08PRg'&<  'Rg/P''`'2 2Rg'&P@@<@T 08PRg'&<  'Rg/P''`'2 2Rg'&P@@<@TU Rg`'2y?ARgRgRgQ$f RgRgRgRARgRgRgXARgRgRgYARgRgRgZARgRgRg^ARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgRgRgRg/altroot/standARgRgRgCRgRgRgARgRgRgARgRgRgmJwRgRgRg`hpxm/RgRgRg(08@HPX`hpx[[ARgRgRg_$RgRgRg$>RgRgRg$RgRgRg$sRgRgRg$ RgRgRg$RgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRg$h`RgRgRg$RgRgRg`h$RgRgRgpx$RgRgRg$RgRgRg$RgRgRg$RgRgRgn$RgRgRgoARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgK:;83+ ~ܝ Y4" b`o'6Pv3W!}6~4 rK*n~T[K-.9~/%r*-]#$+w,8cQ Pt7,}М4$B2V2 . ...profilealtroot bin dev etckern libexec mnt mnt2 sbin  stand targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi  ... . .. catchgrpchiochmod cp dd df ed ln lsmkdir mt mv pax pwdrcmd rm shsttysync . ..MAKEDEVtual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. cgdgroup master.passwd netconfig protocols rcservices ...ELF4t4 (ZZpp<<+<+ TTT,,<<+<+Ptd-#QtdNetBSDpmAPaXU|SR ffffUSWVP[ʟ&t$$u,@jPjjj̞jb |$h0F $uX!BtKj/V[t@Ƹp PVt&uVhLph4phĻ+-^_`SWVhLphWphĻ+- 1۸p PCPrFhĻ+j >whhĻ+o- uhĻ+j =j-"D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5T+ u$1^_[Vh9sVhOs: 5P+hsj,wVhfsjUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S@ tutD$D$$D$% D$t$@N D$l$hX+h"D$ @l$0tD$Ph2"j !D$  |$\$4t$,s$L$)L >QPhduC" D$  L$s()@L$L bQPhu"L$ D$  s D t 4ŀ hu!L$ D dtPhu!D$(@9XUV1\$D$T$T$9tt$N9BD$4ŀ 5P+htt! 1h^_[]t$|ht)2%WS$hthuj5U05P+h#ujJt$|hOs5P+ht3$htjhc 5T+p u15P+hujSWVPD$Hw#t$>` Wt ubd $hrWt N1AQhc5T+ u 1^_[5P+huj_USWVP|$t$7 JhrWV fu U6P+u +)u P+uhrrt P+hjQ迉 T+u 5P+hrIhu3$( SUt uUh%sjQhsju$NPVS  P|VĻ+PhvV! Vjjh7vc  hVvhĻ+P! uj!5T+趉WVοV tuVhsj蔪 ^_VPΉj PQ x $9u^Vhsj[WVοV@ tuVhsj-tD ^_USWV\$$1+ ++ +sVrj=P-x<$h)jjhh U ,+H F H ,+VP3u,+t;#=t%{ ,+##=uthv-,+tttut!tcu,+ȥ +^_[] ,+VhrvW Whv4$hv4$hvj襨hwh4wD$L$011PjPjt$h <+ +++1PjPjt$hw ++hwj!1hjPPt$hwء++ tj91PjPPt$hw褡,0+tZj ,+u$1PjPjt$hwl++ËD$+hwjw1hjPPt$hw.++hxjC,+u$1PjPjt$hx+ +ËD$+h/xj1hjPPt$hEx趠$+ +1hjPPt$hQx莠++fSWV+t/ ++ t5+)փ>8F u롈+++ + ++; + +r*jZ+++ + ++^_[á+ + t ++hz hjhz hj֥hx hjťhx hj败USWVt$|$6CrSj?SVWf u=+PM+u,+++ Ahgxj5+ 1QQP1 +y 5++ + =,0+r+uhx롡+u#++Ky(+ 1,+H(+  hQP蓂 +yJ1,+H (+ hP5+Q + +y 5+++,+utS1V +++9+r_ +t= + +E +t# +) +I +" +ujl+ +++ +t + $+t ,+h`u;5 + +=(+ $+5+VP5+W ,+1Vhx+薮hjghjX5+5+5++hX-,0+e=,++ + t@+8+D+<+9ss$+ +tQj QjP +5+5+5+P$ xd5+-+1‰1 + ++ +8+<++ +,+ +xPh[++u6+j5+5+5+P  t5+h,+ ++ +++ +8++ +<+C,+s +++ +@++ +D+u@s)t`+d+H +PQQI ++++ +j1++1++h$yj~ PhjQWV+=t=ȥ=u 7.++ +t; +9щ5+s))Rj5+Q + ++ + u\54+=0+ tJ5 +j5+  + ++ ++ʉ+)Ɖ=0+54+ t jY=+u(+jPu h8u*(+5+Pt^_hojhEyUSWV +|$,t++(p‰D$l$|$,u .+ xT$ 4+0+ t!(+jQP5+R !ƒ~t$VSh+ $~ D$ `18D$ Z 4+0+ ʋ-t+p+t>5+5 +QPh+l+H+L+14+0+T$<$t$ p+-t+l$13L$ P+T+D$11 +t,+u#+5+hx"T$+L$ AD$)ʋ$tЃ|1@|p9@|50+4+* +1 +T$1 uKH+L+I$T$ ++)ѣ+ +5+- +9P+T+$ t +)PQ5+1 +1++ ++ t(P+H+5T+5L+QPVR tjhjx$^_[]5+hx5+hx5+hxjʛ5+hjUSWVt$(|$,\$$Uh+jx C4WVs(P( 8jUjx 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h.hzWS賣 H-$ +++@++++++++u+i++S+G+;++++++ +=+-U6E=+u =M=+ui $ jSWVPΉjP$ut4ÿ<$VWt Ku1^_[ht{j蝋WV=+t+t΃j PV草 tu+ +4^_USWVtՉ΀= +u)t L$jPh{h QL$jh PQ =+L$jvvQPh{v$v vvvvh{vxvÉ(=+u=+pv =+u j Vhat^_[]h}h}hAh}h}hBh}h|jSWVt$=+<\$Wj hrRQPSH5SVhp@^_[fSWV|$18+AL+GO T+1ʋP+1 t$P+ T+jP5X+N  4+9}0+W+ 0+9|_SQE4+0+ +u +5X+WjPjx!9u=P+T+50+>X0PhhĻ+# h~'0}PhhĻ+ h~N^_[0HPhhĻ+ hT hN +uá+u tjwGjFUSWVj1 Ƌ|$11K< @u=L+t?jj5X+ 5X+P+T+L+5X+UjW A)߉nP+ T+N F5(+q0<+(+-P+F T+n0PhhĻ+t hT Mrh~]1HT+P+,0PhhĻ+2 h~'0PhhĻ+  h~LV 1^_[]Vt$5(+q0F<+(+^WVL$ +5\+9})=<+79}><+80+9~vRO9G9~-80+8+~Z8+΋Nu#80+)Ou9~80+RN980+ \+u +uu80+^_É1jDjDVT$8+t=8+18+68+t@9uхt8+uh~hK1^SWV1+T+j?dhV~tW葇t|8/uWh~Whh`+& `+tLP)t$h'PX+1ۅu@W\5`+hMs*j0PVhy hĻ+Ch@I^Vt$X+t3P8`+t!P5`+%`+Vjh+h+ "x 8+8+<+1d+@=ujuSVL$D$ T$t$d+d+5d+d+~A2d+BI^[fV1h+l+t+p+PqPyUy+Fu^SWV5l+95h+t$h+Vjjh+ut=+++jjPPuthh[Hx+0+@up+=t+VBtVPS%G~*h5+r0hhG1N1NyhhG5l+~h+H h++1H^_[Ë h+u!T$7l+h+1l+xD$Qh++1HSVփuUx+0+@u+jjPPtthhG+ + t+p+aˍ+)Qhx+P +x+0+@u+jjPP$tthhFVjjh+̜^[Vt$ h+ul+h+1l+x 1H^USWVhWaƊtx<0uFD uhxh$EGuȿ|w WjPp 1T L ш @u+hjV> P`1FthhDe^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$|  1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP8+ t uhXC^_[]eC$t8+8u@8+54+Nj-4+1;-0+M1WtÃ=T+tj jwSVVVSt$71Ʌ;L$uWwZ?E;-0+|1MV+15+5+5+5+5+ 5+ +u +uu ^j:jq;V5+95+}+I+P5+ tC5++ +u +urufL$+r5+ 1^0~PhhĻ+ hT A +u‹ +u tj:j9USWV l$ D$fD$p 1P ++19+@u 9u+Sk(+ t$$PPh,  $ +| t % +ڃuh2QʵUuh1Q譵jD$P 4Ë $+9}=+]+9|A‰T$R5+ NjD$+=+ +u+2$@PSW  =8+?5ƅt(+VPP,+ 8+8uK=+뜣+Gh258+莴t:jPDžx Q:? ^_[]Í|$K0 PhhĻ+Q hT > +u+utj84j&7WV +5+19}'+FىDuw9@u1=+^_USWVD$L$9tV+r=+~=+9 t9|1C+Mu9|1C+=+ 9u^_[]fUSWVl$}!uEh 2PUT1h 2PÅt*t$Sǀ}!u?S =0k PUhy hĻ+hH=eSx(=+uWhuhĻ+ 5(++t$0v0 PUhy hĻ+{h_=^_[]USWV |$$Wơ+$T+D$<+1-+-T+9-+t\$=(+t$ gDž~w11+5+Y6ts(+PPjJ Å +u+t$ Dž|$$\$9t$utt w<$u=+t!9u T+ uhĻ+PX9¡T+Ƌ +Ӏu1A9|$t $ + T++t )) +u +ut j4 ^_[]j3USWV1|$=+t WrGHOHt uG `-+9}+V+9rFU5+ -++ +u +0u T+F8W:<1ۍF-+9~N+ +9wUQ% t7-++ +u+uhtk+0 F,0PhhĻ+2 hT 9 ++j2G @utL+0 F+8谼09PhhĻ+ hY9-1+0=T+=+  )Ɖ^_[]js1USWV|$?!uGhPt$WI,VPÅt2l$t$ US NjD$8!u?S=ӻ0\PWhy hĻ+h{8mS۶x-=+uWhuhĻ+ t D$ )@ʼn3b0Pt$hy hĻ+dhʀ8^_[]USWVPl$Uƃ=+t1ۅtf;l$ `1V$th~;-<+u=T+t =+u8 GWPt$ F x4EEs @6;l$ |=+tt$$$^_[]USWV|$\$l$19t[=+3t UPrUPFy60PhhĻ+< h61^_[]USWVP\$58+FEx @u}|~PVq6tj+9~l++9SPI gƉ++ +u.+_tO58+;^_[]Ë5+W58+V( . ,1xщǃ|$uE +| /5+9$~Z+9V5+ cÉ5++ +u+t +W5 +Uu ,$+HPS5+D( |$tM1BDžh40PhhĻ+" hT 41 ++5+9} +|$N++9͋|$|MVPO t05++ +u +umua(/ ]0PhhĻ+c hT 4 +t1+uj-j/,SWV11+H +7h+mu8 +@%f +9u+H +ÍF=+9~Y+9wW5 +" =+ + +u +t +0u T+F +C0PhhĻ+ h2% +1t +0 +8+^_[謵05PhhĻ+ hT U2 +u+u tj_+j*USWV\$ D$1tt$hD$ l$1uHD5t+J t+;+у  l+Ql+;=D0+|hl+hN1GD5 | <\t<t+H t+;+hl+j\l+H l+\\5tjj Sh} tVG)Ȋ t+J t+;+Vу J l+Ql+\$ !0t+H t+;+hl+Pbl+H l+D50 t+Qt+ɋ\$ ; +hl+P l+Ql+D50 t+Qt+; +hl+P l+Ql+Dhl+Q4 t+Qt+; +~;ȃ t3 l+Ql+D$F9hl+QUhl+P똡t+H t+~l+H l+ hl+j 1^_[]fWVD$L$L$$$0k| $ |r1+h)t$t$ q ot9EtzS+ǃxtostypfU6+먡+  $)D$|$ta$8-uW+D$|<+b+S +D+5$L$jj襓th_jb1FhVQVjFhj7h+ƅux'+|$t$8t$0|$t[hĻ+h1J$8u h>_-ju$hĻ+h0JJh4--y =+th+hhĻ+Y +tPhhl+腈 xt` +| $+x51g(+QPP M=+=+hĻ+h1WIhO:,j% ++h,% +΃t0hĻ+h1HjM515+hĻ+h1HhO+VQ=+th+5+hfhĻ+jrjkPh, hĻ+ jX=+j褐unh+5+hfhĻ+Cf$j0yjdt$8!$h0h+g uh+hhĻ+ jL$ ɸ!+Phht@j̕ x#$r@0+D$ rD0+ËL$=+t1@ +Ql"L$=+t1@ +Q#WV1F=+t9|$ ?!t!hBWtj/W~th`)1^_,+(+0+4+x>,+ 0+ 4+0+ 8+;t,uQ8+9;u(+빋 ,+| ,+0+t9t4+1Ƀ USWVP+8+DJ@t t@8+@DJ@t uHH 8+~Ã=w$X =$+!h  !=,+" 8+A1Qptntl  Ӊ 8+A˃=,+FP”^ U 8+@߈\$ ̀1ۈL$QuH 8+H1KDB@,Aǡ<+ ,+  Pj  5<+j$1  ˣ8+@̃=+t=+y=,+6DB@jLǡ8+@1Hptntl   ˣ8+@̃=,+DB@8!hӁ=,+1Hptntl  ˣ8+@̋ 0+1PptntlN  ӣ8+@̡(+HQPN"8+@1Hptntl%  ˣ8+@̍H 8+ 0+ p1Pptntl   ӣ8+@̡(+PPv 8+A1Qptntl  Љ 8+Aˡ(+PPH-4+0+=,+=0+ 9=<+ -4+0+9 9w h (+PP 8+A1Qptntl  Љ 8+Aˡ(+PPl@ 8+A1Qptntl  Љ 8+ADB@;h 1ЍrЃ sO誤j h8+58+J L+w{8"%H+ 8+:o t!gc ptrP  A 8+< b=D+Ho1(+PP9 4+-0+ =,+=0+ 9=<+4+-0+8+@1Hptntl  ˣ8+@̃=,+F1Hptntl  ˣ8+@̃=,+h 1@4+ (+AQP2 8+<Ģj h8+58+H @0+葢8"h N@0+ 8+x w =,+<+t0+0hp  8+x A =$+u;.50+O1@4+ (+AQP@ 0+jPP>8+x  1q1ۃ=+Ƀ=+ ˃h~ 8+x  =$+u-50+54+ 5(+g 8+x ? =$+uL-50+54+: (+@;<+?7(+-8+x =$+u , 0+IQ T8+x =$+u,4+ 0+9QPn8+x QVP 8+y F( 8+y 1 8+y P50+54+g 8+A1Qptnt lu  Љ 8+Aω 8+y  0+<+=@0+9|PRQ 1=,+u <+0+ ǡ8+@1Hptntl  ˣ8+@̉8+z !$+SPhA8+x  1@+++uF%8+x U6u<0+=+t1+8+x =+h+hhĻ+ 8+x }*x1Hptntlu  ˣ8+@У8+x '+G10+4+8+@Hptnt lu  ˣ8+У8+x =++uB|$Wt50+54+QP';<++8+x ==$+uJ)=++u50+Q5;<+)+hh,h L+h~L+1< *5 8+y qtP+@P P+@P;=+hё+8+x )5<+j 6'(Y$i*t 1jP8+18!@8+$tP+@Pa5P+X+$8+1ɀ: t$1ɍr58+q4$8+: $uP@ƅtj5X+b<$hN F*0 PhhĻ+0 hT  1 +u +u u^j jSWV5+}Z+W5+a ti=++ +u +} &+NT$1\uZB0tFB9u^_[60 PhhĻ+< hT  1 +uË +u tjjUSWVPD$9<+1@P0t$"4$91S肻ŋs t+9~Y+9V5p+ 55t+p+ +u +t Yp+sUPh {;$\15t+G9~Z+ p+9VQ膻 5t+p+ +u +*t p+f8 t$t$VN5(++5p+ta(+PPj tL+1 +0 PhhĻ+  hT   +tU+uZtCjÌ0L PhhĻ+ɲ hT l  +t ȃ^_[]á+tjD$ +DAuhx' ËL$<+u+ +1USWVP\$0+;<+|1p-4+M+9t 9tVUj1 tk9<+$1#VDU9ơ0+CPSj t,V$94+~+US) +ySһUǻŋ>EEp $A8GMi 4+910+)@أ(+=$+t W6U+1 +u +u u^_[]jjSWV=+uj貽L$ɸ!+<+PjhhHy|hKNtkPC=Yà P! tGWP7|3/tf/VqCed.hDhup5<+jhVj=+ujL$ɸ!+jh+USWVPl$54+'Ƌ=0+4+-(+9ʼn) u)E1u1$+E@+V}tzP蘹t_(+PPj DžtO++H+u +u[uE6M(+@Pi1,$l& +u +ut j1^_[]jUSWV$+ +th`ckjP~8+L$F$ d+9} `+V+`+9|BVP 5d+`+ +u +! 8+ u1C1E҃!%=+h+P@Ɖ$ d+9V+9V5`+ 5d+`+ +" +7 09L$]9+9|WP说 =d+`+ +]9~[+9V5`+[ /5d+`+ +u +yt v`+ 8+ (E 8+Q8+9\u=Q8+I ( `+G (E,$s 8+L$A 8+ P+y h+)9~_+9VPu I5d+`+ +u + h+`+| P+A(EAP+h+9r 8+L$A 8+7 +3/ 8+Q8+ ( 8+݀ (5l+9}P+R+P+9|KVP腲 t]5l+P+ +u +S5`+P^ P+h+D$1!Pf0 PhhĻ+l hT  + +u!u#^_[]hqh4gj'jVj賦 tL$Qq p PIH1Ń0N PhhĻ+˩ hT n1^V+t.L$19 x+ux+H+t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h+3XWV 8+ td< uh1 Q8+I t;8t7P1ǡ+t?