjx*jt$xt$t$ pycdu^$p!uS8P$0uP$$u6$@$8j7 $cdpQRj/VtDžtjPQ $t$u5sj$$2$PQWV ^j$$1$PWV8]Zj/Vt^j$PQVc%dVPQ j! USWVh[S&lE$dL$u"bb+aPQhRQ$|u"]ab+aPQhR$$u&Ǎkab+aPQhR$u"{ab+aPQhRt$u"b+aPQhRD$LD$PD$TD$HL$8D$HQPj! l$$D$ bD$$D$ D$l$bPOmjuD$Pa Džx ^[ÐS[~jt$t$ [ÐUSWV[E$lE$$u"aa+aPQh R:$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQH ǸxVtuTfD$D$PW,$D$f$//,$$ffD$UD$PW[ yQ80uN$=uW迗#,,$(W蟗(,$W膗,$M;$u Ĉ^_[]USWV$[Hl$@t$8|$DD$ D$D$D$D$D$D$D$ L$PQRVU<$t$PV~#tcǍD$PVJ}x]#D$=uYW-L$QP_xFD$,t L$;Au=D$zb0d1d+aPQhR1PcE;$,u 0^_[]ҝfUSWV[ |$,D$(/D$uaddPQjCRwl$GQjP G1t$ 4$1D$2t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿`t$ w=݋t$|$<$$t$&$$1 $+L$ r#d΍ddPQj`RD$,H$$t$,F <$)ʃr#dddPQj}RCF)N)!r2r&ed׍dPQhR^_[]ÐUSWV [Ø t$ ~Nƃ2 V҉$t`L$FшT$?r?鍋U2 $j@UPQ6\$+U2 ~t0|$>L$:$u U2 uL$>͍ >T$1ҍ2 -9si$:fU;L$s>t 9sE.9r9s34$fh9s맋 $2 9s$U2 ^_[]fffffUSWV[;t$|$LU\PPWV1U<^_[]fSWV[t$WPPV= W^_[ffffUSWV[Øt$u٨ae-ePQj3RD$F$V~nF2 PUWRt$t$QjV$^_[]ÐUSWV[|$,upme-ePQjBRL$T$ |$l$捃yeUWRQL$QVPt$HK 1uA$L$2 2 2 L$2 L$ 2 L$2 L$2 ^_[]ÐUSWVH[Hl$`lD$ D$D|$\FeE$MUu}meUWVRQt$PjD$JP? $$ePQfjjjjPZƍ~80V$jjjjWZƅZUVZL$\u&ee-ePQhRhL$lQL$ QL$ QL$ QL$ QL$ QL$ QPV$YD$L$ D$D$D$?D$D$@D$D$AD$$l$(L<>4LuŋD$;D$uY^_[]ÍsghgfPQhROghgfPQhR$uffffUSWV[8t$0l$,lD$tu5#pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$lD$OGD$ $?17l$ )ȃ84PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWr ;D$u ^_[]ZfffffL$$Yai qyD$A(tQS[RjjB [1ÐT$D$ Zbj rz $z(t RPS[ÈjRjsB [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[RjjA [1ÐT$D$ Zbj rz $RPS[îjRjA [Xt@ffffffSP[}D$ L$T$$RQPZ[fffS[Njjt$j@[fffffffS[jt$t$jz[ÐS[ht$t$jz[fffffUSWV [øt$ uȈ hgPQjw ^ffffSWV[t$(WjVߣ xqN|$,t?r$Ĥd$D?r'譤-8 d$8!L$jWVj ^_[fffffffSWVP[;t$ǢtB36 PQhRjx>L$ $6 )QVWR6 PQhR(6 > t@> ^_[fffUSWV[Ët$uhhhPQjbR蜝D$D$I@t NQwtى+tՃ-!ȃƉNtu+u0u;t#>!tu:uCtPtЉ#.!tō,#.!u뼉#> t<#> 0# Ѓ'^_[]ÐUSWVX[X|$l? D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ffffSWV[|$t$uȈ4ihPQj:R&$D$ WVjjjPM1Ƀىȃ^_[fffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[ȱt$(l$$T$(1aD$8t8P2`i0 aD$(8rl$ Pt$!ŋ$t$tiAiPQhRAQtiAiPQhR*ڕ0`D$8t8P1WJ4$,t$,薕01UPt$fŋD$G6c,oD$ G > > D$8t8Pq1G^_[]ËT$((E^/]ZjUPQRVj誓USWV׉L$[ү2jeVfj+Vft-1|$WjPjcyFu<$|$1jrVфtjqE $UWdt1jSyu%507+w+01^_[]ÐUSWV׉[> tu*mu?ru<6*FtjPOfv*+u4jj2f&vu*tjPf6Z*^_[]ÐUSWV[Ht$0l$$T$081RD$8t8P1/f&D$08rL$ Pt$諊ŋ$t${iAiPQhRˌ[{iAiPQhR行4d0D$8t8P}.Wه4$))t$)%01UPt$ŋD$G6(oD$ G > > D$8t8P.G^_[]Ët$,|$(T$0VWUW( jMUSWV[xt$u"iiAiPQhR膋$8t8Pi-> t9ut@mt9uu+$8t8P,-h1VEu> $8t8P,|$jWu U ƃu 薐8tU tt$^_[]ffUSWVH[XD$`|$\u#ƍiiiPQj>Rct$$UVPWntUVt$&`ǃu.8uj6%~;$} VP_ǍD$9tLVUA$jD$P{~t&UPt$hWin{D$$oH^_[]USWV4[XD$\l$Hu#UiPQj8ReD$lt$Xy&jiPQj9R:L$`u[to |$$t$($PVDt$tS1ɐftsfTLLTftWfTLNTftMfTLPTftCfTLRut:N,19tDtPrt$FPqF^_[]ÐUSWVY+T$tht$1BtBظkw+ttրztЃːt *u1^_[]ÐUSWV։[ÔF,F tvj{FUPKkl$~D$uNtQjPawD$ L$$t$ F1퐐fjkIjPQhSVojPQhpVo1 GtfLGtVLGtFLGt6=u $$$VPV$y$B @uD$$PQD$$PQR(u%#D$=@u;$s#E/$B$L$ ;$u Ĉ^_[] !USWV׉ $[@l$s$$u)kkIjPQhR&n$|$$u"kkIjPQhRm$u"jkIjPQhRmD$fs$9 $9=*uG=*uG=*D$GD$ 9$D$$)9$f:BD$D$ D$ $f9uxjkIjPQhRlkjkIjPQhRlDD$D$ D$f9Hu&jjIjPQhERUlL$1AtATAt1TAt!TAt=u1E @uD$$$PQD$$$PQU$1ɋ $X#T$,@tsBЋT$$Ut$P$$BT$$UP$ $D$fD$f9u&j"kIjPQh/R kL$ftL$t,=tsAuE @u1$P -$hPQi* E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtuo$0Q׃}1E qjMD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjnl ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ KE;D$f/t$$$P $$$$$U$u"jjIjPQhERg1$ BtILBt9LBt)LBt=uf$@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=pIM lt$10lD$/ Njt$$E @D$uP`PUu >l8t E u;$uĤ^_[]ÉNjt$USWV׉[u"ȈIjPQhRel$(9rfu ^_[]1t$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$zf9u;Twˉٍ^L$ |O]u`$$;D$ u)1;T$t\$9vL$\$;\$(f$ω4$ލ^ρ]tN-uf9w f;Fw$~ːf9t4$뱍,kIjPQhRc8kIjPQhRcUSWV[ul$$ukk\kPQj_Ruc$$tu(i1D$$tŋD$3l$ \@h@PD$(D$$D$ ^L$L$\QPKtYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1j1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tW!PWuR uhLD$Rl$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P0 (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$kjPv u|$1D$Wt$VTƋ$6yd$t$8D$|Ay DAD$$uD$*8ՋD$DJtDHD$D$ $@uP 8 DAթD$kjPD$p\jPD$p D$ |$t$ztG$`L$tZkjPq@(jPD$p{ /1ҋ$tkjPD$pR1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1LD$ 1H1D$ D$D$8-b< bY1D$ D$l$t)aD$D$\Pju+V |$a8|$ $%|$t.rjPu. |$t&aD$uq|$ra8|$ $tt$Dtu V_Dat$jl$ Un] 1$u UV;$u!Č^_[]Ë|$|$[| S[{jhjt$t$t$)[ÐSWV[Ü{> t-> jhjVPt$$t8> 0jF> > tPYE> u^_[ffUSWV[{|$ukkkPQj jjjŞ > l$> tUQ> 蘞 > tb1i > 9> wHt QU > WD> t$UWP8 > u 1T$ Ɖ^_[]ffSWV[zTWE> u> jP0xƃ> 1> t > 1W^_[ÐUSWV[ëyTW> u> jP/x5ƃ> > U";D$wUt$Ex1I^0Wq^_[]ÐS[yt$-ƃ> [fffffffUSWV8[xu }D$D$L$$jjPQjR^rL$0 $$t;L$$L$D$l$tL$(L$D$l$_uVkIl=llPQjER]WPYl=llPQjFR6W,D$,D$D$ l$_e^_[]ffUSWV [øwdlPQ [t\ƀ8tUT$D$j PV tŋT$t|zt)nlVPՐ1ɿ[kP&wAT@ʹ&u[@9~ $ljPE,$lVP%T$t$$D$ t l> RUPjQ}L$ t>> ^_[]ffSV[=v? u*ǃ4? "@PV謁? tt? 46VPa1^[ÐSV[uǃ4? ? tPؑ9"@PV+? u46VP1^[ÐUSWV [Uul$ǃ? ǃ? ǃ ? ǃ$? ǃ(? ǃ,? ǃ0? 8? ? hhU)D$ 1Ʌ$t$'L$ $t$ (? L$l$<ǃ? ? hhUD$ 4? t$Pj\WVO t8t剃? 8#tj\WVN t8t뉃? j\WVN t8t뉃 ? j\WVN 68t牃$? ǃ,? ǃ0? j\WVgN tD8tP,? j\WV7N t8tP0? h$? |$$W7 |$&j\PD$ PM ǀ8tWEu͍UWIth=UWItTfUWIt@UWIt,ӧUWItnUW|IQ(? E5xxMf l$<$j\WVM 8t牃? 8#j\t$VL t8t艃? j\t$VL tOǀ8t扻(? nPWH"$? PWHtb`$? D$"@m4? PQ (? l$tэnQP8HuF ? <$j\WVK t8<$tP,? j\WVK X8<$tP^0? t$t$1ɋ;$u ȁ ^_[]7SWV[|pt$u"ȈllPQhROǃ4? ? t P]("@PW{? t,t+V? Fu䍃? 46WPO1^_[ÐSWV[üot$u"ȈmlPQhRNǃ4? ? t P蝋("@PWz? t,t+V? +Fu䍃? 46WP1^_[ÐS[n? tP3Oǃ? [ffS[nL$T$ j@t$[ÐUSWV8[Önu#֍k^m)mPQj{RM|$PT$ugm^m)mPQj|R|MD$T$L8D$,D$D$(D$ D$$\$$|$ $9 EtL$|AyL$ DAMZu*?$D$t L1t 1t^_[ÐUSWV$[õgl$ jj$H$DDžtu!L1Ƀ8-ىL$m|$dWq1D$KWP$H$D5D$&h-1|$4$l$t$ D$1t$ D$,8hUPVfl$D, jjV$L$H;D$$~UP;l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11P@U@;$ u,D$$^_[]D$ʋ4$t$ l$1OUSWV$[Åel$ jj$H$DDDžtu!QJ1Ƀ8-ىL$m|$dWA/D$KWP$H$DD$&h.|$4$l$t$ D$1t$ D$,8hUPV6l$D, jjV$L$H;D$$~UPR9l$|$UPV$LV$HfPt$VW$L$L~9u`|$D$ǃ;|$.$D$?11P\>US>;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[Ucl$ jj$H$DDžtu!!H1Ƀ8-ىL$m|$dW-D$KWP$H$DD$&h,|$4$l$t$ D$1t$ D$,8hUPVl$D, jjV$L$Hb;D$$~UP"7l$|$UPV$LV$HPt$VW$L$L.9u`|$D$ǃ;|$.$D$?11P,<U#<;$ u,D$$^_[]D$ʋ4$t$ l$1USWV[+a|$l$t+PWUD uu^uڸ^_[]ÐUSWV[`|$l$t+PWU uuuڸ^_[]ÐUSWV[k`|$l$t+PWU uuuڸ^_[]ffffffS[`40t$t$ [ffffUSWV [_} lF FEFUVzRu)ʃԉF:FJFx9uRu}N ;Nue^_[]USWV [!_} lF FEFUVzRu)ʃԉF:FJFx9uFpRuz N ;Nue^_[]5ffSVP[|^D$L$T$t$4$VRQP腪ffSP[M^D$ L$T$$RQPkIfffffSP[^D$ L$T$$RQPIfffffY]T$t :tp1ÐUSWV<[ø]t$PlD$D$8uȈmvmPQjhR<pVPQ` 8C hjD$P> @C D$ $OC D$ t:t|tD$ 9rPC jPQt$~p TC jPQt$dp L$ QPt$Lp xNt$ uPV3t"mPV3u 16  C V6Sj:Pt$] tC l$mOUPt$u tL$`C UPt$zu t D$hC UPt$Wu t D$dC UPt$4u t D$lC I+D$ PVt$-o t$ u".kmvmPQhR:PVZqPVZFuPVZ9zPViZ,PVQZPV9ZPV!ZPV ZPVYPVYPVYPVYPVYPVyYvPVaYѵPVIYuPV1YeePVYUPVYEPVX5PVX%PVXPVX81DQV訯UVt$ur tD$1f6 .$&(,048)fp tt$C $UPt$p tL$C fUPt$o tt$C fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&C aD$ `|$4&L$ qL$%L$)L$-L$1L$ L$5D$ PWt$@o tD$ UD$,Pt$#o tD$FUD$0Pt$o 1ɃtL$Nt+D$PD$4Pt$n t D$1vF UD$(Pt$n tD$ 1L$ F L$ D$ PD$(Pt$hL$ L$ t$L$ u&.k΍mvmPQhR3br1DPQTt0Euዃ8 1DJtVt$F t$ .L$ L$ l$|$4=D$ fC fD$4dxD$6D$50UWt$m 1tL$C D$51UWt$_m tL$C D$52UWt$8m tL$C D$53UWt$m tL$C D$54UWt$l tt$C ǃ8C WEVǃC WEV4$-L$D$;D$8u ȃ<^_[]fffffUSWVP[ S|$L$W$ك</@t)9v"9vH8/u)t\9v N8/@tvljD 9thUWVƄ+D ^_[]À|$/tÍffffUSWV[Ql$U3tNL(81DJuK4$6D$j PUfg }t֋L$9tJ9tE6^_[]ËLJ wӍ<(@눉R68"u rL$ <$։q1늾=3ffS[Pj t$ x[fUSWVP[Pt$tttnL$VtH|/t|$/u29r9vzz/u)ρwH hUPV}Ƅ+H ^_[]fffffffUS8[OED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[|Oƃtk|$|$uP1uP!jjP? t8jPjWjW|W^_[j2fS[ND$t=u3[t$ P[SWV[ÌN|$t$uVYnmPQj1R-WhVj ^_[fT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[L[Ḯ̀rS[L[ḭ̀rS[ôL[̀ffff̀ffff/̀ffff^̀rS[dL[̀rS[DL[Ḥ̀rS[$L[<̀rS[L[̀rS[K[ḇ̀rS[K[̀rS[äK[ḓ̀rS[ÄK[̀rS[dK[`̀rS[DK[R̀rS[$K[2̀rS[K[ḩ̀rS[J[P̀rS[J[ḷ̀rS[äJ[Ḷ̀rS[ÄJ[ḉ̀rS[dJ[̀rS[DJ[Ḛ̀rS[$J[̀rS[J[Ḩ̀rS[I[1̀rS[I[Ḍ̀rS[äI[òrS[ÄI[ìrS[dI[l̀rS[DI[t̀rS[$I[s̀rS[I[r̀rS[H[p̀rS[H[j̀rS[äH[m̀rS[ÄH[̀rS[dH[Z̀rS[DH[ ̀rS[$H[S[H[ᐐ*̀r׋L$Q1fffffỲrJ!Q,fffffS[îG>)SV[ÍGL tFL PjGtsL 4+L 