=@+u6Pt+95+hR5+j7 +tV@+5+WP +t.h'h+QPH5+k +3/0 PhhĻ+  hT ^_USWV=8+ tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-$+9}= +M+ +9|KUP tYlj-$+ + +u+uyS58+WZ 58+=T+tsj jSWme0m PhhĻ+ hT 1 +u*+u(tjhh[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u8+ u(+E#t8+ uE1^_[]8uP8+HЉʀπwRj h8+58+% 1wY8"uh 1gu@8+ErUSWV8+H 8+H%u,8Xu'8+,+h,t18u=0+9 ,+L1}50+9~[+9V5,+> #50+,+ +u +\t Y,+ 8+Q8+ u (\t u^8+8uT8+H 8+ ,+1< u0=$+u't +| t % +ى8+8+,+9|NWPO t8=0+,+ +u +uuuw5(+0,+M1IU}0 PhhĻ+[ hT 1 +u +uu^_[]H8+,j'jUSWVPL$(+4+190+}%(+ȃ EhEKl$ (+PUVPt$$KǸ1$(+PP4++1S̪á(+tP芬EPPjM Ņtl9u +l$ u+ue$(+0++4+9}yF(+@(+P%Ut$ Pt$$hDž+9 +u1+uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=T+tj jvS肮vލD$jPjSu t1t$ED$$D$1E $A9T$ 48+9Ɖ $T$~c+t$ 9V54+ \58+4+ +t$ T$u+=T+tjj RS藭T$=4+RSWS 4$D$D$ 8+ $9~bt$ +$9V54+j 58+4+ +t$ u+=T+tjj t$(S=4+t$SWBS Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu &D$)D$8+9~V+ 4+9SQ_ 8+4+ +u+|$~#D$$ D$ ud$th$=T+\$tjj SV賫4+SVPR 4+f |$%C=8+4+ +T$u+ml9}C 4+1F9u,$y^=8+9}4+_+9|W54+蠣 =8+4+ +tT$ +T$M 0E+,+;(+58+9}4+J+4+9|KVP t)58+4+ +u +u^u`I#u0謿 PhhĻ+) hT  +u +uu؃^_[]jjfWVD+ @+9|ld @+j Qh<+ tJP PhhĻ+蝚 hT @5<+誧 1<+@+kD+L$t$T$ =<+@Q葤 <+D+RDVu<+5D+@LF5D+<+^_SWVD+D+r9 <+@<u|L19tWW 9uD+(+H0+<+L0+^_[USWV=H0+=L0+=D+t +(+$<+D$j荣+D+ <+ÍS4R4nr@44v\1L1 [ <+\1l1sRt6,lmL)1 <+t)|?wt)LI1 <+t~l)}L1 <+,u44vL1Y <+l1}w4R4Ӆ HA9~R<+4@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=$+t׫H0+(+$H0+L0+<+D$L0+1 +u) +u&tj\h܂$^_[]jlUSWVL\$d3ʾh4tNjt$`hSV0 fttu=U6߃u +r|$L$ D$1p D$P)ƋO9rPSt$  tu;_Յuͅu t$h%-|$dD$ Du$$1Fl$?uSt$ hjL$j QPp $;Fl$|1ƋD$8u&1zPUy!UhjD$ th9jzNjC=m@!sHQPW xs{QPW x4$UhK! =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@WL y?60PhbӍL$fqQhmW 3Uh7D$ukD$Ph>hG T$_hT$9hńt+H t+~l+H l+ Phkhl+j ͗t$8t$8t$8t$8t$4h=輑t$Ht$Ht$Ht$Ht$8h]蛑t$h{芑t$ hyj迈JlPhڄhĻ+ʓ j蠈SWV֋|$t ΄?tԄVQP, JB8t+H t+;+hl+j<ٖl+H l+ݕl+H l+>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hf/thP]uH+hNf|$Dt1BuNfD$Dh|$u%j t$hjt$Xjhy/ch(PhhĻ+誊jPD$L$jQ5L+ XUSWVA1K8uSt<։@dhU7 ~WUV ~)u1d1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSieƅu]jjN tqƉx jPS  ǀ;t$8u1A8Љ4DAtt;L5rShKj 10h%WV|$x$t,WDWLDWDW8Dx uWZ@jtw\wXN=0+9}5PBt850+WVha#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W" $>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PU} D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph,h跖 |$PQt$t$Rhj蚗 C$t&8$\T$XT$H|$RQt$t$VhojE $L$l$8hhhh?EUSWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hjq NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPz;l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hvRj,PS'D$HPh  |$0hvRj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhćju ^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh߇ 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ h+h+p+p++5+D$D$TH Qq T$T$ t$t$QShj 11KL$0t.ASPhj蹍 V5+[S+4+t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h=ljP8U8H H;1D$8<9+8D$D$ tD$tD$\+ڋL$4Iʉ9w9vˋt$ 1t$t$81QSPPD$tD$t$t$8WSPPj赊 tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhD$8Ph+Vt$,V'~GD$D$8D$HD$L$PD$LPh+VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L x+|+tt94 S.8\+T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph%"¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhaD$8Ph+St$,V~D$@s, D$¹tt;<FG;D$ L$?-Vh Qh.j܆ $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh@ HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhje1gD$4$DŽ$߬$D$D$D$@$߬$ a111CƋD$|$8D$|$H|$LjD$LPh+VL$HL$8t/+ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPhzb11ҋt$  t<=++$T$p$1߬$$$߬$h+h+p+p+DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=+$t1J8D$<D$ۋL$؋+k,L$1T$9|L$$)щL$ Ɖ$D$HPWhW $PhD$(  yNL6L$ L$tL$L$8]:u*t$ tD$Phjt ,uhǏjt uhjt M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP裼3D$ t(Gdt;<r61@h@J t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWNJ1 t1t$|$ 9|1t$$Z ]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPe4$]0hVPJ ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vhjp T$$BRt RP轺RPVWjt$$VhǑt$$X k,P]H D$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph6jo D$,|$D$T|$XD$TPh  t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$+ + 0+9|[5+tFNu +5+t5FNHNFy F4VPV+@+1@j@P+U1@P+F ~4D$F(^$F0^,n#0+^8 +  +t q4 +^G FtH 7~ F^_[]É +=hhhhѓhhheVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP +H+N^,H +++H@+P + +H+H4I +H89t;tprp +40 +t4F +H^hhh4heUSWV}]uuu W@t +1@+1HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$g s G4$O,50+w0VPww D$0^_[]USWVPt$ff s F4$N,=0+~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j'8p +HtƒQ +@ +^_WVt$ +F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdF F F hjv vE ^_E USWVPT$|$:%4+\$ +$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4+1ہ=+| t Pt++1t 98t@^_[]Ã^_[]`V15+5 +hVh+  5+^ft$ t$ Cji,SWVt$frLN4F,=0+~0WPvv 1 t\fv4V1AN4F,=0+~0WPvv 1 1;NuN^_[h Z 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR赤׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hNh?h h?USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPݟ3T$3D$M u1^_[]USWV(t$FFF ]F F$|$0tfhjljPLtLXt uB\I\$$|$ C$|$4Nhh^<1ɺPt`tLtt l$,\$(|$0uejttPttPdA 芇t u_4u_4_HoL_HoLUS6jjW'hޛW>q$ 1=0+lj0+l$1 UPQSWVhjË}Pw Sd P G1PWH¹tTt 0+߀<$u1 t1 L$QWURPVhj:Njl$hu P P E1PUtA|$4t h3:\S6 W6 1^_[]u C4CHKL1}Mt|$4t7h[t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh_:$  $ V 19tQRh& 1@^USWV |$,\$$t$ tCPPt Ttt4RQhܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth$hl+D$(u KHKpStURQPt$DljT$t hYu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh@^ $+VRh}G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh D$L$9tQP$$h!݋t$Ht$nL$tI9ȋt$ tPQ$$hY衋1t$" \^_[]h•hhhԔh•hhPD$L$ $QPj0+ XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$͖nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D$+uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWkƋD$0T$UWOƋD$0 u$$$UWljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP~ERP~$GW #RP~ERPr~$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhTD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhD$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW'zNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPyt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPyT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPix|$FV D$t RPLx|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPw t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP7v|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPu$ D$TBL$?ttXLT$BtJ J T$$T$ QP?uL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPtي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVrD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv J t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h.hh hNh?h hNhh"h?USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p ; A L$H SjQ ^_[]USWVL$T$ B(+ulF1G Uh,$t+H t+~l+H l+ hl+j }u q1^_[]VCĻ+PPh3VVjjhj蟪@ PhBhĻ+ ujWUSWV׉΋*hU2< tCt[PUjhh,+s 5(+ ,+t2(+,+WVS5,+|e^_[]Uh%sjw5(+hj蕆USWV$:$D$VuP胐 9$j uPf U1ɉ\$QSu Ƌ8,8"u11F9Ή$<$1ɉQSu z ËD$8Չ8"u !t$$Vhyd5,+ tbVh6^_[]jh^7jh.uh$hЙh$p hhjDŽ$05(+h7j܄USWV}E phVFhVhVSD$(P5,+;Z#D$0= M$L$A1yyy D$Phwd5,+w D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhjL D$v1111O w+Ow?u$L$A1AAA D$Phwd5,+荻  \$tmt$ NL$,D$((+D$FD$FD$ FD$$~D$(PPWt$,t$t$t$hd KuD$1D$|$Ynhxd 5,+R5(+1111VQRP5(+h֚!hxd 5,+螺 (+LQhww ww5(+h w_G|$9w  jPQ5,+A!¡(+tNSVPhOuWt$ 5,+-_ J9t#QF*hl+SVPh:vكT$;r ZƉ[|$?e^_[]jj5(+hPlhhhhĻ+* jQhWV$u>$jvWҊ s'Wh{dЀ5,+ t^_jhajE65(+h7jaVPPhtd@5,+謸 $t%t5(+h$țu5(+Q(+$$  srQPh (+$$ srQPh (+$$ srQPh:_ (+$$ srQPh^: (+$$srVPh^5(+hj3WV$u^Vhzd@5,+n tH$D$PWVh̜$PwwwwVhڜ^_%5(+hj~USWV}D$Phd@5,+ tzD$Phd@5,+辶 u5(+hs(+$|$\$ t$jVSW轾VRPSWt$h e^_[]f5(+hj}SWVP|$uX|$_hqSƅth S̿u+1Qhwd5,+ t ^_[75(+h7jq}USWV|$0t$,1@T6+$1ۉ؉D$hKWV qt\$te+$95+1|$7wWh|d5,+O D$ ;D$t-i9l$sUt$ ƉD$l$묅hhPV+(+L$ rt-RQPh3|$ t\ư1P`VvvvvQPh G;|$ ru5(+h$t1^_[]W5(+hNj{5(+h]j{jP|$u1Phd@5,+  (+tQhaXD$ 0Qh7jt{SWVP|$t$^hSXtDh 2SFt@hS4ttT$da3 D$dD$ tTj/SKtF1;tٍT$d#3D$dD$,t>\$:t$1\$(X` \ h{ u1\^_[]hhz+=<+uj=D+L+@+8+4+ 4+YhǞ5U6hPh3js8+=H+u thK0"@+ 4+t uh}t=0+uhT)ǃ|u D0+j=X+|$\G1PPL$lQPjW0xt2t$d9 t"1PPD$lPVjWxt50+=X+u4$P50+Cu#$=uX+H+ D+ L+ @+=|+ ɡ0+=X+t&jQPP 0+u[50+h?jhh,QP 0+y"8h,hڽ0+,=X+u'L$dQP50+h h,hrdAPa 50+hGugh,hedA50+- 50+hYh,h2g$$t(hQP50+h$$ƒ ,>s1@![Vs ) ȣ,,,,? , ,,,,,,5,50+=,=,?wD,H,=L,L[VL,?H,) D,>r$r$D, ,,|+u 0+0+]u1hQPM 0+u25|+he50+N0+j50+|V +u Vh8 11h+t1A1A1ۉL$@1h,, ,h,=0+u#d+D,h+H,l+L, t$\F|$LSSWSjVst$L |,n 1QQWPjVsy5|,. |,50+j/V!t@UUUU)ʹ3333!!сist+1F,t!ttB,,cԋJ, T,X,1N,‰ \,`,h,1 d,1AhQhP,WL i-P,=d, / T,ًX,P+==w !r%1H$D$ ʀŸw1D$ $}ȹJ,yt<,t  ud,1I $L$9 P,11O|$ytyt F9u1H$L$$L$ 1ۋD$(1uhе$D$Nj ,1҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$D,-H,=L,X,D$T,t T$$T$@+=T+uu 0+; d,7=8+l0+_h"E|,81uhS|,L8L$(L8L$$L8L$ L8L$48\$81=0+Ɖڋ\$4PVQRVPSt$@t$,t$4t$,1K1Kޅ`1PPPPPP =0+8h1B,8LFu=8+uRhv%tajh1μWjWWWP+h߼t҉,u B,=H+u@+u L+1g=H+|,D$tD$|D$h] ,1N=t 蹵@ 1:WhVVWP+9tigfff։f5,d,L$ȃjP% D$ u hjgbh{- 1HL$ Ajhi1۾,D$,tB?t=kWUhs ,L$ DD 3$ D$tD$D$ u, d,1P,|(.tq<(tk{PWhsc X,T,P,t (BD$,T(2D$ TL 3$3L$ щtT$ d,T$D$,F9u߃|$~O1l$GVWh T$ L D3$3L$ tT$FЉT$9uT$1۹VWSSSP)T$ ‰ $DD$R @,=ue,$@D$ $#D$u D$ \ 1$L$19;ta $Ȣ,=@+uD+uL+u H+=8+t8,~ hNr,~lhmW]hx=@+u1I, ,t hMh)t,o,e$jit1 ,J,t <,t3$ D$ , u=d,5P,X,T,1|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ ,|$E9u KD D,DH,DL,DL /, ,WQD$lP> D D$EFI 3EPART3M u#E1M1 uu Wj` ;Et 11=P+t } tu$u SVRt$hUh3O ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-d,~x P, D$ D$X,5T,D$8t}t ։t$(tB,D$D$(rD$ +1ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=8+t-t(WPhU* L$ T$8St$,T$4$tD$XRQPGb XL$ tC=u=D$8L$XRPQb l$0$$L$ *D$ D$Xl$0|$$L$ tW$=4+tduD$P $OD$hl$( >-t+1ۉl$(-D$D$D4+$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$X, T,5d,t+D$t$+WWFuҀ=<+u)=l,u=d,%P=d,1<+1ۨuShͽP, :5X,T,tD:փ1VPP<+<tX=P+|Oh能P, :-X,T,$t D:$1BjUt$VP <+C;d,OXuVhI1+P'P, =X,T,tDփ1WP <+u, @,uh贼,uhNMtgh莼,=t$ 蹵@ Rhݱ^ hʱOhB=<+uB1B,9x @uuhPh=<+t<,PPh޻^_[]á0+=<+uxPh 轻5,5,5,5,5,h蒻5,5,5L,5H,5D,h<g5d,hcTPhqEh)8, ,50+5,5,RQP5,h{ hIH, L,5,5,RQP5D,h5t+5p+h>診 USWVPˁˀ L, H, D,1J,@,~t=u<,t 9r u֋ d,~:P,”>u~t:t  IuH+ щ $ L+t&=u,օ4$u ,G8+tix+Ȩuhh`t菹x+tj4+=u +Ѕ$tNt,=8+u"Ph,0hPhat x+ =x+uQ9$tt1x+ti +х $t4$P5t,hɶ=8+u5t,h1t"1@,=u  +,^_[]VPD$ L$ $QPWhS+H +~+H +0h+Ɖ t9tD+H +~+H +h+ƒ1Y^hjCUSWV1=\+˃y CS t ,5,11 uY1ɉNVt11@5C C+tPh8 hR1He^_[]SWVP$0+;0+u+X+u"QhmdP]{ y h|811h+<=x,u;5x+|- x+1PuhcV=d,~e1P,111 T,X,Pt,P,8C;d,|hA7Shx7$0+;0+u+X+u"QhmdPRz y hq7^_[USWVP։1ɉQPU+8 1O}t#Ë$8u8"u r1^_[]USWVP։ϋl$=<+T+P, +túrt76PSRhhT$7St$hwشD$7UPS\$ Sh賴7PUSh蛴77PUShu7PUSh]7?PUShҲB77PUSh7PUSh7?PUSh'1PPPUt$(SRhX^_[]USWVˉ1u=P+hT$$8$43|$͉=P+1\$tS|@tj!, Wh jjSPVhִhrWhXܮVp |$>)uhrWhߴ蹮 |$Z)uhrWh蟮 D$|$J,:I,H, G,l$M?>J,N,KL$ u}tGE)9H9^_[]USWV,։L$D$DD$)tD$Dl$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h L,H,D$HL$LVSQPwD$T$D$PVSUPwD$|$ D$@VSPWewljӸ1=0+ƉT$ L$@PVt$QR)wPSW|$LWVUl$lt$,t$,t$(t$@h6,h+jdh," |hh,X,\$ $t < uC{ - +DAu<-j D$$Ph,躶 D$$\$ h# S>K|$(@D$PhS+B $ϋT$ t։t=t$h SA t't$hSA ct$ |$@D$1=0+ы5p+jVWRuD$ՋD$D$D$D$D$$t$t$D$$  T$t+u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$ThS< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh1,V|=ƀ,t$Vh ѧ 5p+D$,$t$P։ω,^_[]hj3USWV΃ twttu^T$(|$$+t+уD$ ;T,L$ X,|.|$,T$0 `,|$9=\,|=8+u|$4u 1^_[]Ë-d,~} ʉ$9twP,|(tk T,t( T( (t1+t+9\$ \$$}2;T$}#=8+u6|$4ttD(OG1nF۹t(n9Չػ}n9l$\$QAuƉF,tt  $tt ^J, T,11 X,t$ -d,t$|$$|$}P,] ʀ|(tP T,t( ;L$T$|L( (9Ή} =8+{|$(t ;P,KC X,T,1$t=t T, X,S]=8+|$(5h,5P, 1l,h,d,`,\,X,T,ƆF,t$ |$(PF,9h,u85P,螳 1l,h,d,`,\,X,T,P,1Ƀ|$(T$3\$1 5d,n P,|+D$Nu P,[\$j5t+T,)؋ P,P|$(t$ hhj P,VfǀUh,L$ X,D$T,ƋD$$ȉ5\,`,d,11d,uP,=8+huպB=8+1|$(9 h,u85P,ݱ 1l,h,d,`,\,X,T,P,Ju UPQ$ d,1|$(tD$T,D$X,5\,=`,^_[]hj-WVP,t^ tڋt֋|҉tΡP,4 d, QPV $ d,ƀ^_USWV T$L$d,@hPhP,  d,P,~CX,T,$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRRk# P,;UjPy fDŽ;UtZF , M ;M;MU;; T, t+T$)ʉUL$  t+1 EE=L, H,ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! Md, ^_[]hjd+WV1=P+Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5+<tD~t@ uB 1u€πr<r1@^_USWV 0+D$Ӌ50+݉t$މ$!!jVWt$b!1Kl$ 0+0+uhUPzQ5+P ;0+u[jVW50+jb!1Kt?D$H5+#$SUPS 50+V50+K ;0+tÉ؃ ^_[]hjX)USWV$0$,1@D$l$D$D$ $1hWV8 suMSyj U5U6菧 áU68=L$90y8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-+)1<$L$jhQP4 h,hedAP` = ,A 9l$| 4 @f ,UjDž\$ t|t+H t+~l+H l+ hl+j 蓡jh,hl+ t+H t+~l+H l+ hl+j K<$ D$ttrt"Ph$D$f ,,Waf ,gdWPVy_ xnu)D$PhwdV^_ h~hV1^_[]Ph25U6hj&4 hUht~ j谑;uPh/hĻ+軜 j葑USWV\T$,< $S5 D$9d$ՉjRPt$ V^11 Sl$UV 9 1U\$tL$j@PQO 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4d h4T$l$  ,1ɺ4 ,1MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$( ,t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf  ,ŅtMaQ4d hT$ t tuf f111( ,|$ , ,0 ,T$4 ,5 ,f6 ,l$E<$g\$ttXaQ4d h菗 ;B Q4d h*r <$\$t4d h[R<$l$!F1D4  wPhV- wThV Vjj hC1ۃ|lu Ku1C1t\h Vߖ E9uVjjh C^_[] IUSWV$$0$h8x,1ʼn1$1@D$Rt$UWQPi$71w8$Ћo,1lj1l$DRWt$P@PU!aUD$PSh$Sҕ$#a0QSh$S覕<.Ǡ!w4| h$Ph,Sx  w$ 5hk_<t$uM55hrRPQh3"555WRPQhFS7hrh}S "55RPQhXSȔM8tDƔF1PhS裔 F;El0Ƕ PVt$ hjUSWV\$ l$|$t$1E1@T6+hWV~+ ou%jSh( 5U63w tEPv ǃuA+)ރu4t$$V4Nut$(t;^_[]h/j[jPhhĻ+聑 jWfWVt$|$ VWCt$?/tWh*謟VhC螟^_WhjfWVt$ |$7藸WVUSWV|$$t$\$WPVS$8$81EFuMjSt$ Whpk.uPjD$zKD$ jPtu^hzu, ,D$9WhyhaS3F j/P<|4$<Ƌ|$ \$SW[t\ NuZD$@u>=, ,L$:i0 PWt$hj(, ,{<|$\$W4$藜 WhyhS4$u hMjF j/P%;t|4$4$D jUSWV\$ l$|$t$1E( , , ,0 ,hWWV;( h~n3itVn, ,Ѓa~.btCd4 ,봃otBs< ,띃NuSU6( ,8 ,1=0 ,0 ,mjSh 5U6qs tHP$s EuA+)ރu4t$$V41ut$(t^_[]h/jbPh(hĻ+辉 j@~WVPt$jWV  9u9t x^_Vt$hej Vt$V~ t@^hV^Vt$Vσ t@^h1V|^WVPt$jWVI  9t9u x^_VhwjWVt$|$ VWzt$?/tWh*,VhC^_WhjkfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds hq-1VWt$ t$]P:1@PPVVu4u0u1OËPhhL PK; }D@u hhd  hhd S&; }D@PE,CEhpVR\$thpVh, u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph+%t9\$t h+\$pD$p\$D$D$ 9\$~\$~tSh(+\$9|1} t hOs+hW5l ,hq}4xME0;E4ru0h(+},u,D$D E4t h̓D$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tSh(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh%((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)WhdĻ+P袁 |$)WhĻ+P胁 D$ $L$t$}D@tCW&1@9tWhD&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$uTL$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$LxPttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2WhhĻ+O{ ;$uhĻ+jjHh ($$D$tD$|0Wh$ $tt$SWhhĻ+zuDt$ vhWx ~$r-D$ t$$$0hxj 3w}D@uhrhD$ttt$$DŽ$߬$$ڌ$ |$D$ \$$wF T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttPVn Fx HIt$41VRtRRP*t$ tPhAQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$Sb VjW@ t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjh͖}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8qWFD$(+D$L$,L$ ʃ{1QPWVthj1F\$D1VPShMD$XWVPSX%|$$u1Ʌ|$t1ɉAw1@|$PhCQMD$tt$5d ,5X ,5T ,t$\t$dt$<5` ,5\ ,Q5L ,5P ,50+PWt$L@ƃ|$4tV5DUSWVӉ $$)|$j W\$ SY Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph1L$8ɉ׉u L$8t 1@׉׉|$l$ G(8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3QPWUt$t$h QPWUt$t$h t$t$hcjfUSWVĻ+1F/WVUhBWVjhrWVj!hWVjhu WVSh`WVj+hOWVj;h>WVj$h:-WVUh_WVjh WVjhhWLWVj hWVShVAfD$t1B9| 0+I 0+1,Iu顴0+P: , 0+~ t1@,@9uUSWVD$90+1A9|G0+S: Ɖ<$~ SjV"" 0+D$~Q1ɡ,t<0+*tBEB(B$B4!؉B8<:tWBuA;L$u5,X 5,$0+^_[]V$, ,D$D$ T$ t$ 0+5,t$T$L$D$\$ $ H$^Vt$FtN H N tNHNfr v X VX  ,^VD$`sH) ,, ,HtP4BPQ@@1ҋ,v9t,,rhQjtp4F@,^USWVD$T$#0+5,tC=,11-,9| n-,9t%9P4uH$3L$X(3\$ t Fu1^_[]hhhhe3USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv 8 F V>, , 0+9|[5,tFNu ,5,t5FNHNFy F4VPV,@,1@j@P7 U1@P7 F ~4D$F(^$F0^,n#0+^8, ,t q4,^G FtH 7~ F^_[]É ,=hhhhѓhhheVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP ,H,N^,H ,,,H@,P , ,H,H4I,H89t;tprp,40,t4F ,H^hhh4heUSWV}]uuu W@t ,1@,1HCSuu WW KN0F,xNF4VPe^_[]vjv 0 fUSWVP|$g` s\ G4$O,50+w0VPww D$0^_[]USWVPt$ff` s\ F4$N,=0+~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j"3 8p ,HtƒQ ,@ ,^_WVt$ ,F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdQ FQ hjv` vbQ ^_XQ USWVPT$|$:%4,\$ ,$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4,1ہ=,| t Pt,,1t 98t@^_[]Ã^_[]`V15,5,hVh,A 5,^ft$ t$ j7SWVt$frLN4F,=0+~0WPvv 1` t\fv4V1AN4F,=0+~0WPvv 1\ 1;NuN^_[h e 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR)׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSW$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hNh?h h?]USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPQ3T$3D$M u1^_[]USWV(t$H t$2H 1hPW jt$ ;|$D$@G(D$DG,o0uFhtȋ1FVt RPbOdQ AuFV FVt RP1OdQD$xd11 |$D$$D$ D$D$D$D$ $uD(tȉDpTtt RP藨 tuGW l$ $BGWl$$tRPP݃1ۋ4$FÊM t19su)Gu7|$ \$'ŋl$F(|F}|F |F F$|$0tfhjX& ljPLtLXt uB\I\$$|$ C$|$4Nhh"j<1ɺPt`tLtt l$,\$(|$0uej*% ttP% ttP$ A 芇t u_4u_4_HoL_HoLUS6jjW'hjW>q$ 1=0+lj0+l$1 UPQSWVhj_$ Ë}Pw S P G1PWH¹tTt 0+߀<$u1 t1 L$QWURPVhj# Njl$hu P' P E1PUtA|$4t h3gSBB W*B 1^_[]u C4CHKL1}Mt|$4t7h?gt$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh_:$  $ Vx19tQRh1 1@^USWV |$,\$$t$ tCPPt Ttt4RQhN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthe0hl+D$(u KHKpStURQPt$DljT$t heu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh@ ,VRh} T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh D$L$9tQP$$h!t$Ht$L$tI9ȋt$ tPQ$$hYX1t$x- \^_[]h•hhhԔh•hhPD$L$ $QPj0+ XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tty|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$͖nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ b,LD4@hD$D$D$,$D$ 3,@o M|$@ t"D$D$D$$D$$uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D,uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWߊƋD$0T$UWÊƋD$0 u$$$UW舊ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPERP $GW #RPERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhTD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhD$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW蛅Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP萄T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP݃|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPH t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP諁|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP"$ D$TBL$?ttXLT$BtJ J T$$T$ QP賀L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV~D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h.hh hNh?h hNhh"h?<USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ% ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP 1 ^Vt$ V(1y?1I+F$ыT$ptj42QP 1 ^Vt$ V(1y?1I+F$ыT$ptj42QPf 1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD Ɖ t,U Ftf^81FFr9$|$<hhh h D$@X fLdttT$<<>H1|$<΋t$  ,uN ,NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPU $K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ ,{, ,\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$ Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(,y ,,Py`PD$@, ,C9݋|$j~h8h&hXh?USWVt$ t&H G;Gt=Ltt 1 uu)nHhi;)np^tSK"cs4S֫KjSw W 14uQPV uQPV dž^_[]hj|USWVPL$ D$HY$tVl$$t$$ߋ_GyaGu,WVՃt!Wt$ \t D$ x$u$u$t$VF$^_[]hshhhh USWVL$ |$o,Y$t3H1 D$9rW(9}{W8GpW\$SeGpGOQJ(uH R,HP G $fD1O,G,1@D$ HOqw|$~_W1ۋ*M WD$ p(H$ك9*vk$ǃ<u  tC;\$|$uW(o,D$ X1ɋ$L$O,)ډW(1^_[]hhhh?MUSWVMA4A|$u+q4+q4  CD$,{|$<|$ |$tD$,D$ \$D$~(Y 1t @L$ H1)FG9|VWh D$$D$MD$<|$tD$,I L$0D$(h |$ D$49}O؉D$ D$0D$D$)x\$ y$;z$v  \$ )yD$@D$|$ 9uȋD$40u~i11ɋD$0L$D$ @D$~@11L$ Y(I$|$u }4 }4\ FD$(B;D$|ċL$A;L$ uEH @T$ J II\$t# 3AL L$ E T$XtT$`T$@T$4ST$lS T$hT$TSlT$\@ L$ L$uSHL$` SpstL$X  t1ҋq0Q,IL$(t#L3L$ 43#t$( t |$ |$(*L$<tL$,D$4tD$@ t$(9rϊD$dMuA40 A40PA4D$|$u CHD$ CpD$CtD$yGD$ D$pPD$xPD$PPT$t< u6AWhV űD$ 1GtPhu^_V'\1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh+C< t< t< uh 2SƍD$$VhP L$T$\$PQRSD$0PD$PhD$@P! t$$$ىhrC< t< t< uSZ=$<rLjShShFShQht$<L$D$D$L$ oP tXljo 1tX L@uH~vCtTjhh+c V$^_[]V )UjS D$ D$ CD$CD$C D$C$Cl$UhrVd u D$CV莛)1$<;obD$D$PSh_ =USWV$0xjW ƅ~F$0h$1jUP ~4$hP C9uЋ$4h 2SǍ$ىh$0SXt| uƄ$ $0ph>QUmD$$0qhHQPKىD$PU!XPUSL u׋$0EED$1ɍ$D$ $PhSG D$PD$PD$PD$Ph S苌D$L$ T$ ыD$E L$ T$ D $A9L$D$uP`hhyC}Shh ShhWC $02t$t$hz$@t$Ph9 |$W}~14 G;}|V 1^_[]USWVD$(}~;$ ~VE pSBW $PjVWjS D$11D$D$D$D$$D$ D$hu Vuc\ H5$ D$>j 5U6PV Cr ,밋U6$PCrj hqVR ىVvS*'1PuE$ ~S4VbR $Ph)jSPt$V蕾 uVh1 ,WhjHÍD$LPSzu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA hQhr$PPrr @r ,r .%r0B$PPh%r0BV2 8YShA*r'r)rzD$(h{Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQh $Ph2Phr<rr hhjhr +rryt$$$PVWU>ލ$P|$xhPhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPg $PhMPhrLt PSh .1$P;$hCShrt$VWh9;$PVhĶ|$$Vh諶hPjhr t$jy = ,:$hWhrt$?c.