4L L R; ^[ËL HL jjjhjPj覬1tȉL uj$Pj~ j*S[FD$L );L t PN![à QP身[ÐS[ÎF̢jP,L uPj[ffffS[NFHPt$t$t$ [ÐUSWV8[FulD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y8DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ PPt$t$ ZD$x$WPt$W @D$x$WWPt$Wg )D$x $W,Pt$W< D$x$WPt$W uD$x$WPt$W zD$x$WPt$W `D$x$WPt$W <D$x $WUPt$We D$x$$W*Pt$W: D$x($WPt$W D$x,$WPt$W 1D$D$$T$EHL$D$D$D$ PpPt$t$} D$@D$ P?Pt$t$L  D$@D$ PPt$t$  D$@ D$ PPt$t$  D$@D$ PPt$t$ D$@D$ P{Pt$t$ D$@D$PJPt$t$W 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ J|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ #nD$ ,n|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$5n|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VbD$Pt$Vp ID$ V3D$Pt$VA 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uPH=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$HQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$TډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$xA(|$€´|njWP $BnjWP| $FnjWP_ o$JnjWPB ~$NnjWP% e$RnjWP O$VnjWP 9$D$D$PD$PWt$ 7D$@D$$PvD$PWt$  j\$0T$L$0DHtJD$0$Pt6uF $jPF$F(WF|$*|$z$d1  $iUB$J($1 UB )iJ$$B(1UB $$1+1|$r$L$B(aD$ t$ D$ L$ȃШ uNQi)1uB,i)\fиwi)\f1N Vk4<$ȃ u|$$uD$$FL$NlQkdl1u'ui)\P ףr1с)҉)i%Iэ))ƒʋt$$$Iʉ)ʋL$())uFЃFL$$ШL$NQiҐL$)1uE,i)\fuwi)\f1=‹Fk4 $<1ʃ;D} $r+3DMAD$AuNL$tuϋNQi)1uB,i)\fиwi)\f1Nk4$NȃF ?NQkd)1u'ui)\P ףr1с)҉)ȍ 0i%IЍ)ȃEHx3QЃs1΅$u t1$Ep]΃t1ɿŃD$ $D$,;$0u D$ e^_[]賺fUSWV[(t$,D$(L H9ttkHyw €|$T$ H w ,Ŝ,$HP x(@D$US =*nfF F????F:?? F ?:??F?? ?F??? ??? T$̉ҍ)эnQPUt$Wt$$t$t$(R|$,WVF/,9s1=tnlQUt$ WRt$t$$P|$(WV/(9r1T 8^_[]ÐS[Î'L Pt$ s[ÐS,[['Pt$ƿjVU =t$(oD$ 4D$l$ |$,QP͉D$$txȈpoPQjCR|$(9ppoPQjDRjUX^_[]QT$ t]$l$E ɉt QaE,$,Vt$(U .D5=L$(T$RQP 1fffSV[!D$L$ t(T$t L$ RPQ Ttƅu D$ #jQ 01^[ffffUSWV[e!$l$t|4BuTppPQjDRFjjU虜 ;r $$DŽ$DŽ$$jP誡$8jPXDŽ$PDŽ$TDŽ$X$`V$`DŽ$hfDŽ$lf$n$pDŽ$t$|DŽ$$DŽ$DŽ$$$$VmƅxU;1Ƀ ΋;$u ļ^_[]@S[ÎHt$t$Pt$[fffSP[]D$ L$T$$RQPE[ÐSVP[,D$L$T$t$4$VRQPD^[fffffffUSWV[D$,|$$u#sp`pPQj?RD$<l$0tjWWWG0tW@9t Q G0ǀǀ GGG yw%\1|$,u"fG GGCGGƍD$ L$PQW^ T$T$tD$(Չ 1;l$t1Ƀ|$, fO Gy1pL$p$`pPQhRL$T$ou GfuUy"pp`pPQhRfo6$U7tI1$ʀ;l$JKG݉oTdjW^_[]þD$9tPu$ffffffUSWV[Ël$jUD}(t4UE u8jjjuU(!ЃtsE jU7^uP}Tut5Et.+E EM0)׃9t E<)jUjU^_[]fffffffUSWV[Ûl$jUT}(t8UE uEFt PF tX~tI1퐐t(0|F t((mF t( ^;~s F @ƋF PBF,t P2F4tPF8t P V^_[]fffSWV[Lt$LWqPVq\WX^_[ÐSV[ LV6P[V^[ÐSWV[LWPP"\Wי^_[fffffffUSWV[{t$l$uȈLqqPQj1(8DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsUSWV [l$(t$ D$D$ |$$El$ߐt$,D$PUD$P|u$D$͐׊D$l$EjD$ w"`sD$tmD$t]+t$ qqPQhR(qqPQhR-qqPQhR ^_[]ÐS[^ t$t$jt$ [ÐS[. jt$jt$[ÐS[ jt$t$t$[fffffUSWV[ M |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉM uj(qƉDl$Utwn$Nj 0Q, 1M utjh=ʼnM 0ƃM LtMjуM @1t*n$FUQj P|$z^_[]ËM )USWV[[ M |$i)Njtt+~%L$9N$ut1Ƀ|$tΉM uj(ƉDl$Uȡtwn$Nj 0Q輨 1M utjhdʼnM 0ƃM LġtMjуM @1t*n$FUQj P|$z^_[]ËM )USWVP[l$UNjM $tOs;1҉vM ljh=aM $uƃM D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0M tuR:t!jуM tiE$SM uj(ŋ$,tIEj |$WPa W̡tE@E$L$1E^_[]t$̡t@ϐUSWVP[l$U(NjM $tOs;1҉vM ljhqM $uƃM D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0M tuR:ġt!jуM tiE$SM uj(ŋ$,tIEj |$WPq WСtE@E$L$1E^_[]t$Сt@ϐUSWV[ t$|$ ԡtЋM t61=tDtPLǃM D$L$ƃM M t?1=tDtPǃM D$L$ƃM ǃM ԡ̡D$ 1^_[]ÐUSWV[t$|$ ءtЋM t61tDtP<ǃM D$L$ƃM M t?1tDtPǃM D$L$ƃM ǃM ġءСD$ ȡ1^_[]ffffffUSWV[$tA$1uhƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/xh>X?USWV[+t$tD$tdPV$xaa1ɐ΍,?UQt&UP#y.w8"tVV 1^_[]ffffUSWV[Ët$V辝M P~M ƃM 8 tj~V:u^tVtDi@u\uRDQ@u말:u~u'M t PKǃM ǃM 1 ^_[]ÐUSWV[k|$t$L$W91:u?8u(t$Ր}^8uuu@tp:ute:u^Uw_wPQhR_ww_wPQhR81~@t^_[]ÐUSWVP[Z|$t$u"Uw_wPQhRdl$ tt=jUjWV^_[]Íww_wPQhRuÍȈw_wPQhR럐USWVP[ãl$LL$8u"ww_wPQhR$du"xw_wPQhRu$lu)ww_wPQh RH$|$pu)Ȉw_wPQh R$ t$ l$4$h\$M $lu)Ȉw_wPQhR$|t$tx8t$tD:;|29v&t:t|u싌$lh $ $L$1xjjjU t$e+xPQh|$XWjjjh@WSjh@uwu D$jl$|$(1ɍl$L1$D$D$L$$AD$ ЉL$L9rT19r=|$T$\$hQl$ Ut ƅ,4LT$|$< u|$$tT$ $1s$#gT$$lu-\$Ȉw_wPQhR$|$tX8t(a:X|O;$v<t:t|u싌$l듋$$$L$$t1<9< t+< t'#<:t <\ut111D$9;|$L$$T$ $)\$PL$QGT$+$‰$L$$|$|$t UtD$$t$t|$(G 4$gT$\$t$ |$(l$ܡ$ppD$L$,4$|$(D$$l$T$<:u>tuk{D$ ؊6U8u Xuuu@}=uUt @fƀ:t FuFT$L\$t$$Ut$ t$4 \$,L$Lt&u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:D$\$L$ щD$)9L$ |KT$<,$D$)\$D$PU ))\$)D$Ɖ$T$<*)׉ڋ\$QVPJ Wt$DU< t$ t$,A4/L$,\$t$ l$T$|$t Uiq<$ЋL$49T$v)RWTuWL$81Ƀ|$D$|$u04$0M Pt$ t:M PD$M $D$D$ V4$$lu)Ȉ1x_wPQhR$|D$,P腒l$,t$ \$D$0jD$HPUWW t$t&t$D<u/t$,D$Ht$ Ľ\$WW<D$\$V D$hUͽt_UVP* WWxz1ɊD$D$4T$D$8(D\$4$  |$\t$JoKWWI t$ ;$Lu|ȁP^_[]0Uǃ|$\$t t$n4$t$ 믋\$Ut|$t\$t$n\$t$,MbNXL$ܡÐSWV[lt$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍUw_wPQhR}Ȉw_wPQhRVSWV[Ü|$t$tGtiM tPǃM ǃM ƃM ƃM WV^_[ÍUw_wPQhR_uww_wPQhR9pS[M tP#ǃM ǃM ƃM ƃM 1[ÐUSWV[Õ$,lE$$$(M uM ȋM u!Q0M 7M t%1M M PQ1t $D$uz1M V7VǃM M HM @QPM u8/>9v$uP FN8D} .~ wF F P[BuWv T^ tŃ~?:}|@uH)ƒVԍ]ZF F BBQWP uvv ] ?~?:uF=~t  8u F,;8u e^_[]NsS[Î40t$t$ [ffUSWV [Q} lF FEFUVzRu)ʃԉF:FJFx9u40Ru\ N ;Nue^_[]crfUSWV0[ãlD$(}!PQdM t$M L$ML$f|$ L$T$|$QRj WP1uOt$ rF|$j WP u0O L$FD$D$ PjL$Q2 79_t$} urQ tgM9uWM % x6QPR}Wu19r"y";L$(M jjP@ PJD$t$L$ WIt^fxHuHPQ$3U q 3u uًI3Muˋpjt$Vq uEPVu} ;EsD$t$W+HL$%D$"T$ ;UwRPuf 1ɋt$;D$(u ȍe^_[]oS[>xjP*M ]h P;>Q [SV[M hVt$t$t$%t1^[fffSV0[út$DD$@t2D$D$ D$HL$ $@D$1L$Ht$t$Pt$+[fffUSWV[ t$|$l$jU輝HWVPUjjU譟^_[]ÐUSWV[ût$l$ |$jWlUVt$ WjW`^_[]ÐUSWV[e$$lD$D$tF0u ǀ$D$D$,D$8D$ D$(|$ yOL$ $P٫tRF$&D$ FF V腹uWP蒫u뉐%$1틼$% $Bz  ,HЃԃ $˃ $‹$tU% @뛁 $룋$z| $넁 $u $ fJT$ F%D$ FF VUuWPbu˺%~V(9FD$ T$ D$~;%T$ $T$ $7T$ $'D$0<^ZBD$0T$ NT$ $ $D$~T$ T$ D$D$(~D$8 $0@D$T$ T$ $D$D$(~T$ $D$D$(~T$ D$~T$ $D$D$( ~T$ 1ɉl$ύ$hPQ_ D$004D$T$0‹L$L$ T$"L$$D$D$$A-D$ D$0-<]tL$$D$Q Q D$Q Q $WU[P h1qD$Q Q $WUP yLjQ D$Q $WUO D$ 뒄tT$0]tD$ L$ $ D$l$~ V誴9$ ui$WP覦WP菦D$ t:FHN}VO$$D$T$  t $ȃVRjD$0jL$D$ b1 D$ $D$b8|$teFAOL$D$tF~VZ! t L$FPQT$D$uD$)ϋL$ȃD$,[ 1 ŋ $D$c8|$Q $PԤu3FHL$QT$t~V聲tL$D$ȋL$ )L$L$ D$,E$L$=r $ ՀMs ɋ|$( Z $$? L$(K$L$($$? $@  $T$(S$ $$?L$(l$,$ $9L$ ,$D$(l$W$с|$(tѺuu?tT$(t? $T$(L$QT$FHNV諰 E=r$D$ ,L$t .$ tEt@u%{{yPQjJRKE@NT$RQjjjuЃ>T$u-*||1{PQj[RT$,$ t|$ tEtHHu0{{׍yPQhR譔|$0EHHPVt$0t$0WRUуt O0$^_[]ÐS[.HPt$t$t$t$t$c[ÐUSWVP[l$t$D$ $ t t@8u']|H|yPQhRד@8QUVwЃt 臙0$^_[]ÐUSWVP[Zl$t$H$ t t@8u']|H|yPQhRE@8QUVwЃt 0$^_[]ffffUSWV[˳t$l$S3PQWʾ t"t$ VW( "WjjPkUSu6PQW芾 t$^fffffffS[>jt$t$t$,[fffffUSWV[l$,L$(T$ l7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]NDUSWV8$[À$Ll$4u"|||PQhR|$PD$u,$Pt"|||PQhRAt$$Xu"|||PQhR$Pt$Pr軖 9FjPoD$tk|$jWPD$(D$ tND$1ɅujW)t3L$$\$T@u%t11|$l$r1҉D$L$ |$41 tw|$tE9sP r L$4QPUW˝x9!xt19)u|$T$$l$);$Pw|$$Xt$,VND$jP tT$1 T$|$$T@uW$L$,Pt$ QW辝t4W$t 8D$1D$(vt$,L$ɸttQȃ1Ƀr8T$1ɐ44t tt tt t 9uӅt!1ɐ449uD$l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@|$T$L$[l$L$T$ jWPjU1xL$ȋ;L$u^_[])8USWV[k|$t$t VD1[L$1jUWPV^_[]ÐUSWV[|$ t$t VND1[L$T$jUWPVN^_[]ÐUSWV[˥|$t$t WC1[1jUt$$PW^_[]ÐS[~[L$1jPt$t$t$[ÐS[>[L$T$ jPt$ t$ t$ [ÐS[[L$T$ t$Pt$ t$ t$ ?[ÐSWV[ü|$t$W藓uGكs^_[!t_t$t%<@F@F ^_[ÐUSWV[;|$ u ^_[]l$ t$W輓t t- t(W襓tWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[È|$0t$,Wt$@{D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tvH<$|$Dփ 6D$4)D$4@u \҉L$x MVat^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/8DPg%0W$\P$D$4@uWu#8DxuGws>4$$^_[]ËD$4  !rfUS [EE$D$D$D$PQWD$e[]fffffS[t$ t$ [ÐUSWV[ş$$%= uRl$|4$iƅt<9w㍃V}k}PQjR}GÂ=r6D$,h1uDžtV;9w ‰ щ ȉ  σWl$u?rƉE}M(tXP&gZ$t1ƒYL$,PP@T@,p@ @J@@ @@D)D$QD$ 112fOH|$4D$,$t$Wl*t$$U:ƋD$H(L$tXP8fǍHTD$t17YGPPUQZ w,L$AGG GJG GGGDD$GoD$PfGt L$ y|$ 1l$9Dl$[|$4l$trVP$$M(tXPet tU1YE<$twW\uut$JuuV>uU5u1^_[]ÉYT$HP@T@,MH@ @J@@ @E $Hf@H u&jh@P8T$ EuM(pRt`USWV։[љG(u2nPFJt3fD$9j|jUz El$FJu̓N $UQYY~8UvuwB~f z}k}PQhRGxF}k}PQhRxUQNt(}8~ j|jUz f Ą^_[]E%===@EM $N1~(Pw,to‰4$D$4D$t$@(ueO@4u\D$0D$(D$D$$31fGHsG D$4l$L$ $Љj0 t9D$"D$ <u SsG OJEsD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDRb)l$ǃt$<)l$ D$8D$D$14$D$Lt$)DžN( u" .uGt<.utʐL$tXw P3WōG UTD$t1 .YMPNQPT$ RK u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRZa4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$m1}k}PQh1RgD$u‹.l1F)EHftf },$FtpP,bu|$t$u N)$xDuW@8/tOF(uIjh@PX tFFU $U<$u~ljF^_[]FUSWV[ۆt$u\~R~~PQjBRe}t v$>VD }t!v$v$v$aV`WK^_[]fS [;HPQt$ t$ ,$ [ÐS [t$Pt$ t$ l ,$ [ÐS[΅L$T$ HP[ÐUSWV ׉[ÔT$48tb=t= T$4t=uD T$41HL$@L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[w[USWVXXv$l$x|$lu"$jPQjwRUL$ttwF$[$RPQjxRU$vl$p1 D$͉L$4A$P]@D$(u'$RcPQh"RDUT$tЃD$|u,$RPQhoRT$؃D$ JL$l$ |$lT$tL$l$ щˉL$9D$ ;\$lL$xvߍ4$WVуD$ ~L$tt>1ҋt$D L9u׍*t$t)փ|$r؉΃|$r1Ґ ,, LllLLllLLllL9u4 t$4l$(.Mu$cPQh#VSLPQhnV$iS$3ȉƅu4$RL$PQhoRSL$ $D$,l$ /؃L$JL$݉D$ \$$!D$T$tl$  *ωL$9w"ސD$ ŋ|$9ߋt$xvD$$WP֋T$\$,D$ ~L$ttE1ҋt$D L9u׍*t$t)փ|$rЉ΃|$q1Ґ ,, LllLLllLLllL9uD$4|$( l$ /L$<|$l$PWփ8t$,ىL$0D$T$tRD$8L$(L$\$|$$D)L$(D$L$T$tD$4L$(t$,t$|$$9.9D$ NjD$84(L$$VW$L$8(L$D$,;|$$rÃ|$ T$tL$(\$t$,D$4;l$ XD$<.+|$lσ|$8D$tt71ҐEL5MD59u.)֋L$(|$re *փ|$rW1ҐL,l LllLLllLLllL9uՋL$(l$ T$tD$4t$, L$t$ 9D$ |$t$ D$|$l\$t>D$ L$ ȃL$t U0uuD$0L$t9rދl$ ;l$$D$ $UP$\$L$<D$D$ |$t$,9W<$VW$L$0Ȩuˉ+D$lD$(T$\$0tL$tU7uuߋL$t9rk|$l T$tD$4L$(4ȃ90rt$<T$HD$ ‰$D$4|$L9|$lΉx9։|$LtՉЉ|$D͉L$(t$@D$P&D$DBD$DD$PՋT$T9tl$$ŋ)4t$9t0t$T+t$@1D$09l$$;l$Y9Qt$$VU$\$t$~ \$0l$1҈ډT$|$ T$t\$ 9؉t$8L$l$$$Pt$ D$4$T$|;D$~9L$,i\$ 9L$$Pt$ D$4$T$|;D$9D$t$w>t$,T$tt$9v(t$$Vt$ $;D$~ЋT$t9w؋L$,l$$96$Qt$ L$ $;D$*T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ sj$Qt$ L$ $;D$~bT$tL$;L$ s>$L$Qt$ $;D$~6T$tL$\$ D$ D$9l$^D$T$tL$9l$B|$tY9r1ɉl$H9u)ω9r1L 9u:D$ l$$49v$L$$Vt$ $;D$~ T$t\$ D$T$tбL$9v\l$$T$tl$$9v?\$ )1$Ut$ $;D$~T$tl$$\$ 뺉ًt$89l$|$tIE9rl$Ht`1ɐ9u)DE9r1  9uNjT$0Ѓ|$<T$0NONONONONONONOu]Ѓ|$<T$0rPMMOMOMOMOMOMOMOuD$L$L$ 99s9t$T$0d$Dt_|$L$(t$@t.9r9rL$(t$@|$\$t%E9rE9r|9u$t$4VWh $QoB1X^_[]ffffffUSWVP[êg|$8tqw$G$t,GO4$6tV1‹n1 uV ;Wujj1ƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW" u$*jU!t@ PVWV" 1ZH8t uLHCH $tD$ 81^_[]fff̀rS[c[ḃ̀rS[b[SWV [bt$ |$uȈkPQj񐐐9t uD$))t8t)Pt u+D$ P^_[]fffffSV[M_L$D$T$ yp9cRVQPYCh6Q4P 1^[ÐS[^D$y%p9cQ PQj@RBh Q j@4R Q [fUSWV[Ë^t$|$uZoƁtPQj?R=l$tt41 |t$t$ t$ Wg uD$ <=u.|$$ R 9ttD$0R M9u;R s|9v9tfP.ǃR ǃR $jWP 8088uyPD$0t$ )$jWP v80o88u4)  $PjQ4 $R L$R ^_[]ÐUSWV[S R t R 41t0DtPVt R Hى|$jjD$P tE t5jVt$ F: R tVt$V,ŋD$R 9tP,ǃR ǃR R UjPL3 ^_[]ÐUSWV[Q481tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[jQ|$1|PWtfƀ<=t^4tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[ýP̢Pfƅt50^[ÐSV[}P̢P&ƅth50^[ÐSV[=P̢Pƅt(50^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[ÚOD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[8OD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[øND$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[8NL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[xKT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$u"`OPQhhR(n$EjhPW_ VW t$ VW tD$WPOmPQWD$@tWЃ^_[]ÐX_=L$TÐUSWVH[5=lE$DD$ChPt]Ƅ$CAljPjx6T9PQWVD$SPM;$DuH^_[]ALÐSWV[|<t$|$ttAG$NPVQ ^_[Í`PQhRguPQhRA뛐USWV[;l$0t$,tt1}tW`PQhRuύPQhR}~$juuPo GtPGUD$P% tEFEMN,$UD$PGONGF^_[]ÐUSWV@[:Mq$F9AFD$D$,jvPWD$PWv1t_D$0jPD$0D$$D$jL$QPD$PD$P/tNjFMAVQ$D$Pt$VD$@t VЃ1e^_[]ÐSWV[9t$u"`ȃPQhMR~$w1Gt P!v$Ft PV^_[Ð+̀ffffj̀rS[49[ÒrS[9[SWV[8|$t$t{WV薕t_GhPV蠣 tIGPVOt8G PV>t'GQjjWPVnu1^_[ÍكPQjGRfكPQjHRgBfffffffUSWVP[ 8t$ D$8Vt$K1;L$$wD$(q D$8 $t*twWt$T$4;4$sc|$(uVD$tcutZD$(PjG NjD$8u(PQ1"D$8ut$6^_[]ÐUSWV[ 7|$t2t$l$VUT$,tt$ u1^_[]ffffffS[î6t$ t$ [ÐUSWV[Å6$$l$t$Mtd$)VD$D$l$PUV p D$$ht$jUI@L$u$1ҸD$D$MEf}T$ twPUV* f}D$9 $D$PU$jo z $k.|$D$D$L$PQ|$WRVy x4D$jPWt$V@ xD$$|$33Ƌ|$+͍D$jPt$t$$ y(;$u Ġ^_[]Nfffffffh̀rS[Ä4[WV^m4D$L$|$T$ :t 0rJJ B^_ÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ A ÐSWV[ì3t$|$O1)rD$OVw P w ^_[SWV[l3t$|$O1)rD$OVPw Ͼ w ^_[ËL$A +AÐVL$Q qt$ Q1)| q Q^Ð1ÐÐ1|$uD$ L$IHÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ Q ÐVL$ T$r1)r rB J ^ÐSWV[ 2|$t$t*tIWVzt\GhWPV Fi3PQjWRuwi3PQjXR1^_[ÐSWV[|1|$t$tt3jWV訖 ^_[Íz3PQjgRuu͍z3PQjhRR묐USWV[0|$l$WUQ1GOhQPUo UPED$wPW3PQjwRzWtV3PQjxRS8i3PQjWR,wi3PQjXRGPl$UύtWU辍^_[]ÐSWV[Ì/|$t$t>t`WVt(truGPVnt WV][1Z3PQhRXu3PQhR2yWVp^_[ÐUSWV[.|$t$tnu"ׄɄ3PQhR WV觌t3oUVt"}uG TjQWPVb1^_[]ÍɄ3PQhRg ukSWV[ .|$t$tt?GG>tP1^_[Í3PQhR u^3PQhR WV觋tGPVtGPV腋tG PVtkWV_[USWV[+-t$|$tmGou" 3PQhR E^3PQh$R q3PQh%R Jo t6tXudGFGF3PQh R: uGFG3Fn<Fn* GFG F   ^_[]fS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffffìrS[*[v̀rS[ä*[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[)|$l$uoXPQj:R t$tu9#bXPQj;Ru7tiFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1USWV4[)$Ll $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP8 ,$$XtY$\tOFl$0PQjUQ/U8$\9ȋ$QU$` FfNQPR$`U$`.1Ʌ9$Fx$P$T)pPURQ.*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LQPR$`$`-l$ 9+ t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$[ۅPQ|$W$`U,t;$Tg$P$T)D$D 1P|$Wt$L$QRR,L$)D$D Pt$t$t$R,L$)D$D Pt$t$t$R+L$)D$D Pt$t$t$R+L$r)D$hD Pt$t$t$Rn+L$9)D$/DPt$t$t$R5+L$)D$DPt$t$t$W+19D$F$PED$1$1[D$ 1D$ۅD$׋D$ tD$ $ 1QPt$t$Uy*H)D$>Ń19t$un 1f$PL$$T)fv fD$ zVQURt$*L$ ;$T$,T$0L$RQPW#t(8W$\9vpD$0Pd;fǍ$0PQhWs)WZ$\9v QW$` %1QW$` D$0PhdFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P[$1111 Ӊڋ6teN tFtI@r8ߋ\$ PQhcRF H1 t1덉\$$\$$\$D$1\$P`l$D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj6D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$#D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$N$l$$L$ L$덄$Pj?L$1;Bu>T$L$T$Btۋ$NF\$$T$jT$ ߋ\$IjjP5 x PX^8L$$Pj`D$1uyxj%$PD$8($'L$8$)L$D$D$P$t$W7$(t$DD$uD$uL$rL$$L$r93|lj$$Pj$$WtGo\$tPb؋\$$$!L$$$PRt$W6T$vu4D$ 8\$$ЋD$ D$87\$t$8MDž}l$$D$ @xuD$ @Džu$ PQhuRD$88tqGPZfD$>PZfD$>PZ f|$fD$L$f"D$<|$h$!VWt$ύ PUhh R腸W>ύ PUhi RWt D$PT^_[]1USWV T$[l$8lD$tjD$@T$4Eu*XՍ PQhRǷD$PPj1F1tU1WWV PQhRztbV PQhRPML$utj<$T$u:D$ PQV1l$8u;fPl$U|l$8u8T$ RQP 1l$8t}1<$;D$ ^_[]ËF<$T$t ;uӉD$ Plt!ljT$4t$@jbtul$8녋D$@9rt$ 1)ƋD$ȃWVP裐^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ lD$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWn ;D$uY ^_[]ÍsgEPQhR,OgEPQhReZffSP[íPt$1Ƀ $ȃ[ÐUSWV$Yxt$8lD$D$ L$81DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RWjP  |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W=u Pt$l$ Uu t l$ /D$D$<F\$hPWt |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURsT$ \$WjRT$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rxs E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$sT$ L$E E$\$l$TU蓎/4$U耎$L$$9sD$DQ_1ɉȃ0^_[]D$D\$4SV[Ít$ u"rnPQh/R蛒V^[ffffffUSWV|[8j$?.1tGljPWzt)l$XD$\|+W. W.1|^_[]jjWjjUjSW.t҃lPD$ l$<$D$ƅuUW뚐USWV [X|$$(rl$ NBCD3EB 3M t91 ^_[]Ë|$,j<.|Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rVus@sщʉѺ u׋ $)jQWjK5F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj4F4~F:F:t1F;pS[Ît$t$[ÐD$@ ÐSWV[\T$|$9W v#wG,ʃt$<u0 Ћ0,L  )r;GvD$Ot$1^_[ÐUSWV[èt$,~$ED$\$Pv(t$Q 9quJ $יD$D$4$ 0t$]D$<$7L$HL$D$ l$ʋD$$$軲$`$ttl$$;%`t %)l$ $D$D$@_t$L D$06vt"l$ $D$D$_t$L D$0ut"l$ $D$D$^t$L D$0ut"l$ $D$D$^t$L D$0vut"l$ $D$D$@^t$L D$06ut"l$ $D$D$^t$L D$0tt"l$ $D$D$]t$L D$0tt"l$ $D$D$]t$L D$0vt$t"l$ $D$D$9]`tL|$4tL$DL$ D$#D$,$tXƁ Ot yI u]D$4$D$4L$@L$ D$,l$$$~虅Ɓ Ot yI u]D$4$D$4L$6.