\$j2 hWhrS$d|1$XAA$Pj2PQd $PhPhr9rhC$`>ߋN8՜ w PVh袴 `Ouet$$P\$ ZShsh$P\$;$PPhB VThSh*rt$  09rhh$\>$Th0Գ Vh$X~:$\1j h&EV= tQC`;$X|j 萲~-h_$`>VO`Ouj _$X1~$1:t @`9u9u$\Ph71@\D$,\$H|$PS$hjVQ L$,9F VhcVhrW hF0PhF0Pv,v(v$hbj xhK$Th7PhhFh V D$0L$4$PND$8FhVh(r WO  FtsSh-ɱ$PtPh谱hJ裱$Tt*Mbi)QRhUn j 脰$XqPShbD ]h2$X~n$1Wȃw,#$ L$7b!qv՜  }PRhǰ F`;$X|ۋt$~G$`>G8tu #P՜ w QWhq `Kut$hCVhrP>t.P9t$1 E$`$d $jj hG`QPjVUyjh`V1F V$`t$Vhǯ$XMbi)QR$\Vh莯$|$|$|$|$|$|Vh>V $\uM-1whb5L$!r$PPVt$h!11҉4hӀB9urt-QPt$hp踮= ,~S$h1h虮1PQh| C uߍ_ j 艭 rt$hVh&r@t$6>;$PtLt RPt$h t$ USWV`p׉͋$tphS|,$tSÃr t1C1|L$PVQc Ou vu hu Z$1hoVW owt1$0 j2t WC F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0GhhWB Ƈ$L$hQh+rU9uhPjhr U`p^_[]WV1VFF FFFFF hVhrQFĘ^SWV։ϋ\$1D$$jhLOSYD tVjhSED tBjhHRS1D t.jhSD jhqSD u$D$D$hPhrWhPhrW= ,t?|$tPVh |$u$4| Vhʪ ^_[$oWV荅ƿĻ+PhW  VhW VhW Vh<Wݬ VhSWά VhvW迬 VhW谬 VhW衬 VhW蒬 VhW胬 VhWt Vh8We VhOWV Vh~WG VhW8 VhW) VhW VhW  VhW VhW Vh3Wޫ VhRWϫ VhnW j薠VRhQ角 t^Vhj!5WVPΉ1WPhPPj PQ, u^_VhQj4USWV։ωl$PU\$hjSJ E9C ShcShrW Vh 芨ssss h%qss3h\\{tt$(Ph5 t$4t$4t$4h$t$Ht$Ht$HhD$8Ph$tVh%̧$4| h8讧$hO蚧Ę^_[]t$ t$ t$ l tt$hj3USWVӉύD$(jP>1t$`FFF FFD$hrV\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP"D$HD$PD$P 5 |$D$ fD$ l$ \$Tl$+D$Ty1 Phj($PT$D$ +T$(+D$0хyL$XD$\D$\5 D$XuT$hL$l+D$$D$ $߬$ ݜ$ܼ$D$pt$t$$߬$ ݜ$݄$T$xL$|l$x ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rhj$Pg DŽ$ <\$D9r< bU*yŃ=,u##,MIрK=,u }8$V+ƹV])uV+Wy $VVY+DžD$u hXul$VhhĻ+膕 Vhh$ P蛑W(yl$`t$Xt$T1ҋ\$މT$̓=,u#,MIрs6=,uA}t']hS`thBS`uWH(Ņu{D$TƄ ML$XE|&hP$ PhhĻ+苔D$+hP$ S( ىV1 D$@W'$WL'Ph,W $'hĻ+jjh@$W&PhW j)$W&PhWg =,tVhĻ+jjh`@,$Wq&PhW 6WKThĻ+jjh @,3hĻ+jjh?,ꍬ$U$P%GV%)1;$v7$5<P{3$P%$$1EhhĻ+jjhD?l$WK(_D$h9jUP~&L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=, ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$hS_Xt jhSK t ;/u f. Gf./WtSi9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSStH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 50+ #,H $s-t$$tHfHxt P2)1^USWV=,thl+jjhs3jj9#tvƃ=,thl+jjh3#,1GNIIˋ^s #, tVfV(#,ޅu#,=#,1WS"ơ#,Krk=,tV$Phhl+ ~uV7dV'%V`v v" *,F$5 *,vu;#,#,K^_[]USWVPl$#,M1t$"Džt.w w!ƅu hd9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=,tW"Phhl+裄 W_1l$$ttF9u t G9t$ Qt$h%*,hhĻ+=<$WbWE&F~X|$<thLV_VCbV&vfFt$ t$ t$ hhĻ+謃EuFufFFV!|$WP`WV&N=,1ۈ(*,$*,|NIL$*,h$*,M,*,ǀ$*,|NAMǀ(*,EFNDt$h%*,hnhl+1N1@=,1ۈ(*,$*,|NIL$*,$*,Wǀ(*,FNDǀ$*,|INOW,*,ǀ$*,|NAMǀ(*,EFNDVdPt$h%*,hhl+YC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=,#~VPt$hhĻ+Ɓ1t$h%*,h]a >W\Ut$$t$$|$$WX ƃ*Vh/V%]1@KGufGfG1@=,$ WbPt$h%*,hhl+Ut$$t$$|$$WƀH1@=,ىV_bPWh%*,h |$u V[v vY *,F$5 *,Ut$$t$$WDUt$$t$$W.PZN1@=,t-ى,VaPWh%*,hhl+؃^_[]S1(*,$*,|NIL$*,t!h$*,ǀ(*,APEǀ$*,|ONTt!h$*,ǀ(*,FNDǀ$*,|INOt(h$*,ǀ$*,|NAMǀ(*,EFNDƀ,*,t(h$*,ǀ$*,|MODǀ(*,ECHGƀ,*,[SWV=,thl+jjh,#,=#,1VWftmxtg #,W sJX tCf{u7=,tSPhhl+~ S\S [빃;=#,#,k5 *,tc~ tWuLfthW Z=,tWRPhhl+"~ Wy\W9 륋v$^_[SWV=,thl+jj h3* *,tS *,1{ t$C$Su[SFuՅu5 *,thTVKYv$^_[USWV=,,R,utDhl+jj"hmC*,thl+jjh'*50,t$G!jj#^ơ`,;#,d,#,,׋-0,WV]Ɖ׋ d,`,9sAWV2ÅuWVhp\ SPhhĻ+| c렉1‰1 u`WVÅu h%\CuhSXCt SZcSSPCcQPWVhhĻ+|:K0,9tPt$ ZU-0,`,;#,d,#,^_[]USWV=,thl+jjh(fX,jY9T jj\ʼnT$#, #,PQ\D$5d,5`,J\Ɖt$U9\ʼn$St$p\Él$9$\$d, `,9ˉs6fX,j8DTk D$;`,d,rM\$ -0,9sId,95`,s9-0,tS 0,E9ud, `,9\$ d, `,9ΉsZWVÅu hYSCPhhĻ+z cWV[Ɖסd, `,911 uU9t$D$ rIWV<Åu h|YSPKAc9-0,u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5d,5`,fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=,thl+jjh4%FtVPXfvu݃=,thl+jj hC%#,=#,1ҹ$RL$QtMƋhtDEt9VP|$ W.l1ۀ~UiCSPW+W em븋L$$; #,#,r^_[]SWV=,thl+jjhN$#,=#,rc11CWS5t:FfN~u %fFfthgVYSvuȃ;#,#,r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhV ~u,|$ t%hVRWh}hĻ+v 1^_[]fUSWV`=,thl+jjh#5#,5#,5<,hhh0+r,,  \.,4\.,^~4$D$F H*,|$\$ x,|,T$,L$(5,t$0=,,\$8|$4=,|$L*,T*,‹ $+Q Q,yfX,\,!ʁ@-5D*,pHulP*,u"M0蟗 PhhĻ+s H*,t P*Hu0h8+Uu hRe^_[]ù0+4+h0+h4+h8h0+h4+hj^USWV$ $=,߉+ft`hjVxH =P,tfʼn$D$CjPl$U UDD$fD$|9r9114+=P,tȉFffF= L,t>t=P,uFFF%)Fu9rV9=,tJhl+jjh^QF ,t(t$hl+jjhr)F ,1V9vtRPhhl+p ,thl+j v$ 9̓>t9߁^_[]áH*,tPjt$t$uù4+WVIAfF=T*,|CX*,)f`*,5D*,jQh\*,&u5T*,F1\*,PVQp =X*,FT*,^_ù0+Qh4I8u"h]h:5<,hhĻ+ojdWVjh0+@1t)h 4l t 8@ W^_V`, d,t7#\,=@u%o>`, d,t\,!=@t^USWV$$$ $jhWV88,\.,tE1M1 tmjWVS$8jWVS$8t$ShhVjV$ P*,U Rh5P*,DžtGhP:tShhĻ+6n 5P*,DžtGhBP9tShhĻ+m 5P*,[Nj5P*,1jPP60+^^$DOGrhPD$PhhĻ+m:hPt$V $(j7V@ P*,u D5P*,Nj5P*,j1PP6h/+^^X^_[]SWV׉1jPP16/+FF9tX\$)yWhhĻ+l %؉jQP6.~tF hP6 F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFhwMP7;-#,#,rv=,tUhthĻ+k \GP1=,t:PhPhĻ+k %1=,thĻ+jjh71^_[]USWVD$$P;_D$x/@thwMQr1ƀ81Mbi)\.,H1ًP1 t P*,P RV5P*,At\G9uGSVP t5P*,Džu*hwMD$Prtƀ8MbE^_[]USWVt$!M1 tFjhRWx3,\.,t(E1M1 tm`ƋU R^_[]ËD$0lw USWVX=,thl+jj&h,, 0I PhWVd 1^_[]þĻ+5,5d,5`,h)Vdp>0 PhT:Ļ+5,5d,5`,h)V\d4>0轈 Pha V>d jYSWVt$|$jhVW_- \.,1tQ1Y1 t ȃ^_[V'=4+#t14+PPV* V葂=0+#t10+PPV Vm^USWV|$\$1 tI;#,#,s9-=,>,QPWS,DtH1ًP 1 t@$Ɖ^_[]USWV|$t$ t;5#,#,rWVhB =,>,QPWV., t,QPjj+,GL$ $B,)P7V 1|$ ؃r04$t$jj*L$tH H t@$9t$F/NG>,9wVh@^_[]USWV\$ T$5B,uQ݋5H,V] Džuh@5H,7؋5B,9ww$(9v؉T$l$F$B,1 $Fщ;tsj/S*@PoPF~G Fw D$ \$؋|$ WSt h0?ى l$u|#,=#,ry==,>,QPjj3)tTH H t;@$\$Sl$U.Džu hn?n^ GFw8ShO?SwSFv1V^_[]USWVj/Q)1t.VE/tÀxtVh>߉^_[]USWV|$u h>WB,u`Ɖˋ-H,U|[ Džuhz>-H,)ًB,9w؉9vlj<B,|$B,WSBR^_[]USWV։ϋ\$ t;=#,#,rVWh= -=,>,QPVWb'{s LK$\=,t%[$tC1K 1 uhS9^_[]SWVt$f~thAV9~u(~thTVg9~ thqVS9FN tkQPDžuhV)99tt79uNH4~^ SW FtPhV8.>W'B,B,B,F$5B,^_[ËAP 9ttЋR9uIHËIH hQt8Vt$VB,B,^SWV|$t$ÅuhV,8;^ty^C Fs j/W&GSXB, B,W W3FV86P'1ɅF fN^_[USWVd=,thl+jjh=(,td|$xhW\ƅu0j50 PhhĻ+p[ Wh;t$ f #,#,1؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ#,$#,؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u#,$5#,L$T$9΋$D 1$T$|>,~L1\$=, tAD$t$ jjSG>,9|͋ #, $5#,T$|L$<q$Q AiP,T,QA #,#,QA@,A$t$ Vjj(Q/F @t330} Ph+hĻ+Y t$xh78V.h^_[]USWV$=,thl+jjhee1PPUS Džy020} PhhĻ+X Uh88D$,PWy0C20| PhhĻ+IX Uh7$jS^ ƅu h7SVWh xD$j(PWT y010Q| PhThĻ+W Uh{7W7,,RrD$l$T,=P,,$1Չ1 9$hĻ+jjh2jj5#,5#,>,jP] =,u h6PjPhHĨ^_[]fX,D$L$ T,P,D$L$ #,#,=,u t$(6t$pPhgS6D$ L$$ #,#,L$T$ >,<)=,؅~ڋ V;5#,hWgM #,@ $none1$ $ t$WD,P^2D,PƀD,= D,t1PPhD,%1PPhD, 8+lhD,hhĻ+*> 0,=D,vj21@ $L,e^_[]1@ $L,D$H,=,t$5H,hkhl+=|$u$f=X,u=0,uh:녃|$u*$t $~G$O,l=(L,8(L,jh,L,\$<$$U=H,O9==,t#-rPShhĻ+<)$O5H,$G$O8+x= D,o$P蹤á(L,t'f=X,u5,hh 9 (L,,EfX,\, #,#,d, `,u(L,jh,L,ZUSWV΋ D,P,9_@,~" H,1B@,9|uP, 1= D,tH,SP#H,SP58+葢 Nj D,t uF~B@,9P,}0~,=,tRhl+jjh @, D,1~9@, 9)J1ɣP,хhĻ+jjh4 pX,tt/uGhĻ+jjhb E5,h{ hĻ+B: 35d,5`,h hĻ+":hĻ+jjhK = ,uhZ=@, Wj5H, = D,tjW#y'(jPW58+!ƒ=,thl+jjh _=D,0,@1ɉ 0, P,P AD,  H,>t=,tPWh hl+9 =P, H,D,hQV@ H,H,^_[]t@, PUh k s-H,hh H,U h0\ Ph hĻ+n8 jD-USWVE,fX,|, x,D$D$ P,( tk=,thl+jjhR99(jtzwC@P$6C@P$C@1Pj$$!C@!Pj$$ u_{C@1Pj$$-!C@!Pj$$ =,J=,t&r;$ tPhhl+' =,thl+j H8^_[]SWV|$t$=$,tlP,WVhpP,P =(,uWV5hP,ȍ t^_[Ë5`,=d,,%0K PSWVh7 hĻ+('jSWVt$=$,tlP,Vt$hpP,P =(,ujjV5hP, !ƒt^_[Ë5`,=d,,0$K PSWVhl hĻ+&jtV,tufX,VVVC ^PD$L$ $QPhĻ+* XGPH ""\))%V=P,t114Bu11Bu=Iu1@'5,5d,5`,Ph hĻ+%1^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th WWNƃ=(,uhV(x=,t.u Ft#hWt9h(TWt'\$j SW $ 9uy6hU$~hWt@h(TWvt.\$j SW’ D$ 9uyvhjD$PhU5],v u ^_[2hjSWV |$t$ >hWt9h(TWt'\$j SW $ 9uy6hU$~hWt@h(TW~t.\$j SWʑ D$ 9uyvhj D$PhU5],~ u ^_[:hjUSWVh $(1hWD$ P' |$ |$ D$~P1ۈD$$,,jUh+褘 tjUh 萘 tG99ufD$u\$ tR$,4jVh\D EjVh, 4jVh 5\$ D$7f@jh0uht$Vj P5],D$^ރ9tD$j@hP ߉tD$PDaryDpriml$t?tD$P躢D andfD D$P螢DgrowfDnt$V耢D defDectsDuV]jhlP V5],5],5],5Y,h} Et2tR}jhV AH}j1hVs #}jIhVN Xt6Wh  Sh UփOut$k h@^_[]1hj蔗USWV}\$j S5],O D$t"NuD$Hj@PjSPhKj1$j$Vjj5],rF=tPhn D$D$ D$$fD$t$j VE 0_ 9 1L$81qAQQ a A j QV5],-D$t$ *jhE p薔  D$ @L$jhtjPjQ5],h hl+;D$t$H1D$`D$L'Ƅ$0VhQ`5],] $j D$tPS |$'y9D$(ȋL$; |"@D$Php hl+#j I`D$$<JD$ D$ L$jhtjPjQ5],~e^_[]ÄtH<t<u'5Y,h 5Y,hhĻ+U  P5Y,hhĻ+: hhjהE 0h`USWV $ ~($ 1j4h&諒 ?C9u1CCJt$LUPV CJjh'UVjS5],~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P5],5],5],5Y,h* vL$D$$jh'hVjS5],Ffȁw$VhUý VhU貽 ƅtL$D$jh'h$PjS5],]$f1Ɂw$PUhWh;WhvL$D$jh'h$PjS5],$f1ɁwhK;t$ t$ 1؃;D$ D$4ƜF>|$Ń @ h h5T ~y)L$ ^_[]ËD$,4hj膈hjD$Ph6lVD$P H PpRQh<9 tVhE&^h1^VD$P H PpRQh< tVhE^h0^USWV$Gh4 V Vh r[hoO yj hWO,@tPh<O, tPh !GȅtPh+ GȅtPPh> O W hVbVhXGtPhk$hVjWƅtVhj t)$1@9}$݀V` uC <=%:l9+Sh9>$t$މ|$=Hc,t9+=/Hc,D$(9+L$, T$l$hPRhTc,QWVM[MD$(t$=(c,|$t'+@DJ@ut1ɊTAu=,c,umT$,$uWjSt$8^|$=8c,Pc,`΀<$|$tZT$,$VWjSPiUtgHp St$0t$8$PVhlf,hTc,у *$c,T$,$VW1VSP5$c,Tc,C$!D$,$D$(D$=(c,t +1ۉ\$0\$&\$'rD$4SPVTR ljӉT$tD$p!ЃE8"70 PVhy 1<==,c,1$1Ct$|$81 t$4t$0D$(t$tt$pj,T$RɁ[A1OD$D$1D$ D$j=Q荁D$ tOAL$ \$ hCVIt=j,SRAL$D$"hCV21۰D$t$hc Vh>VРNh V躠ghX/V褠h V莠.hiMVxc |$$i \$ Ct$ɍQw1$ !>a΀-% plj\$ Cut$BT$ҋ $)|$4˭1ɉQD$PS  D$ D$ 938*蚭8\$ L$ D$D$W|$h S2Dh S;h S7hhS3h?Sڞ'h ?SĞD$t$ |$@訬1ɉQD$PS D$D$ 9؋t$8s8|$U1ɉQD$PS L$ 99։D$"L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShTc,4t9+h Bv 1<==,c, ڍt$81 D$ \$phjShTc,PVT$RWT$1BD$L4JD4`L$p$QRSRPVt_8c, 4c,u1$P`w ,!QhTc,hA- Hc,1<=4 j=Vf|9=,c, j=VF|T$81 D$ t$ hjVhTc,PRW4S\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LPH^$hTc,hAD$49t 8Vh0BS1JD$ $$Qh@,=8c,D$t$=$c,$D$D$,D$\$(V(bGC@D$p9VhBB軨0D Pt$h}A|$oQh@=8c,D$WSt$h>VD$ 81ҸD$ |$\$ Cj"$P ÍD$pWVPSt$ $P\\$ E $Tc,jt$tS7 $Tc,jWV# -覧0/ PhTc,hA B8c, 4c,$PhTc,hy D$ $u1@t$2|$ Qh?(11G|$1\$ tpupthQ`D$ t$D$t1@L$ ɉc t>PQ^Q|$t 芦8t1j t$ 4$`St$h0?FQt$hr?7.l9+m9+L$ L$ ف$K{8P|$WnD$ t@j QS_ D$ ;$|$8tQtUL$4 T$hjRhTc,QWt$N l9+T$ gL$4D$ Tc,1ɍAD$4tT8`T$ Q$QRQPWZc8c, 4c,T$J`w,!Pt$hHAt$L$ $d$ r $3 $tu¸ht ?PQh@|$D$u |$u |$TF1@]c t>Pt$h>$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0QhAܣ0e Pt$h-A|$L$lj% L$St$hN?