&̓Ǔ^_[ÐSWV[̓|$uƁYjVWu yWPV# ^_[ÐUSWV4[x$lD$0D$IuD$HL$j.QPjzT$PQj.jRx$tEL$PQVJ D.0;D$0u 4^_[]$USWV([ؒt$L$-uAD$QD$ +tD$ +u AD$Q8x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$88D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʋ$y&֍[PQhRdЃ^_[]ÐUSWV[ó}eD$|$D$ D$P JlHHPP0ppp RQWjV譋$r D$ƀe^_[]USWVP[*l$PU~ pQPUft5PUHIPU0;PUBPULPUNjPU$ 1uR8MDHt?Ehj PU脖 *h8u$8 D$/t $ 0<HD$6t8^_[]ÐUSWVP[êl$/PUtxF u6jPU# 1u[8MDHtHCgj PU肕 (g8u $8 6D$t8^_[]fffffffSWV[́|$t$jWFGHO~;G~ t H WR)jWLH^_[ÐSWV[\T$L$Bpr~ ;B~ t 2~: RQȏ^_[ÐSWV[ |$(D$$u$P3D$D$D$D$ jWEG0u ǀD$PW9jWqG^_[ffSWV[|LaHt |Jt| @t |A|?t/t5GtPWu02 E49s%hjQjhRE4M01U0)E41u gE ٖPQjdj$+W4Y9E47>PWu0L2 E49s)\$hjQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$hjQjhRE4M0QU0E4AD$,`/}$D\$u M QU Qqu It$\$QRPVjdj$ +PW\$ 9E4<P$ +Pu00 E49s%hjQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-h\$jQjhR\$E4M0QU0E4A,D$#M }4E0T$WP=;'E }4;E0 E4u)\$hjQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E ٖPL$ Qjdj$+WU9E4:PWu0. E49s%hjQjhRE4M01U0)E41E HM @Pt$ jdj$+WcU9E4f:PWu0{. E49s%hjQjhRE4M01U0)E41E E P E Pt$ jdj$+WT9E49PWu0- E49s)\$hjQjhRE4M01U0)E41M AE  L$<%\$PL$ L$hL$L$*M01U0)E41E E |$\$7%Pt$jdj$+WS9E48ƃD$PWu0- E49s\$jt$jht$,D$(E4pE ;D$8}0L$'T$hT$ L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-h\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru CE ٖPQjdj$+WR9E47PWu0(+ E49s)\$hjQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$זVPjdj$+WEQ9E4H6PWu0]* E49s)\$hjQjhRE4M01U0)E41|$\$E PL$ L$hL$L$*M01U0)E41E E D$\$O\$Pt$jdj$+WeP\$9E4d5PWu0y) E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E SPQjdj$+WO9E44PWu0( E49s)\$hjQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0Q! E49s)\$hjQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-h\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$hjQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$PQjdj$+P;F9E4:+Ƌ\$P$ +Pu0H E49s)\$hjQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$hL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$tDD$Q|$XWu u$E? E4u0} PVu,WI**E L$))|$1ҋ\$ɴL$L$ hL$L$$+р਀tsRPt$ jdjVdD9E4g)PQu0z E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$ |$X\$PVQj2jWC\$9E4(PWu0 E49s%hjQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$hjQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$hjQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$hjQjhRE4M0QU0E4AE MU \$VWu,P}$E ٖPL$ Qjdj$+W}A9E4&PWu0 E49s%hjQjhRE4M01U0)E41E HM @Pt$ jdj$+WA9E4&PWu0 E49s)\$hjQjhRE4M01U0)E41E E ;D$%L$PT$T$ hT$L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+W!@9E4$%PWu09 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-h\$jQjhR\$E4M0QU0E4Au wE PPL$ Qjdj$+W*?9E4-$PWu0B E49s%hjQjhRE4M01U0)E41u E P,Pt$ jdj$+W>9E4#PWu0 E49s%hjQjhRE4M01U0)E41u RE E P=E E P(E PWVQjdj$ +P=}$u E E PE E PE T$XPWVQj2jR=9E4"PWu0 E49s%hjQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu Wr9E4!PWu0  E49s)\$hjQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0  E49d\$hjQjhRE46z3D$E4D$W\$PL$D$L$hL$L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$'\$9E4Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0O  E491\$jt$ jht$(D$(E4  PL$D$L$hL$L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$\$9E4mPt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E49-\$jt$ jht$(D$(E4\$0}4E0)E4u)\$hjQjhRE4M0QU0E4AC}$n }$bٖPL$ Qjdj$+W 19E4PWu0#  E49s%hjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0  E49s%hjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0+  E49s)\$hjQjhRE4M01U0)E41M AE I T$ }4\$E0.E4u)\$hjQjhRE4M0QU0E4A g}4+E0-E4u)\$hjQjhRE4M0QU0E4A}3}4E0 E4u)\$hjQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7p$+t$p$ +f@======2|$7p$+2z4|$7p$ +r|$7p$ +rz t$>p$ +rz4w|$7p$ +r|$7p$ +rz4|$7p$+Rt$p$+2|$7p$+2z4|$7p$ +r|$7p$ +Rt$p$ +DŽ$ +====2|$7p$+2z4|$7p$ +r|$7p$ +rz t$>p$ +Rt$Vp$ +Ƅ$+=fDŽ$ +==2|$7p$+2z4|$7p$ +r|$7p$ +rz t$>p$ +rz4w|$7p$ +r|$7p$ +Rt$p$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$PL$D$L$hL$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$\$9E4(Pt$u0: E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$0\$jPjdj$+P(\$9E4 P$ +P|$ \$ D$PD$D$D$L$hL$D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$9E4M Pt$u0_ E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$hjQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u E M4 U0B  ru0M4B\$QVPb"  ƋM49s)\$hjQjhRE4M0L$M0)D$E4z|$)D$L$hL$ \$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P袨ɴPQjdj$+W6%9E49 PWu0N E49s)\$hjQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj}0WƋE49s,\$hjQjhRE4}0}0)E4E \$u4u0Pj薇}0WƋE49s,\$hjQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$hjQjhRE4M0QU0E4AD$,w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$PD$D$D$L$hL$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$~9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$hjQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u uE M4MU0B  ru0M4B\$QVP (ƋM49s)\$hjQjhRE4M0L$M0)D$E4|$t)D$L$hL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$hjQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u ȮE M4U0B  ru0M4B\$QVP  {ƋM49s)\$hjQjhRE4M0L$M0)D$E4|$)D$L$hL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$hjQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u E M4U0B  ru0M4B\$QVP[ ƋE49s)\$hjQjhRE4M0M0)E4sf )E4w)\$hjQjhRE4M0QU0E4AE4D$E0D$|$)D$L$hL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$hjQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$,D$,;$p+u ȍe^_[]Ë\$USWV [4t$,|$(D$ .ʋ7l$Ut$Vt$40RQ‹L$$7>tVt2$QW)$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sD$D$s@(D$ 9s$hjQjhR)))y"PHPQhR ^_[]1))lj$USWV Չ $[3T$8D$4 D$L$D$"u$hjQjhR|$4QA$93<$779$xDD$D$hD$ D$0t$4QEAt$jPt$ E tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$hjQjhRMQUA+<$-D$4L$D$ ^_[]ffffY0T$4D$#ъLÐUSWV[Û0|$ l$t$~Jt$~2UVAx(ƃ|$tލF9wȉ9v=(+t$^_[]ÐUSWVP[ 0|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }(^_[]E ffGftC,$RW'xǃ9w,$)xD$ hHGftf,$RWՠf 8 9Xσ95,$)5|$ oGwtc,$RWc 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [È-|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$U蟞x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0QuuÝ]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[*|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.q^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu۩U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0 (LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XX(\$1ɐ\ \\ \\ \\ 9u΅t1Ґ9uT$r;t$@L$\$Љ\$0 $ @L$L$L$|$ |$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄S|$ t;|$$sF* $D$  8t(y"wPQhZR,^_[]ÍwPQhR|$ LwPQhR%ED$Urt$mu-T$ҋt$ tT$Di@tRjuYt$ tDi@D* ;|$$L$ <9=jfffffffUSWV["D$$L$1wt|$ u ["0~&PUWVt$(t$(QR- X_"L$uÐX/"L$wt1USWV["|$0t$,1>0N xN|$|$4~D$ 8D$lj<wsGuL1Fщ$T$T$$l$TUT$t& $LQщ$T$,$TjT$$D$1պ r $?TWT$T$Dz$ʍF$и rL$ʋD$T$ <$tpD$ЉT$ ;T$4OXyAPQj>R[yAPQj?Rd7D$ ^_[]ÉUSWVP[t$ 6ǃ|$uAPQjgRD$u f0x=|V4$~b1 9tJ|$,00r7 $ r7zB؃u9}B.벉$^_[]fXÐS[ht$ P [ffffÐ1ÐXu ffffffUSWVX[Èl$ll$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn%L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ %T$"jDPQj2jRCǃ9WD$"Pt$ t$VPt$t$)T$ D$@L$)L$tOT$ %|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p8 txҋ9|Wy>TWPڋD$+D$py(ffffUSWV[kl$U覹ƃ;D$vS(`|$UW+1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[$l$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]ffSVP[,L$t$D$T$ $xRQVP1!x9r豬RQP艩 ^[USWV[|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[[|$t$l$tt$$PW%t/^_[]VW t W LJWVUF ͐SWV[t$|$jW1Ƀ PVW ^_[ÐUSWV[Û|$tt$O#PW$tw0l$VW/ t WRLJWVUM ^_[]ÐSWV[t$t5|$r#u#jV#tjV$F1^_[S[þD$tL$ ttu H1[[ÐSWV[lt$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[t$tAjVq"t2|$jV"wsf~ 1^_[ffS[nL$T$ HP[ÐUSWVT$0L$@[(uD$\V*D$ PMǃ\$D$t6=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$|$D$D$D$\$$|$,Vt$8PQRWYǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\j$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$(LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$(L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$;t$,PVD D$,\$wPVuD$,D$$\$L|AɋT$0tD$()0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$( $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$,! t $ݔ$h$lD$U D$؋\$t$t$L$T$ t$[ffffff̀ffff̀rS[[̀rS[[̀rS[ô[̀rS[Ô[USWV[x|$l$ ED$t@U衘D$t#:D$ut$UW# u1^_[]fffffUSWV[|$l$URWG9U6W%M;OuLtF&t;tu5t;tu+t;tu!tf;tutf;4u u1^_[]ÍPQjCRPQjDR4PQjERS[D$<QjpPZ[ÐSWV[üt$V'uE|$WuO;r$vtuO9Nr w1^_[ÍrWPQjeRWPQjfRSV[t$t$ u1 ^[ÐUSWVZt$0~: $D$D$D$D$D$ D$1$ ك˃>ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[n|$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[ÌD$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[D$ L$t9u[ÍPQjpRiS[D$ #L$t9u[ÍPQjpRD$t&L$tu1u 1tÐS[>L$ D$Qss)ǀ[Ãuu ǀ[ÍPQjpReS[D$tL$ t 1[[ffUSWV[Ëj 蛼1tQ@@jjPh V(O8tE(W5(^_[]ÐSWVP[ |$ubZ"PQjZROGQ9u0$jQPh 08t  G $GT$pw1^_[ÐSWV[lt$tRtC|$t3~t-0~r4;~rPV^_[ÐUSWVP[t$u"bm"PQhRF$t(.1tt$Vt 9<$u1^_[]ÐUSWVP[zT$J $Ћ*1|t$WBt94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|L$T$ HPt$ [ÐUSWV(T$XD$D$vy uy P:t&D$j.PWV$"tl$tv$y D$PvL$QRPD$PWU: $t!Q"l$|$TG )|$TW4$l$tNjM;L$ l$D$9r\$VpDfD$BFP_DǍFPQD΃ 931fT$Bf"D$+<|$l$H\$h$+Pt$Wt$uYt$DXe=9ƋD$L$0)9%\$Qt$HPe D$$LΉD$ꋄ$H@ tՍT$\$t$0D$D$l$ )ՃL$0)9sыt$FF\$URPV Vl$l$$T$<)ƒ\$0)19s>Q辠!1$X;$(uH,^_[]Ë$LiRPUτ 1ɋ$L뽉&F|$;\$OW:USWVT[Å$h>L$u&IՍPQh^R舤Wt1T$ T$G j(.¸RD$D$ D$$D$'$1ɉ|$ D$ L$Pt$ V^cǃt$Vt$  t5ꐐ< t쐐D$D$ t$h < t< tPWbt1ɀ8 L$ D$1ɉL$L$ t WPtT$$9s9ȉ86(Pt$T$$Ϙ D$ + $$ȍQ8D$H|$|$ D$Ɛ wL$ $l$9r4T$(PL$Q>s l$T$+$‰$2t$ VaAƃL$sD$!D$$D$#D$ #$hL$$h|$ ?$nL$<)N)‹D$ L$HJL$)T$L$ωx|$t$tjD$B 19wz $PQW L$ A<0A )Ń9t$uыT$ B#P藜bL$$h|$ :ȋL$D$P`ƃ)s4$h$PGF 衦1T^_[]ËD$D$Vt$ Wh D$ 8|$tsD$D$wD$1ɐ$L$D$Pl_ƃ)ZVt$W D$ @L$<9L$ut$ FL$4$p8$h$hL$USWV [Øt$(|$ u"!PQh R裟.vy uy P"y t$t/"$U`^L$QRPUVW6" $tQ葚|$ G .T$|$ W74$_uǸ ^_[]ÐUSWV[Ët$|$l$4y y Ph@QRUWV#^_[]ÐSV[=t$ 4y y Ph@QRV^[ÐUSWV[{4dt6ƋT$L$y y Wh@PUVLVq1^_[]ÐSWV[Ì07uW?7tXǃy ǃy ǃy ǃy ǃy y 3y Ph@QWV^_[31퐐USWV։[tt<|$0t^؜ǜPQh`RܜučǜPQhaR趜|$0u%ǜPQhbR荜! GG ?.D$ D$$D$t$JD$FFD$F t$..L$0))9|h)ƃ1t u/t$ t$hMt$ D$ 薛D$ gt$t$hNt$ oE^_[]fffUSWV4[l$PlD$0|$LuD PQjIR t$Ht*tIL$L;L$0D PQjJR蹚ut$Lu"Z PQhR芚|$u"Z PQhR`D$,D$(D$$D$ 1ɄE<:u~:7t$LL$ $t$ ~D$KL$\L$1D$jD$Pt$$Vy ujt$t$ Vy t*Yt$) Ɖt$u1ɀ|$:/tA?z$L$09ȹcT$f $f1$|$ D$1|$ |$$D$t$۞/t$$p1ɍD$09L$f$f4$|$D$09tu+D$T$ҹt:lj1ҐD/DD.D9u߹)щtR)ȋt$NJT$ )ʈB>81X|$.uQ$rD$09wCL$ V1ɅL.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0u ȃ4^_[]AJUSWV։[Ä_~8LZu 1^_[]É4$t$0t$u'_ t E<)׋$$x`<$1L$D$ D$}T$uUPo$T$E ulD$;tM RE=t܉t$L$0QPut$ T$ u#D$8=u$ELM D$|$uIt$MtȍL$0QPuL$t$6$D$$ʉD$|$ T$,t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$$D$ u?tUPuTE)΋M0E0D$D$ L$$tCE<)‰T$Ή4$MuT$$M8t$ ))ʉT$M< $+4$T$uED$ ))t$$M $D$ E L$,T$+T$T$($2T$9T$}oD$ L$(ȉE)΋L$$T$ y*ʝPQhRvD$uE@9tR踆D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQ\D$e ߋD$)D$U融u E;D$UitjUErĬ^_[]Wt$t$$uT$ !ƒtˋE0tU@9t QDžE0EEEe jUq1뙋t$u)y'ʝPQhR E)EfffffffUSWV [èt$@|$4\$um>FD$FD$jt$84o1D$ D$t$<\$tj D$Pt$< ŅD$\$1Ʌtr|$~l\$ +tX9\$8utAp9r:1Ґ8uʃ9s뾐u.1%)D$ L$ÊD$t$t@uHFWVP=<˞PQhR裂u뙸FWV1^_[ÐSWV[<|$t$tCu"RF˞PQhRBt>t@uHFWVP=F˞PQhRu뙸FWV1^_[ÐUSWVP[Ú|$l$tRu"|^˞PQhR蠁Et`tBuU$EQUPA^˞PQhRRu늋EQUt$1^_[]ÐUSWVP[ڡ|$l$tRu"zk˞PQh&REt`tBuU$EQUPAk˞PQh%R蒀u늋EQUt$1^_[]ÐUSWVP[|$l$tSu"˞PQhFR EtctCuX$EQUPC˞PQhERu뉋EQUt $f1^_[]ÐUSWVP[Z|$l$tSu"˞PQheR`EtctCuX$EQUPC˞PQhdRu뉋EQUt $f1^_[]ÐUSWVP[Ú|$l$tSu"Ο˞PQhR~EtctCuX$EQUPC˞PQhRQ~u뉋EQUt $f1^_[]ÐUSWVP[ڞ|$l$tSu"̟˞PQhR}EtctCuX$EQUPC˞PQhR}u뉋EQUt $f1^_[]ÐUSWVP[t$|$txu"qޟ˞PQhR }u&͍˞PQhR|tJt]uaGQWtQ $Cޟ˞PQhR|ua $G͉QWPt 1^_[]ÐUSWVP[*t$|$txu"q˞PQhR0|u&͍&˞PQhR|tJt]uaGQWtQ $C˞PQhR{ua $G͉QWPt 1^_[]ÐUSWVP[:|$l$tXu"^˞PQhR@{EtltHua1?$EQUPG˞PQhRzu넋EQUt 1<$1^_[]ÐUSWVP[j|$l$tRu"%˞PQh RpzEt`tBuU$EQUPA˞PQhR"zu늋EQUt$1^_[]ÐUSWV[ë|$T$u&֍˞PQh*RyL$u*qՍ˞PQh0RxyL$(t )ŋt1tXuQBWQRP t?t=G UQWP%BWQRP ttGpUQWP 1^_[]ÐUSWV [èt$$l$ u"˞PQh^Rx|$(tTtv6EEEL$QU/D$˞PQh_R4xu+˞PQh`Rxc&˞PQhRwK1&˞PQhRw$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$Uj ǀ|$tB}u.u^[ÐS[Nt$t$t$t$t$J[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[ފD$t$ P[ÐS[ît$[ÐS[Ît$Z[ffYo|ÐXOL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXȉ$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$YPQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$tw;t$b\Gn߃^rxo;l$1\,, $*`wkdT$Ɖ*t$i $*`wi (Ћ4$`Wm;|$Yȃ|$ U(!Ћ$YPQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$k(^_[]Ë$~kᐐS[^jt$t$t$[ÐUSWV([(|$@t$ րt9@A1!tfY;L$,sf?1 ֋|$ 9}PT$yL$ʋL$(,$9}4,$T$Ήe,8;l$s 49;t$,$c(^_[]D$D$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ `0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[ÞtL$T$ HPt$ [ÐUSWVT$[btɉ$u&Tښ$PQj?RqS\$t$4|$ |$0t;D$0|$ "v+Y1T$$VPGu+t-u#D$D$t$0tDD$t$0u20u- ;ǃ ǃ 譢$0@ tQj P D$HL$L0 , t$t$eĔ^_[]ÐS[`D$ L$01b_[ÐSWV[_|$t$wv6u 76_^_[fff̀rS[Ô_[USWV[x_|$ tD$D$l$$Ht$L$T$(PVUWt$<9t1D $+t$ !D"1^_[]ÐUSWVP[^t$C8$l$ L$T$$t$,PUVt$8=9tC8+t$ C"1^_[]ÐUSWVtՉL$^b^$lD$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$l u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$( l$$IʉЃ|$ g$ V L$ \$فt$DPQ$j Vb$99u\$k $@ D$( $@  D$( l$$hQkd)<4 kd(  $l$ \$#n\$,nD$\$t$D$qP$j Va$99u$H*R )tȋL$ \$فt$DPQ$j V a$9<#9uD$\$t$D$qP$j V`$99u\$;D$\$t$D$1P$j V1`$9cS9uB\$5n$H+HA$I ȋL$ \$فt$DPQ$j V_$99u$@t)$p$IЃȋL$ \$فt$DPQ$j V_$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$;D$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$( D$DD$D$\$t$D$q P$j VH]$9zc9uRD$\$t$D$q P$j V\$99u$@L$ \$فt$DPQ$j Vz\$99uD$\$t$D$qP$j V\$9A39u"$H*R )tȋL$ \$فt$DPQ$j V[$99u$@L$ \$فt$DPQ$j V[$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$t$.RPQjVY$9)9u$9 9$Htȋ\$]t$DPQ$j VgY$99ur\$L$$$Wt$ $ƒ8\$]t$D$qP$j VX$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP!ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$t$DRP$j VT$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $t$DRP$j VT $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $|$DRP$j WR $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$t$DRP$j V?R$9qc9uRHx1t$DQP$j VQ$99u $L$ 1t$DQP$j VQ$99u $\$1ƍ|$DVP$j W$Q$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7~85\$]\$$-L$ $<$\$t9u4$<$Ήƺųʉ kdk<)΍\$VP$j t$TVO$$99u<$D$ ;D$pu t^_[]Ë\$IUSWV [ÈGt$ 0D$P)T8d,$D$l$$Ht$׋T$(PVUWt$<9t, $) ,"1t$ ^_[]ÐUSWV [Ft$ 0D$PyT8+$D$l$$D$T$(t$0PUVt$<9tt+ $) f+"1t$ ^_[]ffffUSWVP[*FL$y~X$T$GsY11t5iFs5D$hFdNt$ t3;-00tB׋L$!Ɖȅt<$~81퍻 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[^?t$[ÐS[>?t$jt$t$[ÐUSWV8[?M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$*)L$ *11uj+K H(;\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}q`1ɋU+dF$ GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$!1kD$ \$uuPV_tML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[;t$0W衾\sPXT< QjV0Wf^_[ÐUSWV[Ë;l$t$0W,l u\sPTUjV0)W^_[]ÐUSWV[;|$t$0U輽p uƃp U製1Wj(t H(^_[]ÐSV[í:t$L$t$j'tt H(^[ÐSWV[\:t$0Wp uƃp W< 1PjC't H(^_[ÐUSWV[9t$|$0U茼p uƃp Us< Pj&tt H(^_[]ÐUSWV[k9t$|$0U p uƃp Ut$jQ&tt H(^_[]USWV[8t$0U蠻\sPWTt jP.Uhp uƃp UOLjjƉU.^_[]ÐSWV[\8t$D$t jP40Wp uƃp WӺLjj/^_[ÐSWV[7t$D$tF t jP40Wqp uƃp WXLjj^_[ÐS[n7D$t@ PN[ÐUSWV[;7t$tF |$0Uѹp uƃp U踹LWj^_[]ÐUSWV,[6lD$$$(=ΉT$y |F D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ* G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽^8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ USWV4[3L$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(0V=p uƃp V$lD$|$LL$jWjj'|$uL$jWjj~'|$t1ՉNjt$0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[j20$Pl u\sPl$|$Tt?BR lP~;yQq|1)͋$P蒴^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[/0U蔲l u\sPlB|$t$TtWVP ƉUI^_[]ÐUSWV[c/lD$D$fBt π?:t W?:u$,?/4$\$u(\$jW=\$ W3?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pt59tx/ux.uHt/uэ|$H4$$," 4$\$h@W5ǍD$HhPWب +&y \$0\$WҩD$(WgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$ƋD$ƃ1H4$D$ L$T$kT$ D$ L$N19FD$ D$F n|..>:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$USWV։[!!tK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR7 $Ec\$٢jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$iQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$D1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ81i4Q9uB ^_[]ÐUSWV0T$ $XD$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$G)jhUt$ 1T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$L$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPY)jhUt$CU\$sT1ڽT$\$jjdUR)jhUt$t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$8|$ 9|ځ<1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4X D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjRhPV|1訮ht$t$ o x=|PofF FfFfn vtF$F,F(F $tjjjV葿^_[]fSWV[l|$usjPQj;R}jWw jW^_[ffSWV[ |$WG;D$w+t$9w 9w9w 9wPWVɱ ^_[{fffffSV[íD$;D$wt$ Pt$V~ ^[<VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[d[USWV[Kt$usۥPQjL$0ȁ1ҍ$X1 D$xT$|$t$8$u $\QwPƒ.D$ƒ;T$0v$D$8MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$0D$$xD$0|$\uƄ$/D$(t$P0\$WrD$(L+D$L PD$L$W n|$ptD$'-D$D$\=\$4u#D$(8NT$ L$Lu]|$`o$6mD$@T$ L$߃GD$DufЉڋL$dtL$0\$@|B9\$0|<)y1ɉL$0i|$`$$>$2D$8D$' L$0ӋT$L$Lt $0|$@Љڃ\$@م D$0tD$0ȉD$|$X|$@2|$XC9D$@9D$T1ҐT$H11ҀD$D$t\$@)D$‹D$HЉD$L$T\$@9$:D$8D$%D$D$@D$HD$TD$D1)+$1 \$Ѻgfff)À0D$,L$ I<ϋD$, L$ IϋD$,L$ ID$,L$ IEHMPwEHMPEHMP1D$,L$ IEHMvEHM1D$ y1۸D$'-‰D$D$t$X1 D$t$u RjPj1Ƀ,EHMT$|$PH8T$T$ ϋD$,L$ IϋD$,L$ I D$,L$ I8EHMEHMEHM8EHMT$L$PT$T$ JEHM1qEHM1wEHM1:EHMD$D$H$Q)tO‹D$D$t1 $X׍D$tu $\Qt$ PR;t WY1ɉL$8L$(ɋU$|$0x<$|$0Wjt$@– |$\$4T$ tW+D$8L$0L$9GD$A$t$8uD$y"BPQh&Rc\$4T$ D$D$'1D$@D$HD$T1EHM1D$EHM1D$ 1GEHM8EHM1D$EHM1D$ D$EHM1aEHMD$ ɉyD$'-11D$sEHM0EHM7EHM811ҋL$t! t L$t D$$/D$ȉD$'|$0x% D$tRD$@ uT|$0uM$|$$|$@|$D$@D$?