{D$$!o1ɉQD$PS L$ 9t 9St$h?,D$ D$ D$D$0L$0RPQt$,t$$PWtBD$tUtsD$ |$Tc,jVPM D$h|$t豢811FD$&|$Tc,VVP  D$'$D$8|$Tc,jVP D$pTc,jVP UD$1=8c,D$44$Vt$h? Ph>=(c,he^_[]4$h@ًt$D$t$$t$SZ@9s Vt$h@ SZ@D$t$|l1ɉQD$PSLC T$tD$pD$ 9t8u?8 St$h[@Qhy@1ɉQD$PS ƋD$ 9t8t}St$h?St$h?D$t$։D$踠L$8`OGL$0d$ rxL$D$nT$oL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hO> j|j- PhTc,hq> h>h[AhAhTc,hx6SWVPD$t$|$L$ $QP6729w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSDS1Ht$L$ltT$d;WuT$h;W(u Q0  ŃtD$ppPU9x D$DGXHr Pz oXd^_[]USWV$l9+d,8Tc,t d,/d,ShTc,otWTc,މ)ˉESQ|$ Ww DWd,V09VVfǀd,/SUouTc,Uhd,8,^_[]USWVhT$D$$7p!1Chd,VD$ CL$;rjt$Vt ufD$jD$Pjhd,V t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPlcWt$h7|$$j@WVPOcWt$h7j+LWVPt$=h9+PhmW} (c,t5Lc,Ph=5h9+ZD$$PV5h9+ Pc,^_V΅tOHw;s1c, Dc,te0k PhTc,h=M Atʡc, Dc,t"講05 PhTc,hy  u =(c,t^jyUSWV=8c,ˋ}4c, j tuQhmغb5p9+Qh5T迺 IWVD$0L$41|$VVRWQPKt)L$$<$ug@c, USWV$=(c,t  $D$\$脎1ɉD$QQSP$VCjHPWU2Pt3j$Pt$S$U P8W$h<{ =(c,vjߨ11ۍL$l$ PSQU$VrBtct =8c,9$$D$tIt =8c,$,@$@rt51t ttt ttth>= 9uЋkT ;$tl  1L$D$Sjh}Ѫ {t+1:LtPhg=諪 G,;{r܃TD$@TL$9uj 裩V 1A ^_[]hTc,hT=+USWV }=(c,t D$ tohl=WVxtcZ1ɉt$QVW:( T$$9t8u08,Wuhv= =(c,j11CL$ t$PSQVuu:tWt =8c,1==Dt u,ND!XDt u,=,t8=g,u/K u, u,=u,u u,1u,ru u,r⹀u,t8u@h,u,r⹮ qu,=t,tt8u@h,u,rr: u,t8u@h, u, iD $u,t 8t1@ $u,r1(u,rlDY VWWh0u,h,u,q  V50u,5,u,h8u,h4u,H V50u,5,u,h@u,hXu, tÉ\u,rtƹ=t,urt‰hrƉ5`u,>u (,^_[ÉoDPu,z8{lV t<0 1=t,u V ^USWV׋t$$\$l$;Et*+u(rt D$ L$M^_[]USWVր9tMτtC1pu,2U5h,W pu,1pu,U5h,V ;pu,|ut$@h,^_[]Ë u,h,USWVL $։ύl$ D$?hDW)?SWULL D hj VUX $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$Cxt$4hj VWƠ L^_[]Ë u,h,V=,t =,h,=Т,uF u,h,u,8t!u,8t=t,u Xu,1BHh,=Ԣ,u u,h,b=,t u,h,Hdu,=|,t!=h,|1Fj 2F;5h,|^Ë \u,1B^ Xu,1B \u,1B=du,ug=,t =,h,uN=,t u,h,=Ԣ,u u,h,=Т,u u,h,du,Ã=h,"du,Ë Tu,1BY `u,h,Ht$j5$u, 1B)=t,tË Lu,9th, =p,jË u,h, u,1BV=,\u,tXu,1B5hu,t-F=t,u,tu,1BV^Ã=t,u,tu,1B^_`` hu,t 0u,1B>hu,t Hu,1B'hu,t @u,1Bhu,t 8u,1Bhu,WVD$ #=$<+ lj Ƌ 4u,j" j VW x9>u1H^_ËL$#$<+ ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th`` V]trL$PQV t4uRL$xD $x2P DT$x D$x Dw^1JD^aD$# $<+  hu,9uVD$ T$5$<+! щ щ! ‰ 19^Ã=9+thvDË Pu,1BSWV@΃=9+ttlu,tVs\tx1Cj S*VGV#SP_GVh6PH lu,=lu,!Vh{Dj@WvWZ@^_[ËD$pu,WV99+t#֍|$RQjW41B$59+^_Ãw!ÉfUSWVPt$ P!уtRPtt jhDjhDl$$\$|$Q t^tY9uE}4u ;Ճt(ˉ $19u tC ;$u~2KՃujh Et jhDjhDD ^_[]1ۅs IQRP踒fVt$t=9+tjhE59+^á9+xy=tu,uE xu,0@#4@u.tu,jh3E?t 0,t9+P 9+5h,f h,V1N=xu,t9t/ xu,,@wB$@(@1҉,@Ɖ^USWV=9+xu,@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhEE1@$qQ59+ 9D$}xu,럃^_[]USWV-xu,1|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}50,(xu,@9@S xu,1JЅt8=|u,u/@u1u0@4@ \F![WVxu,1t[@t @4v xu,4@0@{!уt RPF1G)t 0,t^_USWVxu,t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHxu,9t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë xu,t$@(@ ,@1HUSWV5xu,1H(@$@9t#H1ًP1 u,@;Hs D,%D$z9tG1؋O1 D$ ~9 $tG#G=,t @t9+x9 @}lh j֏ tH @1HGG7FGF8~FNOG Fx ~,@;GsN+,~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@J!ƒ5xu,@@9+tOD9+Q@u;G  )RQ@w u&xu,0@4@ !OD1@l$1tʼn$yjhE1= h,u 9+x~OUQP 5xu,@@o<$t0@D$4@=|u,tU=,u#L$ Qh ,j2=|u,t=,u q=0,5xu,9>tOOHOxu,5xu,wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhuE @,1H^_[]USWVxu,ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H9+áxu,@u1I4@0@Ë9t1JQQ 9u@o xu,4@0@1@@(@$@,@PPP@KG!ƒtjheE81PPjt$!G!1WVxu,0@4@!΃t@@9} 0@4@^_SV\$t$ 5g,({xu,h8@jxu,@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV0F!ƒtxu, xu,@P5g,vzxu,@u@^[SV5xu,@  ˀuH9tPQP P薐 dž @vv Hu5xu,@uE u@ 5xu,dž@tV7 1xu,P5g,y^[áxu,t@1fWV|$t$ t=u,ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVi.tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hrj hJlLhv,hv,hw,hw,\$ -uF :tjhJ]jNbt'.t5v,bt0:wtptcu+w,F&jShv, w,jSQ ,uFv,v,v,v,v,v,v,v,w,v,w,v,w,v,w,v,hZJJ1tPh*JJ1F$<+Vh5JWhu,P(h>JdJVhLJWhu,P ^_[hfJ>JPJj3輣 1B thrJJƅu&hyJIƅuhJIƅt]hHVyu6hEVyu$hHVyuhHVqyt1BEw1 +TA ruƀu,ƀu,ƀu,@=u=u,D$u,SVt$ v,M1ۅuDv,;1Cu1G+(u!=,uL+ 1ۅÉ^[D$u,ËL$=r!=u,tP5u,j hv,1z'u,u v,v,uv,ESCv,Ãw@u,uQhVJVPt$ u v,ESCuw u,u;Vt V5u,B$v,xPV@,@u,uPhVJV5u,j hv,[yv,^WVD$L$ =u,=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$, !F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=u,t'~3P19wKS>~-19s2C,9r9v)CK$SU(>uF8AUn Ve o ɋl$u9tSv =t1|$jjSOF ~.EFE0uE^_[]V4,t";TL+t1FVhw,P/ 4,p^USWV\$,=u,tV,,tgفuHD,J D,<,19*Qh<,~-,,5<,1E4,,JD,<,1E,,=(,u (, 4,1҅; .uD$ L$PjQ课 $T$e^_]Ë D,1; ,,|w,á4,t @@@ 115[1PPUSWV= h,׉΋$$L$ D$1AyōD$PUw#D$=xh 2UhUu W$ShUv 0jh,KUf ShUv D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(L+D$ $XL+D$D$ $Uj $Pt$Wփ ShUu S3<1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV= h,o=8L+u=hL+u =,P1TAP@PjVP?ZW|8QZtQL8hWfÉ4$pu1ND$PV"x#D$ =uhV} hKa0tPSƅdո(L+Ex uָXL+Fx uh,KhSe T$Za]VUh@KS:S:4$VWC Wr V~r Ā^_[]SWVhcK/P/tt;^_[&h V01ۅt+h V0tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(L+tXL+u%\K+TKQhPsd tWhKv^d Y=8L+t"hTKhv>d V(L+=hL+t%h\Khvd VXL+^_[^_[USWVPӋl$D$ $uSPSS1tD$ t}t8^_[]StV믉hw,jPN SPuSqWV,8L$ Ƌ , h,9}I9u,xtWD$,$ ,V,8t,t$<$PD$,8uڃ^_SWV w,$,$ h,+ 0,|51ۉ|$8tZO\$h,+0,$9|Ӏ8t-t$|$D$|$D$$8u$w,)ȣ$,5,^V^_[V5,w,tR,)Ɗ 0@u L+5,A=,w,"8,=w, 1@^À=w,t8$,, L+5,8,1@á,8t AUSWVPQS$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhKO+hpK@+VhKP@ Åt^_[]jhKWz@ t VhKPe@ Um uhK*VhKP:@ ÅuVhKW%@ WV9G t'փtPhKV*` G?G uG^_Ðh,i ËD$u5Ã<`+PhKUSWVD-Dh,ÅE\$9uz$1ۀ|tisljDDs9u>rjjx l,l,$t,tV#hj:} =0,TeuYÃ=0,e4΃eh,~o6/=,u #=, t t =^=,;,Ct}.CЃ jS&ed~h, |,x,=h,t h,5=h,u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=h,ih,ihjjS\Fc`$ != h, ёt;-lL+5h,=ES[jUY  xSh,H݃t =,-p,>!(Ƌ L+ķ>tjVUP t j=9+u J[\ L+jry C$ ! 5h, hL9h,9Ph,9h,=,S,C1Ƀ ,,ῃ5,5,h,/U]VsWWr!2@*=g,%q,h,7@,h,hjj,,n= h, 5TL+h, }hKh, _ghM@ y1PPv@,1; x,p, |,H|,x,/= h, h,%hL1PP9h,9Ph,9h,؉ك u. u.S莍i,5lL+h,%aihё{jVy,, PZw p, *,уBЃ@*? !1҃ ƒ!D$Z=,,9h,t 9Ph,h 9h,W jh Mj#t$(V,QOVrlp1BsRtM&=g,=h,73p,Щup,Mj5t5,,,,,P,j)eD$t Pj{@eJr蘬 L$Qh1;x,|,||,x,)O=ܢ,x,u' |,|5,5,zMx,jjP1;x,|,||,x,跷ݫjj蟷ūD$<`+D$PhK= h,jhKVR |,x,, |,x,,x,1ɉ |,||,x,1@Pe(ejhzLe1;x,|,|Yx,|, 諶Ѫ=ܢ,u5,5,Ljj- |,x,ʃEݣ,c |,x,,,  ,1; x,p, |,||,x,q j5X`hLr1PP?ùe9h,e9Ph,e9h,e e S賁+̲1PP5 ,n豲צ1PP5 ,jP#'x,|,ؽy蟦=ܢ,t5,5,Gjj5x,d:0ؔx,|,艽*Pjj5x,9; eS贔D$D$PhL{豱ӡx,1ɉ |,||,x,1@P"etbt3tFu j11A; x,|,#L|rL$Qh+L11%x,1ɉ |,||,x,1@P'"e11A; x,|,#L|rL$QhKLje5g,<h P&5g,1=tjhKo5lL+h,nvhё1SVUh蠻Ag5h,rSPx], h,݉x, |,,9‰}x,5|,)‰,@,e, h,x, |,,@,i1|,x,15Ģ,QPHFjhjLH3D$PhLd ։u=,tx, |,,e,5,5x,tI~V8JjhKbUSWVP趮ܢGVD$1Ƀɉlj щ ,,|u,=0,uH9ljD$u21xUUjn6 9-0,u;=,,D$t|u, 0,2t8teue^_[]USWVPӉơp,up,1 r4$0utV4$#p,p,1ESWPO áp, p, ,tu1Fx` sKu j]j%u0SW5p, áp, p, ,ujhyMt 4$4$^_[]WV=9+u=,t =,h,u袬׮t $h, h,!ʃt]5(h,QY@,u =9+uP5|,=|u,|,|u,u _BLE5|,=|u,1jPPB ^_SWV,߾ t h,/ V+=,u V@t hMt uёM@ P1<,PP^_[V蛫ơh,"~S.#V$^%= h,,VPujh*M  tY>!t ,t PM V!,= h,M,.hMqF<+t< t g,t Q{M V菛g,/7E= h,V蜭h$MPt% = h,V^Xx,^(N5x,jF5x,jQP軯^5,V5,5,,73p,p,PVg,hMhrr^SV p,t s7h,Zbp,sh0Mip, sh;MQp, shGM9p,thSM#p, sh]M p,fyhhMp,1Ct$‰sShnMjVw:Vp,CuϹztwM svMQ<,^[fD$=u,t@WV|$ Wjeƅ~WhV ^_USWVt$0l$(|$$t U,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD u,H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW^ t W%` WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f , , , ,USWVi $AD$)< u?FP貛^tP9~\NފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]VhhpL+hhhN+hMhtjPV'H jhMhMhtjhMhMh jhMhMhtjhMhMh ^Vt$ t:j j@ tL$HΉp ,,jhM荞^Vt$ t:j j@ tL$HΉp ,,jhNH^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVF 1H^_[]hDN t8tMjQP[ ƅuhKt98t4jhTNP/ ǍEjPW WiF iUUUSWVP1F= h,jt$覠 P#19jV:? n1PPPS!ƒJVWS <$S 11 ?$:81xM'x+xG1O|E(|n|dȃ|$,t,Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTWD Sԟ 1N^_[]4$iD |t|uVP11xtɉSWVh,t$b<ƅui\$h,e5,PSh,I5,P|,t,h,5,p^_[ËT$ ,t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=,ÃB1ۃ=,ÃCɍH9 h,~Pj#|k@,SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=,ÃB61ۃ=,ÃC%|$mu9h,~HPj#j@,؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPD$X9vpG$11Ʌu2~>9sWt$V t't1:%L+1F9r':$L+u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQit1=L,ƃtEuG%t|QhOhhk AVh6< Eu ?=u Qh P$ u 覣!ƒtVHQhO^Ã=L,t$g,tPP&t5g,ËD$t5g,PF$1PUSWVu195g,Og,t_jP%=g,tJtWg%W"=g,u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =,uID$xAP^t4D$8\$PhNFًT$WVt$j 1@t=g,jWd$5g,t$V$t$5g,g$5g,$h h,5g,#8h,t$ t$ ۨ`,=H,1110,D$4PD$,$jUuWP W<' U&ڃ,$C^_[]SVt$ h V1Ct'hACVthNV~1ۅÉ^[WV$ VtVWVW tWt^_USWV 1=,]= h,Pj\h L1Ƌ|$ 11@L|uM@-u)Fh W)1%tuQ%t s@AAۃ\$WV跫W謫؃D$jPtWVt$PW% "Sy% 1tXt^~u1O\$$D$jPW uQD$P4D$(0 ^jhP4|1 ^_[]ÉOVQ;t;VQ1|$rɅuŋD$(N1O;PrS$ USWV= h,t^_[]j荈hPt݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhPU{PljD$UV WS\$,8jUHrS\$SVUP4$# S# \W# VEP V|V$*p#N@ |^WV|$=,taPWo1=,#D$=W*jP`qWP hPO+LPWox#D$=@{W跨jPqWPM h@O+Vϊ  WoƉ|^_V|$PVx D$XT$\1jPPVf|^UWV蒊lj5g,# QPnt1GL$ T$3,3 ,1@ u,L$3 ,$3, u!tL$\9|$X}e^_]øQVt$V覧9vHx/uAΉ^fVn 4,1ы50,1 u^ã0,4,=p,t^6~^P~SWV1ۃ=|u,t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=8,t8,USWV-,,~ON}=,,~Q111SWuljӉ:}qF;5,,|؃=0,' =0,1=0,|=h,111;5,,| V|ljՉ!<$=0,FD$1;,,áh,D$ t,D$,D$$h,1t,,PPSUt$ ljՋD$ h,D$t,D$,9pt$j pF1Mh,H91Z{1@^_[]Vh 2F;5,,uj{ t j2^USWV\$,=8,t8,&|$$t$ l$h,t  $9~ ,$x 9} H9$!tT=\,t ,tC`,1҃=|u,TRQPWV脘WV Ɖ1ND$(D$<$=|,t7h,H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=|,tzmz1@D$/1@D$=|O+uu=9+t hHQ\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|O+ g,t)!u =|,u=,u8,=,t Xm<,9l$"h,HPj-|1Ot1E1=,,~1VV|{~ VVVD5 -|u,t <$tw y|O+j@ ^_[]USWV=8,t8,41=(,u!,y=|,t h,'|$t$;D$||$$t D$9h,~ =,,É!tF=\,t ,t0`,,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=(,tá,y=|,t h,ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åth,HPjytm=|u,tPay1u11FUvUVRPVjv!уu 0,tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V h,~&111RP!уtF h,9| 1 h,19^fVt$tsVGF95g,u#1=O+tu1ɁO+tщ g,AF=O+tH D,v  v ^ ^ËD$O+tQ1O+tЅtË 1O+tËD$O+t 1O+tËD$O+tI1O+táD,USWV\$S@Nj5O+O+tv W6W |$j4j'fSeFSF 1HF$F F1FFF0F,O+tFq0@@F=O+t@D,VEES?