% T$0t9\$UρD$? ٍ$$t$XPWt$ t$PQ$|$\$uM$t=\$|$T$?T$D$$t$Xt$HWt$ Pt$0(.Ǎ$|$8)D$e!D$1D$@D$HD$TD$D$D|$0\$4T$ |$ ;|$D$|$'$/L$Lt)L$\$PD$D%D$\$4|$L$ \$׋$GÉ\$L$ [Uu/$sc$PQhRϲU\$ۋ|$.$D$PR[D$D$ $0|$'sG >$B\$L$ rʋUu/$sc$PQhRU\$1ۅt<$D$PR螋1ۃD$D$ $Xg1ɍ$E|$|$'u5|$|$'u D$ $|$'txD$'BL$ D$D$L$ rHUi$D$PR׊D$D$ $t $/Ƅ$.0$.BL$ D$D$L$ rLU6e$D$PRKD$D$ $t|$OGL$ \$׋$(GÉ\$L$ <Eu/$sc$PQhRE\$ۋ|$$L$QP~D$D$ $2G K$(B\$L$ rʋUu/$sc$PQhR>U\$1ۅt<$D$PRΈ1ۃD$D$ $X1ɍ$E|$$sc$PQhR诮UD$hD$ $$/$sc$PQhRVUD$D$ $|$D$ $D$ +D$L$ |$|$ljЋ]D$G $(BD$D$L$ r‰څu/$sc$PQhRwUD$D$t=$D$PR]D$D$ $P1ɍ$;T$ $(\$ T$ B|$lj|$L$ E$L$QPgD$D$ $L$4D$0|$D$DD$8D$BD$ÉD$D$ D$ EL$4D$0D$Dus뚐F$sc$PQhR֫EL$D$ $L$4D$0|$D$D)|$L׃UD$DD$8GT$ D$ÉD$T$ Uu3$sc$PQhRL$DU\$D$ۋ|$ $D$PR蛄D$D$ $L$4D$`B|$\I׋D$(L$dȉD$L+D$8L$@9ɋ]D$8OD$ȉD$L$ L$ څu/$sc$PQhR+UD$$D$PR軃]D$D$ $vD$8$XD$x$Y$XG\$ L$L$\$ +u/$sc$PQhRmUL$1ۅ~$D$PR1ۃD$D$ $P$sc$PQhRL$DE\$IL$M $؃L$GÉsT$D$`|$[D$0$(D$BЋT$ L$L$L$T$ Eu3$sc$PQhREL$L$|$C$L$QP聁D$D$ 1D$$L$ "'1ND$щЉډÐT$$ 0\$T$T$|$D1ҿ;|$|$DڋT$rÃ|$@B<0:|$D0.D$LD$҉|$8^ $ 1ۍ$D$`1ɍ$D$8T$dBGLL$CD$ Eu/$sc$PQhR{EL$D$ɋ|$tT$L$QPD$D$ D$ $L$4t/D$L$ L$4|$D$ $L$4D$0+D$dуNj]ʋL$ D$G $(BL$D$D$ r‰څu/$sc$PQhRgUL$1ɅtB$D$PR~]D$D$ D$$1ɅOD$$4D$`\$ ]ʋL$ ϋ $( B|$L$GD$ څu/$sc$PQhR萤UL$D$ɋ|$tU$D$PR~D$D$ $D$`L$4t-D$D$`ˋL$4|$1ۍ$D$`L$4É\$ \$\$CD$ $0D$`BEu7$sc$PQhR趣L$DET$T$ |$ U $L$QP;}D$D$ $L$45 ( D$ $|$@)L$ D$D$׋$(G|$lj|$L$ REu/$sc$PQhRƢEL$$L$QPV|D$D$ $ D$G 9$(BD$D$L$ r‰څu/$sc$PQhRUD$D$t=$D$PR{]D$D$ $PK1ɍ$;D$ 1D$$D$ D$D D$0u ыT$ D$x|$ GD$D$JL$ rEu/$sc$PQhREL$$L$QPzD$D$ 1D$$kKD$XD$ $D$@D$8|$XT$ t0D$Tƒ|$H|$8D$L9wD$8D$X]D$D D$0T$ u1D$x$X$XBL$ D$D$L$ Zڅu/$sc$PQhR֟UD$7$D$PRfy]D$D$ $|$0 L$ |$|$|$8|$8T$D$TuD$XUD$?|$ GD$D$L$ ruu/$sc$PQhRUD$tG$D$PRxD$D$ D$$t'i D$D$ D$1ɍ$D$L+D$8T$X9ÅۉD$8ZD$\$ ؉D$D$AD$ UҋD$u/$sc$PQhR&UD$tM$D$PRwD$D$ D$$\$ t-} 1$D$ D$1ɍ$\$ D$X8)׋$(G|$lj|$L$ NEu/$sc$PQhR8EL$$L$QPvD$D$ 1D$$r D$G 7$(BD$D$L$ r‹Uu/$sc$PQhRvUD$D$t:$D$PRvD$D$ $R1ɍ$?D$D$ 1D$$T$ T$҃\$H)ӃT$T)‹D$X|$8ljЅ‰\$H<47|$0ߋ$jj RWA )ˀ0$D$$ËD$XD$H(|$@ ߉ىËT$DML$ߋ$jj T$HRW`T$D )ـ0|$OL$Y|$|$8|$tL$H t9ϋ|$@uу rL$L\$KL$HytL$H\$D$AD$ $|$0D$ 1D$$D$\x Ћ]T$ ߃]T$ D$G D$BD$D$L$ rljڅu/$sc$PQhRʙUD$D$t=$D$PRVs]D$D$ $U1ɍ$@]T$ |$:B|$lj|$|$AD$ ryڅۋ|$0D$u/$sc$PQhRUD$$D$PRr]D$D$ $t Y|$0|$\D$(L$d+D$8|$09DžD$8zD$D$L$ L$ rqڅu/$sc$PQhRGUD$t=$D$PRq]D$D$ $t1D$ $D$0)L$ |$|$D$G $(BD$D$L$ r‰څu/$sc$PQhRWUD$D$t=$D$PRp]D$D$ $P1ɍ$;׋$(G|$lj|$L$ rwE|$u/$sc$PQhR蘖EL$tB$L$QP,pD$D$ $L$4t*L$4|$L$4D$ $D$DT$ L$ |$T$ \$C D$$B|$L$ rċUu/$sc$PQhR蘕U|$1t:$D$PR(oD$D$ $T1ɍ$A|$UuS0T$ Ӌ$Clj|$L$ UrҋL$4L$4u:$sc$PQhR詔L$DU|$$D$PR6nL$L$DU|$t<$D$PRmL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PqE|$8E|$8|1 uT t$ 9wS$w닔pwl$Pmt t$T l$PU\ / U| 룋$L$19u $P;<^_[]þUSWVP[xD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$҆USWV [&D$ 069rljT$D$uj$jWPH (9$T$JHJHJHJHJ H JH RPE$jWP 舉(聉8t!w0t$d0*)4$PjV腅 $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }ljujD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjPp )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]USWV׉[Gl$YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[3m|$hE t$p |$<$ MM$U ljujl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjP蔀 )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]I~ffffUSWV[ÐE\$t*\$4w=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$ljuL$tyD$0D$lD$ $D$T$D$\$]uNjD$L$ttW% ?L$@\$D$4\$uj؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖw(v؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wHD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃ(D$u[j؉( ʃrx,vRt ,q t.,vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋d|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$(D|$<ػ<|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$dM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋d|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bكd|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃Z D$1e^_[]ÉL$D$4|$ \$D$0L$T$tWjt$`L$¸tQT$Rbu d$|$ \$T$~0vt@L$(t$$D$4|$0thjt$`¸ҋL$"QT$RaD$ |$9t$D$ 1|$ \$T$N|$9u@F9L$|$ \$T$@<9uF9uL$1nFd|$,D$|$ 0|$0t!|$9tD$ 1F|$ \$T$)|$ \$T$L$NfffffUSWV[Ø|$ t$nD$.t>L$$t6 ruLQUY^$t?$L$Uc$1)nL$^_[]þT n0ffffUSWV[t$|$l$t?xʦyPQj5Rgu1 1 ^_[]fffVL$T$ tu1 ^Á1 ^fffffUSWV[M1ЃωT$(ЃM$U `E81!|1 Ƀ9|$$PKT\$^‹ED$}D$,1 7L2 79vސ|u; uB1Flj<uj)B$tW\$R&SD$PVD$ ,RL$ )M ~D$$Pt$ VL$ P_T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VSM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$w(v3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmtD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك||$tT$L$؃ݜ$$$$$݄$(D|$@ػ|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋d|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtK+D$HD$T$,‹|$LD$~$RQOt,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$Q2QT$|$t$$$Y|$D~RD$T$ L$$jjt$H D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PRNDž~#T$?؋L$؃T$$jj QG |$@c΋$jj t$G ‹D$8 |$Dt$$$/L$|$D$D$t$QfFD$ t.L$t9t$QFFD$$P6FT$%T$$1|$D$Ȁy0ItL$RFL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wDO L$O ‰D$ t$QR6 jt$MM|$D$ D$$t$|$ W_D$,t$WnNt$ t$Nt$t$,k$jj PE ljD$ D$L$L$D$D$QPƉ|$Wt$ Mt$ t$GNt$,N0L$ x $tPrDL$(T$D:Pt$ MVIDT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QD D$jj t$D NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VD D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$KL$ |$$F|$$t$t$ Z0D$ t$(Vt$bKt$t$z|$D$ jj QB D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPI\$ht$D$ PJugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ HD$I$t$t$ ID$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[m-S[mfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffUSWV[;lt$|$uRPQj?RHK1tt (h1^_[]ÐUSWV[ph}uuuU\$D$4PD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$(Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$,ΉD$|D$|PH/)ƃ16(T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$()1.%+D$9Y+D$ىދ\$( ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$(L$@\$@1) L$,A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$(D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$,D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ;t$(PV'T$4D$(wPV'uD$(D$D$ L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQj D$p '3 |$4t$N  D$0P QVR, t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP/ 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}"P"L$D$ffffUSWVt$F98[Í7 |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[ã6u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[û5t$D$T$<n~,D$9r9s#L$9w)QjP ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX4@0@4f@8@af@e@Af@EfffffffUSWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ì3D$H~( 1u 9r1$PƉ^[fUSWV[K3L$?tPc w t{ ?u1>P ƅD$t/Fn?tPFF ^_[]1?tPس@| )ʉʁ oΉ@oUSWV[K2t$tbF!r V O}t3WM}F  tW+  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[81l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&U E!r\U 1}$P}T$,B ti4$հ\}th$P賰1}F  t14$荰$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[Î.j,tL$H@[ÐUSWV$[X.D$9| 9}T$P7P|$, $r0wD$PjRe  $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU 9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [%E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[#$t|11 NPQjERP$1jjU- ʼn$tƒ9tut)D$P$ts#D$ =uXtZfx $tu f~ $fFvtF$F,F(F OĀ^_[]fffffS[î!t$t$jt$[fffffSWV[|!