ËnU19Ë\$sU- SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t PC w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=,jjPWV^_USWV,T$Dl$@ظBӃ=\,t  ,t0`, @1)ʉ|ЉjSUQP虊كQP4v=,tK uu|| t u+| t u0,tt0,}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t0,ǃ݃ tkwRPW v=̢,t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N , CfN =,=̢,ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1,l$t$1E1!1M,^_[]Ã=,t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy59+=9+H~y@wr 1N59+=9+^_[ÐSWVstjhXQc^_[uƉסh,HPLi11 u^_[8iWV!Ӌ h,It*QRP4 h,HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhRbKy1V[hVjRPUo=ܢ,jusj'hD$ jhD$T$l$ !Ѓtd9}\h,H94$SW!уRPvlj9Љ $Ah,H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$h,1VVjt$t$PY95ܢ,^_[]1K16-8,-@,h,H $)QUjSWP(1K[6=|,tf"g15@,SW=gh,HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9T,EU>$4,$tt=t|<9T,|wC^w \$D$ShUjW$4,$Uf9T,u+9T,}9T,t9T,hu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuUr6$4t$ t t_G칆Ur$40tUPtuUdF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVjL,^_[]SWV׉Ή5P,5H,hqUhS<=w )WVRQL,S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸlR+ t^X,X,Y,JtGtO GO X,Y,lR+ tX,uX,^_[]ÍZ w6$`F!tEGЃTZ$F!btPeu>fX,랄tGOm>2놃>4w> h> YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]X,Y,d   >X, X, Y,Z,^,RhUjhX,UX,_t>rvVhUd,P+t d,9ihU蹻h,Pt h, VjVLl,jVLp,5`,h,h,1,PҎ $u(,^1|$á0,4,St,1,x, l,p, x,x,@x,;t,|1ۉ8,<,@,D,H,L,P,T,X,\,`,d,h,1H4,0,h,#h,,P $u(,[USWV\$0l$,1=,uSUƉס, (,SU\*@u6 9+9+!ʃt'9݋T$0|9+@9-9+T$0| h,=,tU th,,Z,|,,, ,9}Q,Ɓ|, ,ك=,WV^! tt$j VRP)NVƁ1 ,)~$,r5,Ƃ|, ,Iu܅~+1ɊT 5,~=,|,,A9uס,H ,ƀ|, ,,8,^_[]Ë ,t ,=,t1,@V5t,x,9}9 p,<u"l,0Ph, p,x,F9|Ӌ5t,5x,,8,^SWVt$\$u$D$0j?oP聀/=u,t&v!Ss1҅ SVqt1҃Pn1҅t$Stx,~- p,Vt[up, x,LV3Zt x,t> p,VtV[t'i=u,tVs1҅ƒK1JFVY# t,#t,#5t,#t,‰^_[QY# t,#t,ʉ# t,#t,áx,l,8,p,ál,x,p,8,ËL$1wQ5d,萗1SVt$ 1ۃw)V5d,juV5h,W1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ%V9u!B1@uDA;1A+u%uVt1@^ÃwV5d,wu߸ع#L$1uj jE1ɉHHs SWV=X, u|$t$\$t-1 |15|,5x,tm1@Z ugX,t ,uU=P,~+, ,\@,P,X,5x,=|,1X,=u, P,%=ua,P,,19Rh,bmh,m,5,5,, ,H ,P,u",,x,1WV=u,t ,1At^_[ÉШu-%=tS0lP,=,5,뢋, ,,P,USWVӋl$,|$(H,=,,uBu>%j jzC1҉PP,`,H,H,twQPl'UWS ,xtd,Ph,蔅1,H,u+P,t,A\$l$͉=u,1؋5x,l,H,Rk5x,UWS% 65, ,,PV軄(,@,VP诅V荄 (,AVUUUЍ@@(,D, ,9}oh,藅ơD, ,Y$gQVlu&l,x,PjVPmL,$#5l,,9|x,l$ EVjUek L$ )v %uh,蚃5, , x,; t, 5l,|tq=p,0jf jp,9u"_l$\$u4Шx$_l$\$u$5l, _ ‰$ u*T,t =,uKuG ڃ^_[]u,m_uiud1UWj8,+, tR+`,91J$;d,} qɉы4h,)t _l,\$ PjSi 1EL$l,) x,PjS`i ǡp, x,tW4V)8,~ZL,t\ [5xR+)Й)֋$F UWh N1H,E1-H,$_PdtUW ]u,t6=,t-QdtQd UWl $UWS t1@1^_[]SWV=,~4։1,Pd VW u C;,|1,)^_[Ã=P,~, ,P,1WV=P,~, ,mP,|$t$ =X,uu 15|,5x,itb=,tYD,h,98,|@,8,<,x,Ah, D,H98,}, j ,,jf=(,8,tLh,tBx D, h,9}; j,8,P D, h,9}h,ы D, h,9|L=t,tCt,„u0=,t't4|$t- 1j1j 1j5x,95`, ul,0p,^_V=,uajm5d,tMȺj9DFu=d,u"Ⱥj2VFu^SWV։ˋ=x,Gx,9=`, ul,8p,4D$ 8,; @,~~ @,x,<, 8,^_[SWVt, x,9}1T$5p,ׁtu Ӊ x,@9|^_[ËD$L$ |,,VD$ L$=T,u=آ,ttNI1҉ tK1G,9~,|,+5t,)΋ p, l,0 ~^T,D,USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t80,u/`,H9| Qu@l,8GO1H^_[]cS l,9t l,Mtۉ>?SUSWV-`,\-jS jS DžtVtRU5l,VC p,UPW. U 5l,t 5l,=p,`,1t WQ 1Gt VA ^_[]USWVL$D$ʃQPO1H…t$=`,l,D8OlV tn0,uc~l,>-`,u@l, (I=`,9rHŠIJl,9s=`,)\8OVà uQL$ t l,t=`,91H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15,1K,|EtESSP t衔,@ԋ=x,9=`, uS1Hte1ɺ|R+:tWAuN1|R+1I:t?@u21|R+1I:t%@u1|R+1I:t @u^ËL$H1Ʌx R+USWV։Q4l@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=,u1@$58,+5D,~1; h,^USWV։L$|$0\$,ЃtL,!t6tC؃T$RjQPWSQ=(,=`,1ۀ=\,tw4$\, (,ىȺVUUUЍ@)I,~4,I,1E 8Vt$0j* G;}|Cu4$SG h,tf 񡜃,,!Ƴttt$,9} 5,=,\,1ۃtQl, x,T$ 1ۅ~&L$ PjQ\ x,~p,\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1ED,;,uX0,#4,uD$,0,=4,=,~01, 8jG;=,|h,t8,;@,~<$~@, x, <,$8,~1 ;j_G9uD,1;,uD$Ph,tx, t,9~~51ɋl,4*1 p,444A; t,|١x,) $ D,x, D,; ,~(, jD,HD,;,؉^_[]WV|$t$ =,u1WVP PV WVt1@1^_Ð,H ȁl,r1l,,,,,, , ,,,Ĝ,Ȝ,М,̜,USWVL$0D$,l$$,$,,t-9Br }$r1z3|$( H,u$$r,t :=,,,<$:rBJ jl$(jW,tC:,t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?,t_ )ϋ,$]},t,tV+BJ NF=,uW-,MEu$9ˉ|-,],$ϋ=,t sKӋ$JHJ^_[]USWV1=,tD|$(T$$!t3|0,,=,t'9PH }=,u11CŋE1ЋM 1 u ]u,ܜ,؜,,EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}0,!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[0,u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt, 11؉^_[]Ã=,xÃ=,u @,1,Ph2V4V,xNH ,d|@,* ܜ,5؜,9|jhJVz5,^USWV|$ l$1Ƀ,,tKC9⻴,̜,1 М,1 5,v vB1IʅI~nVv 4$9ʼn1I1PPt$R90, ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R0,uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=h,~%GW8É!Ѓu O;=h,|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhQ2,1111ۉu WVSU1PPWV+0,u Ɖ!Ѓu,^_[]WVT$D$ =4,t 5,,1)|щƉ^_fUSWV t$ >-uF(s7hё+V+h2+艣D$1S6]+S)S\^S8 S45 jy Wb8 hwÀ8t>tkV聪tmSʼnD$_$Uy_ $ȃ$jP'袷t$PSh?Qt$UTt$E  Sa'Ņu>tVh#qF'U'E U jT4 W7 WB4 1FVJ]V'D$$t*P*hcVy*/j ))3@,t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhtV.1N\$hS 4hёQ)SH)h2;)3(1S|&S[jj 71KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS4jhV1KtL tGf;t=ËFHN~ ;F~à tQu VSV1Vj L1GWZWg%e1=@,VZ^_[]fSWV1,1K4t 5u'#ar'G__ _Gt P GF6u^_[ËL$ 1ɅV-$t:,'W.t7^uMg,,1,, ,g, Ģ,,1,, ,,t P ,Fu,~1S薺PW豺Fv ^F~ ^v;g,t PNu VSWh ^_[ËL$t@;g,tjhVx)1HËA QUSWVD$T$1ɾ,=g,9~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9,u ,,uUSWV\$SκƋ,t@PPVGu,, Dž,Wy u^_[]USWV=,|$,t$0hW l$,,!ʃtWj UQP",u, h V蕏t,VU ,PhVWu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=h,9Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P  $FQF^_[]V= h,tjhV&dt$D$tt/uKVh,;m?u7=9+xCjh'W뵃=9+x%h,QhNWl&^jhWjhBW{Vơh,t P VޣPh,V 5h,蛙 ^3h,VD$$L$ t tC8.@L$$Vh Q S+>jh\WS+xxPhWj VgVNT||P|0tB D$0PhW;D$$Vh P >t.jhrW1Ģ,L$QhW$^ãĢ,S+VS+x$ h,1Vh@BVPRQ_Ģ,^VD$$L$ t tC8.@L$$Vh;Q S+>jhWS+xxPhWj V.VS||P|0tB D$0PhX;D$$Vh;P >t.jhW1,L$QhX#^ã,S+VS+x$ h,1Vh@BVPRQ&,^V|$u%t$jVt0PhCXN#^V|$u%t$jV؇t0Ph`X#^SWVD$L$tP,p= h,tjhX"VP>PR Zt V踘)X!ЃtV谕5Ģ,SW? ^_[VD$L$tt\uoPe0`+_Pơ0`+t=(`+t P VӟP0`+V 0`+QhX!^V|$uJt$ =l,tVg,-,hwM_V_h@^^WVD$t t0t$Ч,l7=tDMtGhuXF `+P,Ч,Qh5!Emtwt su!FF`+Fا,Fԧ,F$`+7 V^_D$u5,6Ã|$"7VD$Hs^\jhX7<`+V)h&PhXhXV!O;`+xu'hXh1YhUYhYhYhYh0Zj^^WVD$t$ʃc"y$F!m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ= ,utjh|Z$FVPMy0PhZ^_ÉPh_ZUSWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;`,~d,A9s } uE9u9t},u E&| tR+`,+\,xR+ ^_[]WVD$Pt t*$TVALPVLD$ps D$ stopD$Tab =tR+|i1Gt$rVKfD,VK4d,hrP= G;=tR+|VKD andD theDen t$VK5xR+hZP?= 0PhD^_à D$t t+uyL$tJQtQytWjhZMà$L+L$%L+AAD$Ph[!%1%L+$L+$L+%L+ $L+%L+ V D$t t]D$t$jhg_QVP46h V6t5>t , $,8,tP9, L$Qh[O ^ËD$Hsjh)[/Åu h,Ã|$u=,D$u = ,~GT ,ÃD$ u)=,| Ph:[,ÃD$ u)=,| Phg[,D$u"=$,t=g,t*!ƒÃD$ t t%uCD$ S+^u2@t+$S+"S+P7Qh[V D$,L$(t tC1ɉ ,, 0,8,uT@L$,t$VhIQl >tejh[Ot$50,5,,h&jV\0Ph[#t$D$,VhIP >tjh[9 ^ã0,,,D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$hG!d~&s wR$G!s wU$@G!gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G@,1 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh\1QZS@,^[ÍD$Ph[҃=Ȣ,=0,=,,Ë ,1 h,+,,t$4Phq]h,7 ,USWVl$,H <,t&AUjQD$}ol$,7F]$G!|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Phq]h,6 ,FVEŅ8D$EH$ H!E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=l,nAL$,9 ItIT$uWoD$,7,j+o2Phq],Vf5 T$jV%D$,|$?+g,t Pw GP g,CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt W |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh@,P <,I<,^_[]É|$|$ u D$PhW\ D$Ph\͉-<,ōD$8Ph-\uA0hp]j*h@,=ËI1Phu]j*h@,"USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph]=j UQ xt-u)%tt0Ph]1H^_[]SWV9toӉQ[A@jP ljtG\$=,t <\u ~t F <$t)\tPSYt GFFuD$Qh]1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$@,Ph\|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hp3rtP%~`+1@USWV\$(|$$1E=d,uhh, ?d,@,9<$l$D$l$ =,t=,t=,u`+=,ubPjD$P D$tD S+9PaHD$=|u,t=D,tft$,SW  d,=|u,u"t1`,@`,| j=y!F888#1Hpt9=@,t,[1d,D$ D$D$$PD$Pj 9=@,t 0,t, 0,d,^_[]øjhh,O UVV-%Ve^]USWV\$r0 S8V8,jUVSh7UP聡^_[]Vt$V uVhph,* ,^USWV D$0щL$l$ |$$t$4PWUƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV1Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPaÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$Sыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjP e^]fSWVP0,t @,Z1,WP(t>1C4$$,u V WSCu ^_[S=,t, \$`+=,r `+H `+,[V5`+,t(,`+VP5`+ 9t @,^Vt$5`+^Ã=,t,r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVkيpO u݃|$0xG-Wt$8^ ^_[]USWV\$8T$0t$,11|$GUSRVjيpO u݃|$0xG-Wt$8 ^_[]SWV|$(L$$\$ 1Ѝt$FpNuxF-VQ袓^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$Pe/ ƃ^_[]WV t$RVQ t|$P3GuV /^_9Hw @sÃtP=USWVPt$|$ħ,V<$=,uԇTh=t, dVVt$ P]Eu t,48JMp;5h,| @,^_[]VWj .^_[]ËL$T$rPPh+p USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu,^_[]WVt$|$ zt!S+PhJpPhDprPPh+p ^_WV|$t$ t%WVra7ft=h, @, j Qu jF^_fUSWV\$l$=,u<؉%t1Uh,1GWP?[PW1WPPUVd[1 jj1=g,1Ƀ=(,HPVW Åt!W |$t8jhbp'D$ tPvdD$ 0ť D$ 89t V讥 ^_[]Vt$tP6d6艥 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQ ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u q*D$E ʀ[} ,@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø8 fL$tt"u$ h,h,HI h,Iȧ,ʋTUSWVD$T$ h,5ȧ,|1Gll\G9uTD^_[]SWVD$L$5h,ȧ,|F|\\|N B^_[áh,~Ph5ȧ,ak USWV h,; ̧,ȧ,th!t 1G31K;)1G1I4:tl!GtˉP  h,jQJƣȧ,h,̧,~PhVj !t\l^_[]USWVPL$\$As h,11H$(uh,1@$1ȧ,<#|tZȧ,4ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$ȧ,1H; t$z|#=h,|O1;Ll |C9u^_[]USWV h,~.ȧ,11F1l9޻r G9u1@^_[]USWVL$T$9~1@+5ȧ,A1G1֋l9߻rB9u^_[]ËT$h,!х1A9Hh J!*Ч,=l,|J!tAJ!P ԧ,hJ!ا,hXI!`+hI! `+hI!$`+USWV \$4ܯ,ܧ,|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$H!=,EQ-s4C$ىË $Fw$H!#Fw}$`H!X!уj WRPBBtDt L=,!15g,h P\1sTu~-1]PuYQA tLу|=RP螽1 $1=ܯ,ܧ,7f1=,u ÊCCs|,v, l,uȡ8h,!ƒtظ:,u5g,资j W5,QTу h,5,,n9|$ V5g,5g,蛅PtmƉV膜 +1+5Q ic+Ɖ!