|$usZVPQj=RjWGHO~ H0 WjW^_[ÐSV[ t$ usVPQjIRFHN~ H VL^[fffUSWV[Û t$u֨ͨPQj>Ratrt!w 11ҊNt\tGɍyw@ؐ+u˽뿁뷁 ՋL$) 1^_[]fSWV[ì|$f jWRG0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:sPQj8Rf  ^_[f̀rS[t[SV[]t$ usT PQj;RnF0u ǀVuFH^[SWV[|$us\PQjJR8uGG Ⱦ uuL O @G0taW@9t QG0GG81t&WG GGfG u WG t' V襟PV荟GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐSV[mt$ us\PQj;R~F Ш u V1^[fSWV[t$t1mT$ |$L$D$t#t8uӉ6@VRQWP@26@VRQWP}6@VRQWPL^_[ÐXL$AA A AAAÐfffffUSWV[5$u$hj1$džt.%u%D$PQ1t+8$u!8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP2$ t;$PQ~|$=|F P/$FEt$P$FV EtF4Et UMtЅBt N&tEu hVΓ VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCOUJ(1V8(1^_[]14dž$j$"tJpH,HH H ,HHH88oUSWVՉ[ÄjqNlj1&NL$jP$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u1K8"=8^_[]ÐUSWV[ 4jQ@# t 81t>0prPt>ot u8~)1 9}8tQ݋t P<Vt781^_[]ÐSWV[ |$tOW^_[ÐSV[D$ p|$s t.jt$ 1dž,dž,^[S[^L$tAt[A[ÐSV[D$ p|$tdž,1t$t$ ^[ÐSV[D$L$ qtdž,&t 1҃ƒt$t$^[vdž,빐USWV[HL$(D$x)$xuLJ$LJ(LJ 11t f} t2nD$(tE9(G($19wJjjWQ}Ɖ鉅 hf}u A(9vA($9(LJ(u$kPQhR31(f|Eu;DEjVPWQ ƋhLJ(f}tf}LJ $^PQhR1jAf|E@u(9LJ $LJ( LJ,^_[]Ë(L}w*jt$(t$(VR薧u‰w$ trT}t$t$ r|})ǁ$w<$_ t)׋t$ ~t$΋|$$7)ʉW $(15SWV[ |$t^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[Ø |$(o(o(OG0!D$;G9} $wD$D$ P]$L$L$D$QPt$蝘 $L$QjPH t$$D$ Gjw $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$W  ^_[]ÐSV[] t$ t$t$ #F,;F(~#F0^[ÐSWV[ 4aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nt`=u| .(H9u. $; u#|)D$(t$< i)Ng1$dž dž(&fffUSWV[u$twD$(AD$$Q yAqi<$t! $ $D$ D$(D$$D$$D$(h$sh$jP LJLJD$LJj$tG$tLJ xppp p Ppp@D$p$ƃt T$0R$PQ++~(L$ utu T$Mu~D$0PQ $ $tbL$ jQP} nD$ =b1 !FT$ $u!$wr |$(u LJLJ ΍AT$$tt!ʃ1ҍ 9r1҉$F1t$=r,6,ƍUQh)Rrf4$Vjt$- uWQRPjjPI dfxu8u fx7jP7 $ t!@@t!" T$ L$ d$D$D$L$ȉD$ɉL$D$ȉD$D$ȉD$D$ ȉD$ |$ b1u*|$u#L$=wȃu D$ _tEoOGt Pt P8|W1Ĭ^_[] D$D$P7x8ut$,jV7臰 $`jV7o K|$,@@@f@ŋfEE Pjt$V jV72 jU7% t$SV[-D$ pFtjP6 F u^[ffffffUSWVP[t$$D$hEtjPu肴 Et^_[]ÉPt$ Um] t݉ƃ<$t-jPt$(jjVU趃!@uEj6u j6u fffffUSWV[D$ (t$$|$ NȉɉNFȉFF ȉF FffFfFrOPQjbRF fljD$19L$TNffTN>f\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrUSWV[D$ t$$|$ B~rOPQjbRF 7f.ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]fffffffUSWV[|$oEtjPu׭ EjWṷEtPXE EtP7DžDžtPDžDžUWV6s^_[]ÐUSWV[|$0D$,pFtjP6Ѭ Ft^_[]Ë 1uʃtttjj6藪 t$b1D$L$T$ |$# l$hxP H@b1jP6! 6藬Y 1KfffffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fSV[íD$;D$wt$ Pt$V ^[ D$$PUVOI …t3 B$D$$|$pu-tEjQ6 l$ Dl$ 6T$t  ȋ $ T$ȋ $ $UOу PD$@D$)AD$$D$;T$s)t$Qt$WUt$V'l$ L$(L$D$r+L$OPQjbRL$(D$t$f9 $t$s&p)ɋT$rQPRtD$ f@H+L$(fHfLpыM OLL$L| v6WVt ~uuWDtT$ t$F($ < $uF;uFf9rfFl$ uwztzukfuf1ɸHzr#OPQjbRtT$σ;L$ $ufjR6؝ |$p uL$IQ0V+D 1M;L$Lu%P^_[]1f1ɅL$$_1LyffffffUSWV([ÈD$s $E9sލU,$D$)$hPT$ RQ$ $t#9<$v,$}/(9w$) $L$L$  D$$D$$t%ht$WN $t* $hW8h1Ƀ89t$1퐋D$(j?Pt$l tWH0tȋL$):,T$D$19u^D$PW`8uk9t$u?ٷ/ED$PW7E/1Ʌ#D$$=@蕷1y1Ƀ8dfffSV[MD$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVT[lED$PD$LD$HD$DD$@T$@P D$FD$FD$FD$FD$ F D$F$L$N|$ j@jD$PB7 xH 9tE;D$PuT^_[]PyRbUSWVx[lED$txDtDwTƅ1~ 9E;D$tx^_[]WQDD$pD$lD$hD$dD$`D$\D$XD$TD$PD$LD$HD$DD$DL$T$dP 1ɍcT 08u q?u8 \:<: :PQRvQ |:OPQRGDWPjJ#$jI1$1$jI$jjjhjD$Pj4t$jt$P4 u4$VX41VwRHWYP 51ja2`菰USWV[$lE$ D$|D$xD$tD$pL$0T$pPe D$LFD$HFD$DFD$@FD$OD$|D$xD$tD$pt$0T$pPD$LGD$HGD$DGD$@GD$tD$ 9tUЏD$L$$D$(0jVD$0j U蠏1^_[]ÐUSWV [ִt$ T$r&άŬ\PQhRӓT$fzfz~F l$$uBrOPQjbR艓ftB׍Bs811brOPQjbRG[1W)11lN.lN.lN.lN.9uمt# N1Ґ,Q.9uL$$DAfAfAl$$}E 4$uErOPQjbR舒ftH׍BsA11rOPQjbRC1)11l$$lMt$$.t$$lNt$$.t$$lNt$$.t$$lNt$$.l$$9ut' M1Ґ,Qt$$.l$$9uL$$EDfAA A jQD$0h^_[]ÐUSWVP׉ $[%l$D$fJfJ D D B uD5OP )fOfOɉEDDD5 L t5PQ#= D5tcju t$6ge twH jP6Bg 7E (D W)fWfW7PQR< ED7fGG G jWD$0f 1^_[]ø荒USWV4T$X԰D$ D$PL$(f\$r+\$ 6\PQh|R\$D$xr(\$ OPQjbR膏\$D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$D$f;D$f9u(D$t$Tf9L$I T$ $T$LB4 t$4 L )\$LC T$ t փ L \$L$f9v>NL$TAʉT$T$LB4 t$4 D$f9w;L$,9D$$f9t7ŋT$HJ)fJfLBЃD$\$ Vt$P8:\$ r+\$ 6\PQhR貍\$9D$0g|$t(D$ tD$ Kf1D$A4-=r+\$ 6\PQhR2\$D$HfpT$(B(t>BL$;u3Bf9rfBt$f9s D$HBL$L J)fBff9|$vD$Pf)8D$LD$ދD$f91i\$\$L{ \$ Ńt$LF)fFfD^\$ QRP8 f9|$t$19t΋L$I T$ dщt$\$\$L{ 4 L \$ VL$Tyʹ9\$\$L{ \$ 1/fy&\$ 6\PQhRdD$L$Lfif9uD$LfhD$4^_[]Ë\$ 莍fffffffUSWV[ث|$8D$,hEtjPua E l$wJrr GE(uI1GT$0:zD$PVtHUD$PV|$a$ML$fMjPu` juu^ t1BQ A8E,jjuc^ ?fpjWu#` jt$u"^ DžwrOPQjbR:G or&OPQjbRwD/DD$ l$OPQjbR衈E,jju.] ǍD$ l$wrOt$ PjbQ8G GtfAjWu^ jVu\ Džxl$:蕍E(Err/D$T$ OPQjbRYD$$T$f9B$fD$},|$ f9{l$9aFjRu] jvu[ E‹npr׍OPQjbR襆|$qbjWjWl$u] <$wrOPQjbR3ft$><$fD$l$.E(uEft,$fD$$E($EfD$1OH$fD$u,9 GjRu=\ jwu=Z ftB :$f|$wrjRu[ jVuY 1rjRu[ tYjVuY `@=r'Ǎ֍OPQjbRjR*|$B uSfiDBtjR7 [ jV7 Y 1ul$$fl$1l$D$D$ B fyDBtjRu}Z jVuX t3xrOt$t$jbP蟃{$8t$EtP~E EE($}fu E(jQt$  OfL$$Ɖl$;tjVuX 7GfD$Gft$fD$t $A4 ;tjt$unX $@jPujV :ʼnprOPQjbR老fw,$l$fwWt$U) t$l$whrOPQjbRf9u>pjPl$uW tljVuU fGOT$,‹OJ3t$ $;tjQu:W D$,0L$fHL$fH1^_[]Ë$;ujVD$0V ҸffffUSWV0[u~,jj6T &|$ NL$eL$A }HʋfqDBtjR7PV jV7ST L$D$xrOPQjbRc1fu(77)(QjP(v F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPu <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVt^_[]ÐYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Ît$t$t$ [ÐS[^t$ t$ F[ÐS[>L$T$ j[ÐSV[ t$ tA j@PVP FPhjP(s F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8LD$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPAi FP3nPtPWjPi UVj~jUi FPNHVLN@VDPV^_[]ÐSV[mt$ tAj@PVKF FPhjPh F@FDFHFL^[ÐS[t$t$t$ [ÐS[ކt$ t$ [ÐSWV[üt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVkg ^_[fffffffT$D$fSVP[D$L$t$$hjjjRQP  $^[ffffffUSWV[ÐMD$$&yd Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ < 1D$D$ D$D$L$8T$jjPQjRatD$8 D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$FL$$L$<L$TL$hjjjPQRD$L$8T$jjPQt$RL$81 urjP) _UiK1D:0D$D$D$ D$L$8T$jjPQjR`t$8|$<QPWVID$D$D$ D$L$8T$jjPQjRD$XL$e L$uhjjjPQRM uMD$D$ D$L$8T$jjPQt$RtD$8ce^_[]fffffS[Î~ [ÐUSWV$[h~l$8D$D$D$D$ L$D$QPjx ̬$PV1t3 t!jHDžu t$<$* ol$NQ;WvRP`Nt,NQW QRP FEE1^_[]ÐSWV[ yD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [øwT$0|$,D$(L$$)q092sVPL$D$00$D$ jU0J+ Ÿtr|$9rL$EQPt$V jUD$(0,D$ )t+Ɖ4$juD$(0* ŅD$u1 ^_[]ÐUSWV[vL$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0, L$,+|$ $t*D$D$Pt$(L$njUD$,0+ 1ɉȃ^_[]ÐUSWV[øu|$D$ hj07) tk@ uVxPQ4$9vDt$jW6F) t9<$)HL$PV9|$w jP7+ 1ɉȃ^_[]ùfffffff̀rS[t[ḿ̀rS[t[̀rS[ôt[S[Þt[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[s$lD$D$huET1}8XM4tI$P=E8*$$E4E0|$ 1D$L$j`QPu8VR ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$PLT|$ WH$Ƅ$D$TPW t.$Ƅ$8u$L$ThPQp $ 1 $Y?l$$PW}$D$t2) $j UW$WaƄ,j W$U !RjD$$PU: ʼnQD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFCt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW |$ u9nuqF$hPW^ nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$P4 E$$t8OltC$($,2D$XP$0 $0$$toOt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TP)$,$ $$t%(tPD$(PQ( $$(1?7$($,91$u$QPW t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tP$$t M"$($,uWPL t$l$$t$|$t$P^E$$8$j`2t@8@P$i$t$|$t$PE$$t8L&t$l$tW$,$$t(SL?$($,t t$7$QP t$$t$$tP9$$tL$$snSWV[ìftM΋uA~8t:~4~"`N4F8 I9rP@F8^_[ffffffUSWV[5f$$$l$$9$u t!6t$!P$VURQD$bI$>I+`|$ lL$1t2`r/j`PWD$ .$D$ `1t`rŃ`j`PWL$ #L$ `댃$t!$9b`Y|$ D$荫p$ $` $hjD$ PE tF;EuED$E$D$ETt+hPt$$V+ Vbƃ t$ $tVD$PQ"L$ t$$uO$;$uSuO-wBIlux|$|$ $u5$t&aH0;$^_[]Ë$lD$|$ $$Pt uœ틴$L$t$T$9rD$Pt$U! 1gL$Y;L$OG :4ffS[~bD$L$ AQ jQ0" [ÐSWV[,b|$t$t+jP6 tH  W6^_[ff̀rS[a[D$t8t9@€tuuuuH+D$ffUSWV^Ua$ lM$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]É)ffffUSWVLXh`D$L$ht$dl$`u/t+t'\$C=PQjkRa?L$x|$lu'\$R=PQjlR3?L$x1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$Z D$$PT$)rh,D$GD$ \$UW|$t׉t$ l$Uуx6l$V\$t$ |$WT$tx:|$ 4l$l$x \$|$ Wt$T$tx|$|$D$؉D$ )\$VD$@P|$t׉UVуx4\$Ut$@VT$tyx\$Ut$@VT$tx|$+D$l$ \$UD$ PT$tD$ WUT$t|$ x!A\$|$Wl$ UT$tx($x \$t$|$ WT$tx|$l$|$\$V|$W|$t׉ljl$UVуx1T$|$\$ T\$t$Vl$UT$tx+T$|$\$ x#\$t$Vl$UT$txT$\$ |$,tPD$tY\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$VWT$tL$uӃ|$,\$h|$tOD$tY\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq21pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[gthGt tww$Ѓ gpNjPQw%;u<tww$Ѓ .