уRPUVܯ,=ܧ,H8 ܯ,H=ܧ,wA5g,kP豄 !уRPaٹ ,, h,VQRP~Xg h,5g,,Pkyփr9RPٺٹ}"RPOj WRP$zQD$ tOՉr6UPlٹ}RPVt$!j WP( z/15g,Mj WP j W1P9@|ܧ,r9 ܯ,t ܧ,r ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5Ģ,Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^5`+~V5,1=l,tȉt `+Ч,0A8h,^5$`+'SWVQNjܯ,عܯ,9r Ѝܯ,WVS7 ;ܯ,;^_[VQ!уu$x h,H9}FV!уtt^^Ð1,,,,WV|$ =8,t5,tZ=(u,ta=h,|<1W!уtRP虆Ws@Gh,H9|vu,覍5,^_USWV 9+9+D$L$!ȃ9+D$9+D$ 1H9+9+9+9+=(u,=8,t4$=h,|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$h,H9|u $u^_[]Ã^_[]鍌^_[]T,K|$th,m=,t1=,,j jhrp"V΋At P FVC^h,SWVt$>t_w 輕 W賕 ߅u1F FF1H ,,,,^_[h,SWVQ1u(\$|$,St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-,Vt;xH|p$x Hȅu^_SWV|$t$u;,Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=,uH 9+59+!ȃt39+99+|$|$ !@tp\$9ϋ\$(|$}^,U1tHt$ !t Q9y}1I(t(t$=\,tT$$1=,uȅt^_[]h,,=\,tUWVjW7!t"j]jRPWV je^_]Ã=,u ,(,,d ,Vj5D$Pj@t$>SD$$PL$Qt$Tt$V>,,$u:, ,!ƒt&9L$L$|D$;,D$ ,t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d,T$X/ t$ t$ \$(T$_CtN4$jjD$xP$Pt$4t$5,5,2$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$> V5 T$1H#E t0E t L$PL$THD$$e^_[]Ã=\,u?h,L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ ,L$,L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$,}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8,@,t$# t$  }tEL$L$H1USWV8=,,5 ,,D$$8u=,,u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}, ,ȉT$!Ѓtsu!9t$ƄuY ,5,;t$T$$|@Ut$ 9D$ЉʋD$4$`,@Eh,h,}!`, @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># ,L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o= ,,!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$, ,!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ ,D$,D$$,D$ ,e^_[]1JЋ4$|$9ωL$}@D$ `, I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=,, USWVt$h,tH>tC\$1EjU1GGGUSxL,,G=,,-5,,t~'V( u,,@,^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5,jjSt$DPV5,5,s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9 t$V-WH ^_[]WVjPh4,hq% t h,h4,Hrhs}u ,,,PhhP׽ x1Ɖ5,hrhWFRhrVW b5,hqS^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@ܸ,Ph,ft USWV T$(\$$t$ 1``+PURS)ˉ<à uVhRt$|$u u)u%u!1ɃtsQl`+PhskRt DhtQ^_[]SWV \$ hSh.r# uP} ths  ^_[xEhShqo# 4$ t t$豼 j V hs뙿 hl W+5b+t$S jW*|$W_s [9uR1Vt$O 4$4 j Shs$VkHWV|$ 5c+j/Vt@jWhQQVf^_1@ظ,PjV*ÊD$t+J t+;+~{у ts l+Ql+jPh,hq" th,h 2PFSt:j5b+P? f=d+u5`, hl+QVh,h>rPUSWVt$81GWh(z5,ø 1-ظ,hn SX)D$h,SD$Um Wh,5,y tLtFPFuf=d+`,tjQP> P jIt$4l$0j7D$T$1D$EHM~EHMU'ڃÃ=ظ,uf=|d+u0Iڃ% tM 1f=|d+@ ЈD$P D$ƒ t|f=|d+Qq f=|d+uf=c+tT$j \$Ct,j Cu\$T$f=|d+x댉\$ 넻 $f=c+tD$ @D$ PhrMڃf=d+,5ld+ jW5`,耷 , ظ, u61=D,#$ |c+9uj 5$t hsZj ڀ tf=|d+u j ttFPFujÉU$t$jr&f=c+t'+\$|$f=|d+rtPrWSP jh,5,| h,jjK(^_[]USWVP\$D$jP5`, f=d+1=,5ld+ jD$P5`, W 9=,ttػ1FU PhrLKtMVh,5`,- =,5ld+- VD$P5`,虵 W 9=,u^_[]WVjPh4,hgr% t ^_h,h4,Hrhs`ы ,u ,Q[h 2PNtAf=d+,vrtnrPQhWIWh V \Wh>rJLht jG$,USWV$t+J t+;+у  l+Ql+t$hVh.r 1GWh(z5, WS#Wj#h,Sj  Wh,5,ȳ x>jƉ׉Uk ~*9u$hl+QOEhs~11f=c+tj|)RPhr jh,5,4 1h,VW  WV"Wj"^_[]j5`, Wp 1Sj"SWy"VVhrHS)@USWV$t+J t+;+у  l+Ql+t$hVh.r 1GWh(z5,& WS!Wj!h,Sj  Wh,5, x>jƉ׉Ui ~*9u$hl+QMEhs|11f=c+tj)RPhr jh,5,T 1h,VW  WV Wj ^_[]1W5`,= j5`,- S Wj WS VVhrFW:>USWVPhs{1GWjM WjB 9utDƅtZWh 9uht{1VjVj ^_[]hĻ+WjhhrZ1SjSV-c+j/Ut@SQU[ hĻ+WVh^hrW WVPjh`K5,諮 f=c+t%5c+>t=,VGPVW| 1FVh25,e |$VW5,Q ?nu5c+hriE ^_VPjPVhr t=,u.5 d+VO yVhrEhtzP^Vt$j5,F VtVh sDhtyEj<WV5,d+t)>t$=`,V2PVWg j}j{VhVhs Vb+t$b+jhG`5, c+uc+$c+%c+t$c+t$c+f=c+t5d+t$$5d+f=HЃ sX 4HЉ5L,jhPa+haut$4U ߃ufH1K$lK!U6,뷃EFU6jhS5 jhS hSD$QPuVU6h|4 ShdSzhS$_=,U6P,1@D$<$XD$,=,U6j/SD,k<$$YxD$ P1PhPjPP5U6 L,L$ !P5U6huQ2a X,,\,=U6W*Shuh,s 1@1H1HD$1@$D$~1HD$$+)t5|$L$(4hV t5P,X,,\, VjVjVjVj,5L,hevj V<V4$jhl+8 NwK!P_ D$tu1=, 1A111ɣ/5,jV?,,5,X,,=L,u L,%,Y1ɉ ,,t=,u,t =P,lj:h)]t$M! 1Ʌ ,=X,u6,t=,tP5,N1X,5,j:h t$ t c+j:h t$ t d+j:h6>t$ t b+j:h]t$ t b+j:h t$d t c+j:h~t$C t c+j:hlt$" t c+j:h Ut$ t c+j:hP t$ t  t d+=̹,u ̹,b+=,u ,b+,tPh,Ĺ,tPhй,tPh ȹ,tPhdhԹ,h*zt$7+ u Թ,hع,hrt$+ u ع,hܹ,h:0t$* u ܹ, 5,5,,0,t%j,VvtA1ɉ5, ,,^_Vhy Vhzhoyj ttu$VhyFhyhyuFj,fSWV t$ |$6s_ K 4,a8,' <,1@,3h0zPD,VW8=\,1hd,S/ ,d,%,%,%,f, ,,f,,h,jSV h, h, h, ht j z9D,tzPhP4, x |AEjj5`,褞 xPj5`,茞 hzju h6zjͿ 1hJzVW vtHЃ rt+vhVzmDH,ō HЉL,봡+)ǃG<1+DHu0W=r$hhiz`hrjX SGhWhP,_ ?t GG?uP,P,5L,hzj V{1 WjK Wj@ Wj5 Wj* Vtuhjvhyvjhl+ hzXb+t T, h=X,t5b+u,u5=X,5b+{5b+hzj Phz WV ƿĻ+Ph6{W44 Vh[{W%4 j(=,th,htj! j SWV5d+t>u+t$ȸ,t P@ Vƣȸ,d+hVtsD,hdVctah]VOtSh% V=teh|4 V+t1Ļ+Vh{WC3 WD,$11ɺb+0 ߈ȸ,Bu^_[ñ1WV,|$8V5`,WV躦 WV #NF=\,t L$f=d+t D$#$d$d$ wfD$ f=jV5`,z f=d+t|$ 4trPd`u 2 WIأ,NI$LL!WhR#,@,N Q1f~ @,t+H t+t;+lhl+j!!)l,v Wh{# `WhR#,@,N tEPPm,Vl+H l+!6h",#|,h4W^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n{L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh{SuW 1@W\oljR1^_[SWVb+1t8ϻb+WPt!CtWPwt Cuމ^_[USWV׉A tS^؃H$lL!n tWU$tjPu Uo0 WYF tQfB t p th{U*N 1?!9~ t~ N 9tF N^_[]h{fSWV,1f=c+t h|; |$ us5b+Ϸ jW5`,> j贷 l$ÈD$V۲t1:ul$B9u|$tjjD$t$j1 ^_[]VP1Vhxt 5`,z jsVhyt 5`,\ j5`,̑ jsj5`,襑 jhP}5`,P V}<0t<3thY}ahp}T1FV8sPhf@5`, jh}5`, Vsj5`, jhxt 5`, 5`,ц ^jh45`,蚄 h|,jh,= fUSWV $ uwE h\jhH, 1HX,ܺ,h~It ~t,'~h=~"$tt,$ hU~US ƃw$L! H,׃BU68jL$QPo% $9b\,`, I,냀 H,wU6t,` H,T H,H-U6hUK|ſ}M!h U6VWUI u<7t;upC H,KD5tX<=Eh/ Uƃt=tUBU7D$d0@<=uEajD$PU$ L$9! t , KH,hVJ,<0$ $ U6~5U6O,VP",t=G$tjVP$ H,h,l, I,}=P,rh/ U蓭UPhD) pjh~VhZ%) WhI&UVsh )h jX Wh'(QWhg U6Phg~j u*H, t5+)~1҅ S|@hhhq hhhhKhAhKh^ L,u8D$P9 u h~9$~H, L,y!ǃu h.}M!t!ϋ L,1Ph~' N!u sL,0h~' sL,0h~'AWhr'.t%thRU'|$ Dd,$ $ 4hW uW$ 4h7ō$UhP; tʼn-T,=H,p,hPU X,uzt P5T,hh\,Pu5T,hjP,uG=d,tyP,,=,tV,hH,QP,u7J$ P,z$u+hH,Pu,P,05T,h:u5T,h =L,uhOh!h0Yhj$$ t~ ܺ,u$ thgh,Pu$ thX#,=tD L,Au$ thҀP=@5ܺ,. ܺ,$ Dغ,H,5T,hP,tpp 0h H,uGغ,gttW#,n@trQPh< d,tPh{}H,uu+ L,0Au*hN L,  L,'hH,u VhɁ #d,=u#5X,d} u5T,hg{ 5X,} u5T,hܺ,tP} u5غ,h]j $ thlUSWVt[ׅtf΋N!t# N!tVPt%]uWVh " jh L,^_[]hhhhhhhPPPhhĻ+<L,t@t hH,ЃjD$t@0hXW"1hIh>hh8D$t@0h!"1hIhhhD$t@0hĂ!1hIhhhUSWVh!1 ,M!Qh5ThĻ+#N!t*tu6hĻ+jjhɃhĻ+jjhуhĻ+jjh׃ȿ߃tFKrhĻ+j @#^_[]USWVһ+9u1Ht$Vhht@P V$PPftхu! $h) N!tc D$  N!0tBVGؽ ;$ݸ߃D$VPh5ThĻ+D$uhĻ+h2蓅^_[]fL$t11f3QBuhhՅjThWVD$ tRt$tX|$t3fPhfPhf1@^_hIhj` hhjahxUSWV @$ @SFX~ _cf ߃| RQh%19ս|*Ձ tRQh, 1 @^_[]û l$ WWSUP} 9tmv hZ萏$ =Ut%tv h hjU* 1$ PPQ| É11 Զx$" 9/9$ $ =JA|$  D$ |$< |$$u)D$L$T$$RQP T$ L$D$419ع#PhHch Pv tOPSQhg6$!u$!$!j?PQT  t$hЇQ+PQh!$ "u!$ "$ "hPQ  th$ QRPhL]$$j@P$!P Pt$$"P$$ Ѷx"l$$ $8v+)t)+8uHJRQPa  t hÍ$  tL$(SUP; l$ M1h$ US |4ōPUS < ߁WjP N1\$ PPh t<=NýjPU` 91E b8tX8J8u.N1 T$ PPS 9tǃuz8u~\$Shmdv? th/^N1 T$ UUP ljl$Shmdv 9=tWv he2v hXghIhh8Bhhh91hhh: hdžhh;hچhh<hMUSWV$F~ 1jUWSPw 9u!D$=жxt9wwF̓uv hZ" v h#ST$1uD1Gu<jUPSvw 9tu&v hXh1^_[]hPv hԊhIhh hhhhhhhMiUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P D$VUP舽 s DD$st$s 8D$ s <D$tf4$l$4U`N!!t_uh+h^ hhĻ+$  `N!hhĻ+  uhĻ+j dN!D$l$4$sf@8tD4$t$xV\*@S͛PSV* \$$Vt$S`3K1D$0D$,D$(D$$d$sD$4j@HP6 st$st$ht$hȉt$hՉt$ ht$thtL$9dN!t uQh `N!hC|$4tD$4Ph*|$ gvVD$PUT 16D$8uT$Bg)QPR thR1@^_[]USWVӉ͋t$V 1Htkt$t$VSUs tGUn t$t$VWUs 9uVSW t'W  W 1H^_[]W USWV$$$|G8-t +$D$ 1FD$h WS躟 it 1N!e+9t9At&9IuJuiu3$tHPhݏ AtPqh!E 늡U6A뀃Dtou&t$ mt$dU6$W$uQ 1t$hWV jSV $FWPP uhe VhiPj u hj Wm T$N!e+l$D$G_HrY7S hjD$*P ft$fD$CL$fA37SPhjD$&P ft$fD$f\$ $T$0 T$T7hjRj SaZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$P \$ $ sh:sh*s h=shZ sh{shs hs$hܐs(hsHhs,h@s0h^s4h~zs8hjsXf|$rL$Ifw N!L$T$ t$"VRQPhؒwhhяj_ D$f=g+1g+hjD$$P fD$|$<g+fD$ $T$g+hH$|N!L$f|$tPD$=ufD$L$IL$}1|$D$L$ t+14/Drt#E9uT$ЃDPh/~|$ujjPP诈 jt$t$ Vq VhiW u hwD$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSWb jl$UW貪 whhl+eWh:it$V" uO j.hl+1jWRWh:iVݿ u Cw8)|$P0$rkLPD$$PQ2 $<1|$Vht$kL4t4N!hLhc48~1D=PG9uho/4 D$4!4"4#4$4%PSWRQt$hy%4(h444,40k<SWPRQPh4`hhC4\t hRt hWh.4d6|$1A t$t&u/7t$t nu Qh\6FL9Mt$ $t$qVc P$t$RVc hPh܎hĻ+; jUSWV։1hUS3 jWS臧 sUPP蔄 t'Sh9iP tVPc Ĕ^_[]he hďjr USWV׉1hVU jSU }VPP tAUh:iP uGPh{y1FSb Đ^_[]he j VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1PhK^WVhv8f>r1D~Ph GH9|j]*^_WVhvf>r91D>Ph_ 9} j:G9|h^_WV$fGjRWs WhiV t Đ^_hj臂 fUSWVu }6( hrj hVW Hw$N!̻,л,ԃBu|1PP5U6x Ȼ,불Ի,ػ,ܻ,,̻,,너Ի,,sjhl+軕 _Ի,S3=+=,u.1L$A AAAQj j_ =л,ػ,̻,,,Ի,"+1O=t,3tch Vt^=ܻ,ukjjV^ ƅD$ PV~D$(!=<\$yB  "+u1PPV;^ Ɖx\$,z+=t,5Ȼ,PL$Q] ƅ~E1,VPS\ i)u5Ȼ,5,t$h] ƿy5,h6u,"+1O=\$t$9ȉQ0^ L$5Ȼ,u ύD$ PS5Ȼ,r*V,Vh,Ȼ,,,,V] 3hXt,3Vd] 3h5ˋ$B65Ȼ,9Ph˔hĻ+ 1@,;+t=h W;t1=ܻ,u 2PW;? \$+\$=, 1$ӋFHN~ HVbƒ =,u u u1G1=̻,up=л,u< u7 =ػ,>hrhhl+{ x+@t>$@$Phhl+Qڃ x+@ t_  =ػ,t+H t+;+hl+j$q  =,xt+H t+;+hl+j^:=Ի,,t+H t+;+hl+jMڃl+H l+$l+H l+^t+H t+!;+hl+jIa l+H l+I l+H l+Mt+H t+%;+hl+j-ڃu!l+H l+-+DPuWt+H t+;+~ƒ tl+H l+hl+Rڃt+H t+";+hl+j^Rڃuvl+H l+^?tЃ@Ӌ t+Qt+; +~ ȃ t l+Ql+Vhl+P=F @t5,ho,f x+@ui+\$t V1(+% +WhCo,1;`hl+u,e^_[]hKyjny hfUSWV$$0 hrjb 11E1D$D$D$D$$׉jh h+h7$V| Q~Hw@$O!ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jU6$ىY1ɉPXuG +$T:-u"j9uzuI + u +)t u <$u|$uM1ۋD$Ã<$D$ P.tD$ ,$4u9>Wr uTWh}D$u5t뢍D$PWGu!WhMhHj7w $1 |$ $jSVC u h P M1uB8V31CHHf wy$hO!|$uhULÅu뼋ss  PVh7i |$u.jSUY ss Q PVh72 1F $tCPpQ |$t KP;AmPsT$Z|$Oshk1F7h jv PPhhĻ+IjfUSWV$$6 1hrU -,-,-,-,1ChVWS e'H wu$O!,-,-,Ńo'fil,뙃prv$,oa,,,%,-,-,7,-,-, , ,,,,,, ,u +)ǃ= ,,u-tX1Ƀ=,=,tL$H=,=,=,=,tʉT$4K (,j迅 ,,P豅 t$lVUhHh+} 9rUh\hHh+|Hh+ @h+QT$/u>t$|9A@h+A @h+Ih+vy/th#hXjr t$ Dh+DhU jE=,u$PhHh+B$PhHh+SCu@8uT\= ,u=,t@, ,t3D$ P6B1#$=@txUhHh+D$ P6Bu6hj4r #D$=@u, ,1ۉ  t1ۀ|$/uhHh+h.t9UB{r|/u (IHr IH9/touɉt$P0,USWVT$juQ= PQGD$1t$CHfw?$O!ss PVt$ h7 PshĖ>|$(5Dh+C,Hh+)=|5TShHh+hd t$VF1Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$hBQhT$CS(L$)ʀ</t ~/t/FD$щT$Hh+)rPhHh+ht$PVf L$@h+@h+=Ih+vx/u H@h+=,tD$PhHh+@@D$PhHh+?T$KP3Qt$31 u@T$(3Qt$$3q u.shHh+h$ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shHh+hJ 1Gt$#KPqt$1BD$ $O!=,L$ QP T$ ,  ,sHtbffM 4,Q4,T$ 4,t$/D$ !=@8fush~jSt$ V@P 1G)=,tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=,t$tjQ\4,H 4,<0,tICPphHh+yO 4shD$ PhHh+;=1u=$,thHh+sh) VBÅc1G1軼8uV@Ae^_[]7hh jnl hhh6!xhHh+hhh?hʗҵfWVt$$D$(H0JH(x,z H4x8J z@[1C=,bWhHh+`IGG;D$|u,,#G%PV!G wUSWV\$|$OǴ OOtQPSF uG1CQPhHh+E t918thHh+hvZ1F#GGtPSF G1PhHh+E thHh+h2Z1Ft\= ,uSol裴t USRF UhHh+F u%x8-ulthHh+hY1FuWhHh+t1F^_[]WV$ hWvyA t,$t'hHh+thHh+hp"vhchHh+WPC tWh{.Y1@^_Ã=,tjvP(1V|$ thHh+qt hHh+hp"t$vhHh+C thHh+hX1@^Ã=,t jV1V|$ thHh+t hHh+hp(t$v$v vhHh+v thHh+hCX1@^Ã=,t jVF1<PPhhĻ+jUSWV|$j/Sآt@Ë$h SLuGhrWVq X+)ƃHt4B j1hiWVq e~!r8$P!L-˃K~3LtgP<-믃st\vtcwH-듃FuX8-@-D-H-mD-@-Z<-NP-BT-6uX+)ފ P-4 -U-8-u=8-uD-u@-H-,ttu'MUj MjPt=L-u4PV1u$#D$=u茰Yj}PVd0uB#D$=@tM19t<1jA ŋ9uU+Vhj_ 詮PPhhĻ+(jUSWV׉΀=P-tj}$hVSi =w6Sl t)$ PQheWS9耯?A=<-uL$QVЃu#D$=@`=VhT1C؍e^_[]Í\$SW/u#D$=@=L-u"SW.u#D$=@=P-H->/uD$PV.tX$hSWh Wgi t?$ VPhehWD$PW7.t VQSD$PW.ÅP-WV/PVNt@\$L$/PW.t@L$ Q\$S裟u)D$ )=|\$=@-u=D-hl+˅WhhĻ+h +H +~+H +h+覩É؃t9 t4+H +~+H +h+fƒ߃Y=8-u#D$=@uW6p Wu8=P-u WV< <- PWQVQ< tW#1ۀ=T-$U-VPWhۙhĻ+jj h͙+9D$t$QVP Ƅ fDŽ$.$$PQ+\$4$9|$ t#t$WP藅$ D$Ƅ fDŽ$.$PQe+$3$$3$ $3$$3$  WVh fD$L$TTPQËD$L$TTPQΜUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQPl^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP蠛^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP:^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQPԚ^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQPn^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP#^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQPؙ^_[]USWV |$87n hrjjt7D$Phht@jݏ uD$tLl+`-d-h-h u l-t$41۽hWVf HσG$8P!h-1p-1`---d-1p-h-t-x--낃w--^-O-@-1X-"--@1`-------- l-=|-t |-t---1V-G--1C+t-1p-h-x-d-|-p-1h-t-1@-t-1p-h-x-d---`-1M--rX-c--J1`---4x-1p-h-t-d-+D$=d-u=x-u =p-thCgtPLl+=|-u |-- t-L$$ ȉD$- -- X-L$D$ ы- T$ L$u1 T$ =-t ŋ$u|$u|$ t+uh-j? - -=-X-tL$t*t,uw kL$t;t=u^ R Kh =-u==- t/4 ( ! =-u=-6 t -)θ =h-u/= =x-u! =t-u=p-! t -t1ATl+U4\- ^_[]נPhĚhĻ+W j-USWV΋\$=- t1PSRX ~jP41ɉ=-tWh& L݉t$=-D$W'ÉL$ CHHf$XQ!ks PUh7 \-{Dt{T.u =l-tw=-uL=-u%sh1TShĖL|$|sh-VW3ʼnى=-ut jSW2 W&Å裠0W+%蓠0茠8u ^_[]jh jOP WVD$ qH1ftYT$zHftIf t$f tf9t=-uyDt,RQ-1f Duf u RQ^_fu1@fu1HUSWVL$d-D$ t-u =-D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$PPSl$$h7wt$X 1@F F\-Z|$dt~T.u-=l-t"fu=-uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=t-t-T$$L$(=-t-sh j $Wf$D$\l$t$0Kjs6 Džt=-tsh j $Ujsn Ņtщ|$WU‹L$@D$9ʉT$@l$ UUʼnD$<9L$<=-t/h slo\ D$TPUT$ 9щL$ 1|$P à t$P Ct$ P=-t +Cl$TUPȵU^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=-tD$|t$ |$ n-ʃQPRW{$RPhUjV:V!TD$|=-t$ |$ tHVUUUȉD$|$D$<$$SWhpBVUּUS$t$h VU購US$=-tDŽ$Mt$4t$ t+J t+;+~у t l+Ql+Guhl+Q詻=-tXD>t+J t+;+~!у t l+Ql+Gu7hl+QHL$D$ ρÃ-T$9-}`;L$}XD>t+J t+;+~!у t l+Ql+Guhl+Q貺t+H t+;+hl+j 臺l+H l+ 1D>t+J t+;+~!у t l+Ql+Guhl+Q!t+H t+;+hl+j l+H l+ e^_[]SWV΃=-t vrhwMc1TVO^_[SWV΃=-t vhwM1TV^_[Ã=-tATPqheJ ÃTQh8Í` f w5$tQ!t+H t+;+hl+j@I/t+H t+;+hl+j*t+H t+;+hl+j=kt+H t+;+hl+j%Dt+H t+w;+ohl+j|!t+H t+g;+_hl+j/ 1@ál+H l+@l+H l+=֡l+H l+%ál+H l+|밡l+H l+/1ál+H l+*USWVl$(}=-tE G=-t=-t(DG-1 -Í4^69Ll+} ^_[]{E ;\l+~*P5-tM \l+--4FMt%$Q  Qt $ B$Iu$ Ll+șƉșD$$t$D$ D$|$1ۋt$=-t( - U tt$ ;4$}Z;D$}El$)št+H t+;+hl+j l+H l+ MuC;\$rt+H t+~l+H l+ hl+j 蠵D$@D$;D$ ^_[]jK1LUSWVt$~=-tF G=-t=-t(G-1 -Í,C Ll+-9} ^_[][Gșljș|$$.1E  E;|$|6t+H t+~l+H l+ hl+j 蓴1V =-t(41;$}D$)át+H t+;+hl+j ;l+H l+ KuGm=t+H t+~l+H l+ hl+j ^_[]USWV|$=-t_ C1ۃ=-t=-t(C=-71F  Ft+H t+;+hl+j,Ll+H l+, +N,t+Pt+; Ll+} 0;+(hl+j ;~&l+H l+ "l+H l+ hl+j 1W =-t(4_ŋvt+H t+~l+H l+ hl+j [^_[]fSWV|$-WAt pSPFt81PWV VhV蓻^_[hWhj7 USWV$URA4(F$$1 |$1 9$)덄$PSUD$PtXǃt-tat$?tL$T$d$.?T$O$E1 $ ;<+r9vL$?T$$$^_[]SWV ΉRQS# 1t4u t|uHthl+PjSYt Vlj ^_[fUSWV$$3M 1hrWWH %$ D$D$ hSVE mu05U6 tChP $W膹뼃pu D$ 뭃u +,uk5U6h}j5 Í,VUl (;<$˄tD$Pt$VxxuGr?WVn u0N8D$PVx+D$ !=@<$ut E/T&ۄ8<$Vh9*1@D$|$ot$褟/PhhĻ+诪 j腟USWV$$6 hrjbhƛVUC hft(-ht14vt%i-----맃+)Ń#D$=@u.$VtP{= 9r*th˛j3 |WPJ ty/t AƄ/@L$M$D$SU<|/uH9tx/@tj/SNsޅt@V<L$rSh˛@1A $'@PVt$ )) ٍ$Ct1@$Mg4$|PPhhĻ+膨j\-USWV։π=-ujV豫t~VW# t98uR\$@SVwt{SWi9Wh1ۀ=-VWh)x VWh$' w=-u=jWuWhH#D$H=@VD =-/jVѪD$@PV+jW訪uD$1Pt$Ls D$2x rtD$1Pt$\, 1Pt$`苐 VPSt$D$BPhhĻ+ݦ#D$H=u}1PPW[ t$HhV? \$D$--V>CVh%1C؍e^_[]ÉVh.hĻ++ +H +~+H +h+i|ÃtH tC +I +~+P+h+*| + tuÃ߉1ۃYM@Vh$'$-S-t$|$SPt$ Å11S5-t$ 9x߉=-t{\$(t$,l$( $$L$$D$ l$ |$T$ fT$l$\$l$T$-RQPVSt$(t$(hBhĻ+蕤$5-5-t$ Å6|$W\$S+ t$uVh=#S D$hL$l$JD$pBD$tB D$xBD$|BRW tVh.;#t$\t$\W: }8tVh< ##D$HD$Ht$\$ \$D$t$Ph"VItVh#"t$ S 1V"5-t$ t$ЋD$HPW tVhPZ"$W t|8-t$Vh]'" WN tV|$Wt Wh#H1ۀ=-DVt$SWVP׉B jWP t$t-hxh謰hxh!1@^_[%tPhxht B jWP t$thߜhߜ%tPhߜ1돸=-uxjWVhI PhqS Sh jzߜjVhI hhqWҴ WUSWV8`l+t P `l+1---- -x-p+it$L$Q!hjV `l+zVh20jG`l+hhVA `l+-hjV `l+;zVhg0jͳ$-ul+1`l+$-dl+1t~(-ttja`l+$-ll+1@5`l+$-ll+1@DyVhL0jE`l+t(-tj`l+ }.tQ`l+h,-P[xC4-%= ts=`=@5$-hj許 x5$-h0j膲5`l+w `l+-1HPhm8@5`l+` 1ɅA ---5--ˋ p+u|.|.l+v$Q!=|.=|.>1jSS5`l+w`!ƒux8f ---5- a1H p+p+=-Gt =}r t~=|.|.q˃u#=|.tPWUV谟 ~jWUV薟 tw߿(=|.u |.~~=l+|l+18^_[]111RSWV։ωS< l+D$t,t\$W30< 4$ t$  ctjt$< Q1@jt$; 1PW; 4$ t$ jSVV($ x^_[h hhj% VP=`l+x=}. }.t}= -ut=~.tD}.HQP~'Q &x-1--$Pj 5 ~.hʝ5}.| 5}.M=-uKh,-5`l+Wu4#4-=u"- -u5$--=p+w=}.tl+~ jP 5`l+f l+~jQP_ }. }.t4= -u+5}.hf~.5}.L`l+=-u -tP1--}.tl+ }. }.t'=~.tG}.HQP~Q x-Pj 舝~.}.tZ5 ~.heuC5}. |.|. u |.|.jhQPdRPhV蛙1V5}.K5x-^USWV=p+l+tĻ+D$WO+- - u1@1ɉ$L$=}.p+\$5|.5|.h#hS<$t$W5|.5|.!c$h&RPWh.hVה$VShhW軔}W+PW}tf=-t]t$5@-5<-h#hVo$Vh-hҤhWOW6+PWjj p+u_5x-<$t$WjV?b$hRPWh.hS$S]VhhP֓}.D$=l+Ox-D$ #D$5|.5|.VSP葓$5|.5|.VSPs|. |. |.|.4$t$VPQra$h&RPVh.hS($S]$QL$Qt$Wt$$hhP$t$V)PVj "$PW5 ~.h7t$耖e^_[]V~= -u(=|l+~h~V5`l+ |l+~^V-1= -uE1jVV5`l+QXxRP5`l+i yoh 0jd 1N^Ã= -uh,jI&1=-u5 ~.5|.h^j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|l+= -t$t$5`l+d ƃu*~3-;5|.tc5|.tU-L~ -?5|l+x5l+hj, 1{n5l+h0j^_USWVP5|l+|$l$1ۡ`l+$WUt$ ƅ~)tދD$9u--!|l+ -Hs-m8 uc1hޞVh5|l+:~\%tS1jPP5`l+Ux})RP5`l+f yPbhm8tD^m8t:Tm8t0Ty:Dm8t :m8u |l+1$m8Eu |l+xt -1-=-uhj腥`tx>}.Ht)t h5l+hjL 1%h`jl5l+h=0j^_[]USWV1N=-=|l+ p+uhȟj٤-<u-- -sg--1jWW5`l+STxXͽuWURP=)jWU5`l+TyQu t#-@-=|l+:hFf@Phm5`l+S x|l+h'j1^_[]USWV \$$|$ l$(1uu5|l+ -1jVV5`l+9Sx\D$ljT$Ӄ= -D$--9L$ujRP5`l+Rx+D$T$EU,= -u#hjh[0j |l+1N ^_[]USWV~=|l+$(~$$~ -t)hj蔢I1u)1ɍ|$h~W5`l+G 0|$fGWhm5`l+Q fD$D$Whm5`l+Q \$h~S5`l+ $h~S5`l+ GfD$D$Whm5`l+?Q |l+t1<$uzfD$D$Whm5`l+Q f $ |.11F$$~jQURHы$ʉD$ ʋ$$~) h-b1F|?1jPP5`l+Pxg)y11=l+|!h11Fs1ohhJRjRP5`l+MP1yKgh .gh*"ghghr gh0jB 1N5|l+~^_[]fD$D$ D$Shm5`l+O yZgt$h]Jgt$hť0j٠SWV Vh$~.j ygh0j袠 jVj yfh0jv 1N=--=-=l~.u5 ~.h趟=$-hll+WkXhdl+WUXo -aXt5 l+tVQWPA S8 p+t2P5 ~.hhˢhhݞ|$h Wf|$.D$tL|$uErYtSu6yu#5$-5$-hksWhLT5 ~.hAhˢ4h'h<=l~.thj{5l+hʣ5 ~.hҝhŝ|$h Wf|$.|$t+D$5..L$f tW= r@h\ hh;Y5 ~.hFh9sWy\Wh-|l+5 ~.h>~. ^_[hМ-t PߖW-t $-1-|l+h{j|5p+mtt$11Hfhh-} th-D-1bhE0j臜 1Ht$ bhb0jX 1HVt$Vu( ubVhv0j*^\SWV|$$Wƃu[Wb1~tHNtt 9 tu/.bPWt#D$=@t b1N|^_[USWV1F}.PH{}.P kjUƉ+t-Hw> }.SPh-Q@ `-$ d-L$QPh-\h-Cjuh-[jh-^uH=-/u+-Bu"-PPh--PI hl+WVh-M<x+@ub`-h- d- l-QP.t }.P(jh$~.j xsZ1e^_[]B`h0jՙ USWV (m+x&,m+kLl+9|׋yM1II1|-1PQÅy19}WDu=p+hj.hh|-OÅy1ۉ9|(m+x(,m+kLSh|-l+y݅u=p+tehj迗|-1E$sVh}-|-Ph )؍|-1Ehji1IkFLl+}.Sh|-#1ɉ^_[]USWV D$}.xGD${-$1F1|-SQ291C}.h|-h-P$ }.Qu*D$PUh|-Q8 |-tu=p+hj耖t$h}-h|-E $W1CttUtB:x9u=p+tFhsj,Wh|-Q19uh*j1H ^_[]hPth-Q<t x-1hUSWV1C}.PH}.P yjhƉ׃=}.t/5p+ t\h0j4 e=}.t Rrx7t$t4}.P(jh$~.j lzbV1ۉ؍e^_[]Ít$\$D$t-Hw5 }.VPh-Q@ `-D$ d-L$ h-kWeh-duy=}.tSh-t^}. }.tSh-h-Ujh-Xt@h-Em`-h- d- l-QP=-/u+?<u"-P/Ph--P[ }. }.tSh-0 }.tp}.|NPWt$h-)6Q=}.}.D$L;-D$P-Ph-8~.-t@t=~.u Pl=p+t1t-Hr@tZ tUh-l'9D$X;$-D$\(-?uD$Ph-$Ã|$=~.ut$h-Å}.VSh-P@ =~.uSh-/!؃=}.\$C=~.6D$}.HQPQ }.=}.D$L;-D$P-`-h- d- l-QPDy h-j=}.\$^=~.Q}.HQPQ D$L;-D$P-D$X;$-D$\(-OPj 蜁~.D$u`-D$ d-L$ QPp-x5p+5}.0`-h- d- l-QPh-ji\$=D$L;-D$P-Pj Ԁ~.USWVj/h-jG1Uh-n t>5-h-U /tOGh-WUh-hŧjjO1N,K|/t1Nuh-hjj^_[]SWV=}.01F }.t9t71hjێmQHb}.P R=}.t i<}.x t `m#}. }.t#5 ~.h̦5}.{ ~.ujh-^t(`-h- d- l-QPu1=}.th-hxuth-ly}.P(ljgSW, xa}. }.t&=~.t5}.h2~.1G*ƃuejh$~.j ^_[USWV $}.xu d?*1F}.P,}.@0D$ jD$T$=}.jSh-9]jh-Q$=}.th-~gh-+th-2dt- w's1PP5-F $jh-Pƀ=-/u+4u"-P Ph--P =~.t4$h-Z' }.t:}.|Pt$t$h-s.Ph-0~.x-h-T$t8=}.=~.}.HQP~dQ c}.L$Qt$-SPD ƉPS?&=}.tc=~.tZ}.HQP~3Q 2Pj {~.Ph-%dPj {~.D$L$ʃ|QP  d-`-ʃ|QPxnh-*1C@TPh-Z%VQ5-h0jh-8ch-)t }.P4 jh$~.j =}.tn)11Fe^_[]þ-PV$Vb뙉Ph-$뇃=}.t cxIx}.PHx11@USWV $$h 5~.SI  = u$ /,4ŏ4/t EƄ4/FED$P5~.#D$=@`1Gxv%xmlxd=}.t exRh-!(ttjh$~.jE Gm'15~.hj 1GĐ ^_[]EO5~.h0j҈5~.h?뻸 )D$ )D$$h- X}. }.tV1=-/-t$PU ;D$vh-hajN _D$PS E-WT&W^jh-Kt'h-K`h-&'VSh-NR xơ}. }.tD$Ph-lI=}.t5}.h-+~.x-=}.tEh-C=}.}.D$D;-D$H-h-{t-Ht 1PP5- $jh-#Pt$h- Wh-D$P;$-D$T(-7wD$ Ph-;}.tk=}.tbD$D;-D$H-Nh-h-^^D$D;-D$H-D$P;$-D$T(-L5-h0j蕅P-WWWh-!Ph-=}.e=~.X}.HQP~ Q Pj u~. D$D;-D$H-Uf|.-|.u }.@|.=~| h~Ph=thPhnj蜃1Hã|.l+5$-y x1|.|. |.|.ʉ|. |.|.-=p+u=|.t4=~| h~PhthPhͩj1H5$- y xᡀ|.|.|.|.1|.|.|.-~l+|.USWV=}.thj艂1I^_[]Ã=|.|.l+u|.1IxՋ=|.+=|.|$\$5l+UVSWq)9|11UV$)݃|.|J|. l+|.~H5|.P|.|.;|.r֋ |. l+|.|.1)ȉQPx[|.Ɖ5|. l+ȣ|.)=|.|. |.1|.|.p+1h,jWV1N=l+=p+uh^jy1|.|.5l+5|.Z1l+~9} G{u'Phj~ xI1=|.=|.5l+5|.~ |. |.|.|. |.1^_ËD$L$|.)ʉ|.QPRQ! USWVu ]1D$ D$ D$|. |.)ȉ9؉| |.)։ |.QPVS\o)ЍT$RPQ 1ID$L$ )|. |.|~ |.|.)ЅqxUtX |.|.D$9ؿ|‰|.)ظ|D$L$ 1H1@D$D$e^_[]V1=|.5l+5|.~# |. |.|. |.|.V1xC=}.t/x&5|.5|.5l+5|.~|.1 }.1H^V|.;|.v*5|.)QjPA 5|.5l+^USWVt$|. |.ƒ|]; |.|.}O1hW}=|.=|.$-|.l+ ( |.9)1 -|.1ۡl+1PUK;l+tS1|.|.S|. l+|.9)QP륉|. |.Nj-|.S5|.U +|.l+)US|.|.|. )VQS |.}.Htt}.1O1^_[]É-|.USWVP\$1~cl$|.$5|.<$)"5l+3x3ǡ|.$5|.9|WUV8 5|.)11H^_[]USWVPD$~Z\$ |. $5|.ŋ<$)Dž~9|.$5|.9|WVS 5|.)D$^_[]ËD$)USWV\$ l$؃|~|.D$=|.t$)#5l+4x\ơ|.D$=|.19|VQWD$ w> =|.)Éظ|$1H$$^_[]USWV$  $x$|$D$|=}.t7P$d$y#A$ h0j.{$|r |.1N|.)ȅ5l+  |.9غ|PQ$ ~|)à |. |.ظ| uXP$#$3D$8$3L$4 $ hjUy hx$ hʪj