^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[LHD$t$tA|$1ɐt 9u)tPjQG) ^_[fffffffUSWV[Gt$0|$,ttq,TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P, Pt$8=t +l$1jt$81^_[]fffffffUSWV[G|$(T$$tMtpGJB t zRty+ sPQjGR%T$4uʴPQjHR%T$4h`+F \$/}u-D$ $$L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$a D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$L$T$( 9J9s\$VWPK t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[{B|$tpjW0G 1o7)/1ɨuOOtVUwW, ~f)uODt_wу; WP7W& jW^_[]ÀO @1USWV[ÛAt$us ִPQjVR N 1tQ~tJ.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[@t$usKPQj1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[+#l$$t$|$tu"PQhR-D$,tL$ z91Ʌ1^_[]ÐT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[]"t$u"pPQhRkD$ t|$tT$t121Ҁ9 11^[ËD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[e!$[ЉׅtOϋ$tZRWPQ$$$4UhVH$yPVj蓚 S[ t$jt$t$PUSWV[õ $$l$$[ЉՅtO$ tZ$RUPW$,$<QhVt$t;ml$VPQhUJPUj蕙 tWD$ hjP' D$D$DŽ$DŽ$ L$VPQjH$;$^_[]ǃP҃¿+w狔у̃ǃƒ蓰S[t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[ZD$ D$D$$jVj$ uƃ dtjljj0jVj jIjfffffffSV0[út$̀rS[[S[jPt$t$t$[ffSVP[üD$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[4[PS[[fffffffS[8t3[Ë[ffff̀rS[ô[S[Þj1[ffSV[}|Fu!|V>u ݏ1^[fffffff1ÐÐ1Ð1ÐX Ð1ÐÐUSWV,[èl$D|$@ 0u"\PQhRƃ$\f Fwt =uЋ Ɛ=r4$UhW두 덋 |$@l$Dt= t2 9s8u+p ?ƃ #D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]ÐfffffffUSWV[õ$$$lD$@$t-u))PQhR$  $$D$ D$8|$$l$ BE <%t9sߐD$D$D$,D$ l$\$4D$ L$ zt*[D$ H1 w71A*MЃ rl$ D$l$xD$떐l$D$느1퐐,AȉӍQЃ r܉l$,l$\$48 L$ tȉD$ L$$$L$,ɋ\$4\$,L$+D$ L$L$@L$1:lu D$ʋl$L$ L$L$r$D$yD$$TD$x!u4u uCu@ug $O $)ED$El$; $l$( $l$D$ $)l$ l$ ED$ l$( $f $l$f(L$L$ɋ<$D$ x7uu u"u /@t/<$l$D$oЍW$‹D$ L$-L$xL$ L$l$1͉l$1Ϲ,$D$D$ O?D$D$ Uf3 $ $D$DD$ cbD$,$D$u'u um@tl$ED$D$11$(uT$D$l$(PjUD$$= )L$9ȋ\$ȋT$D$,$D$u'u um@tl$ED$D$17fD$8D$ $u~ Ϩu @tɉgL$DD$D$DD$(\$,$ED$D$L$fD$8x1) $1BED$}D$1iED$}ЃD$K)A $T$l$ uL$ L$ʃ,$uʹD$T$T$D$ |$T$,$D$ xd$D$ T$8u$D$|$_te$\$|$ ؃E1ҿ9T$ T$8Ér$|$ À0ʼnD$1;|$l$ r͍iD$00 $rgD$D$\$4jj WP͔T$ $4$4$4$4U$0R&U=r,j$ V;$u;^_[]Åt|.u|$1UPQhW[frffffffUSWVX[$L$p|$lGtGx,t$xfJt$|IPVt$|UQB$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$&QxnNj$L$|PQZU$L$xPL$Q=U$ǃ$fB$) $W 9$A A L$|PQT$L$xPQT$PjT$PQuT$ztQ$WT$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPOƅxՍ7Pj S7Pt$S7PjS7PjS$ 1۸$IUSWV[{l$ |$t$D$@tP) l$$FPj)%SF|PQSfFD$@ u1ftPVPRVjRG fffG )^_[]ÐUSWVP[Êl$0t$$T$ |$D$@tPT$$։)͉ $9L$(B99t$4D$,WP RGPl$UQGUVPL$4 )΁r&u9PQh=RL$8QPQ+l$ ^_[]fffffffS[~jt$ [ÐUSWV[U$ $lD$0$jUPEt U uEEEjU U fE@$hjV Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhmtkǃhpjP| EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU{OD$ djVU PQƅD$$}`hVW1 ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ Q0wtPǍ$WhhPE`D$EHD$E\D$4D$D$|$Sǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #j P$P $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  g"鍔$P5 $< t< 0$< w  A< vhQt$蘎 ƅ_Pt$nuD$ kc$< t< H$< w& A< vhQt$V ƅ_j VctuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tPVTs< D$<@@@@ @@D$@D$8j5Pj j$PݺD$PD$;t$ s E$EtJP EDt%uHPWiu퍃PQ P2xtNV[ML$0 ;$u ^_[]`USWV[+t$xPKdžft91 9s)tQJDŽͅtMtt|Uc9utJxt PrJWdžtPdžf^_[]ÐUSV[$Eu jP\n$D$F$FbfF e^[]ÐUSWVx[ElL$ L$pu D$jPmD$3D$fGt$V@jWV VWZGL$ ;L$pue^_[]^USWV[+t$xP Idž|$ft;19s)tQHDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[D$At&t$0UP EO $L$(T$ L$HL$OL$ F< t< tjt$Vv^ \jPV\^ tj PVB^ "jPV(^ &j PV^ ӓj PV] jPV]  jPV] jPV] j PV] jPVr] jPVX] jPV>] jPV$] j PV ]  wjPV\ jPV\ $`FPS 5d$/FP3 |Gt^eGddGtAPt$'F P|GGt~PQ7< < {$H׋$ut$0UP $P뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]'PV=f?r?D$PVt$ D$L$Ƅ|$'PVe?r?D$PVt$ D$L$Ƅ($H^_[]ÐUSWVx[$$l3 h3 p; t|\9h@t[|x$D$D$%D$ D$D$D$ PjjjQtctt. T$u8u X, t 0 u# h6 , 0 xL @4 P 8 PD$ lD$4 8 ( ${@:tnq6w < @ K4{z9u 뷐K4f;{ztK;|3(ҋ@ D$< 4$t$L$ 1|$)T$ 8 C4 t_tUD$tKNjD$ 1t0<2 u*d)փ4 !D$ D$ 8 L$, 0 ,},T$tL (ML \E,E,4 E9u9rT$ }(PL$|$щ)ʃ|$ $sO߉ʐ JHJHJHJHJHJHJHut1 : 89uD$|$,$},uǃL ED$T$)E uY$}[u}M QWWE7)Ɖ4 D$L$,E <$t r }tz1\urt' t", 0 IL$9uʼn , 0 @D$ 蚕, 0 @D$\uWjP茹ƉL uȼX88<*u, 0 @D$uWjPL tu^L , 0 ,u1ɅD$uBtE,1.\0D$L , 0 , $|$;E vAVuNl$ A AKq NjEL 8L$@DPD$ $1t$8 L$@ D$< 19E<2 u d|2 uߋdԅ>, 0 @L 4 ( ։L$9Pt$ t$D$ 24 ( T$k@9tt y6w < @ K4t$kz9t$u 말K4f;kztK;|;(ҍQ6w < @ K4S|9u t$.t$KK4f;S|uS@:t@ D$< *${@;L$ t p6w < @ C4{z9u,럐C4f;{zuC;|3(ΉЋT$ T$$Љ4 ( 4$k@9ty6w < @ K4t$kz9t$u$뗐K4f;kzuK;|;(΃4 4$0jD$ 0D$0"cD$ D$ 0>tuƊt^8L$9 $|Gy $ DAD.D$8VH9s .1%0PjC$^_[]ESV[ý, tzP N90  QP~, t{NDDDDD DDP .jIs, tǃP ǃ0 ^[ÍIUSWV[j0rƋD$F PrFF谍(Ff~FF,, t 0 1ҋL$9u<0 F(, tl0 9tF F$F衋(, 0 rL R4 P\8 ^_[]19u말S[>u6QPRJ j SWV[ t$8, t30 9tbt,8 4 zL , t70 9u 0 ~t vV^[19uΐS[t$[ÐWVXͤL$ twAQQBQQAA,, tH0 49u80 4~L v4 P7 \ 8 ^_19u뽐SWV[,t$tvT, 0 t/<t)8 4 zL t%MLH4jP7? ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [ø|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9unLUL$)ΉL$+D$PRT$ R $ fL}$fD}9L}D}fufL}1ً|$EftEftUtUr&^PQhRgT$ftUfUD$ @8D$$H1 ^_[]USWVd[h|$xG =tjj$W跓$jj$W蓓t$H I xfL$0.AD$D$D$D$|$ UDu (L$DLu)L$HL$T$LD$DPD$lw9sf|ww L$LT$)‰T$PRQ$z ;D$|uDu|$f+|$tBlj)ωL$RPQ DuT$ff+DuL$fDMfTML$L$D$|$ <1 $iEft$t$,pt$T$0z|$(D$ L$l$L$$T$ T$|$xMfv#f|Mt$[D$TP$D$,p Pt$t$(W [L$Xɋ$OT$TT$ ?T$\VL$ЋQL$ IL$(hD$$D$ t$tM+D$,fE<L$9v&rg^PQhSRdET$)fLEfTEjt$(V$W轐O t΋hD$,L$ ɉD$$tQWl$ l$ l$D$ T$Eft$T$MfG =t‰T$fl$D$tuD$ (L$4 .))ƉT$L$<|$@t$8WQ$w ;D$|ufL$fyr>TQ9t$|$|WƋHL$T$TQ9vPt$ |$|WU&ƋHL$(T$P2Q D$ff|$(f}r#L$0IT$4RуDE9T$0vZVWƋHfyrD$0@T$4RЃTQ9v*t$4t$4VWk uR"t$4GT$0t$431ɀNG8G8tO(1;G4~ Wp^_[]ÐUSWV]X~t$4\$0V{4ufr\$0K4T$Ns DDxKS !T$S$1҉|$9,$~t$ 4L$͋|$!E;l$\$08un19؋$p fGL$08rT$0jjjjQPRT\$08mD$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj f`1JуT$  1fljڋ$jt$8VPR脆1ɃFttHT$*]tjLjfLjfw8\$$^PQhRY\$T$ D$4@ftjf|jfDjfȃ^_[]Ë$VD1Ʌt‰ D$0L$ЃVhP[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08GT1USWV[ÈyT$B =t $|$ t<|$,t5|$$|$(j<W躃T$ D@fw'֍^PQh#R/XF P=tfOtfO1 ŋJttƋD$h<WjV*U D$@ ) PhQ U L$D$ L$T$fB81^_[]ÐUSWVP[jsD$t$@ 1=r L@%<;V$~$NN 8uO9QL$=8tlnjjjQPVIu@8 $tA !‰!t$Vڂ ^_[]8+M"^PQhVRQffUSWV$[Xr|$Dt$@l$D~t-9$w$D$ u( D$ uD$D֋$;PD$ u fjT$Ty)‰T$ L$ʉL$‹D$Rt$VPT$ D$ Ɖt$)$ƋD$L$f xD$ L$fDy9f)tyfyuM|Fa!T$PQhROT$2|Fr"!PQhRN1<$V $D$D$ $09wЉl$$uL$D;QuLN)L$.Wt$P |$$)Hf,Nf?Ń$r)!PQhRNT$flFL$fLFt%f~t$t$<2tWŋpf~l$M|F!PQhR|M1$^_[]ÐUSWV[nt$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UxƋD$cPUT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σr+dPQhRL$E ʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]ÐUSWV[Hl|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQu uhDnjt$Pt$0VvtRV tm9u.NWRV/u t ^_[]ÐSWV[ kt$|$LQjPQWavt2HfyuftfDHjWPVu`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVt+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TNGDHjWPVnt t&dž(@f8u$dž  ^_[]ÐUSWV[ÖhzA =tl$$G)B fT$L$D$ uf͋t PB,$Uj<|$(todž(dž $FDGjRPV^stiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$L^_[]DGjt$ PVr t׋@f8u$dž wSWV[g|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[fT$$wA =tF)G D$ *$Ffu^L$t PA4$j@:L$t$,t$,jWQPt$DFjWPQqtjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ> $JЃ^_[]ÐUSWV[xet$0l$$D$jPj :|$[ffffffffffUSWVY+]T$r 1t\z:_L _L _o ݃L 9stǃuƁL ^_[]ÐSV[ê\V7jVVP^[fffSVP[l\l>u1$ jjPVjQit<$ t ^[fffffffU ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/202502230120Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20250222233809Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%untpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.0--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.0 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.0 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timeread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist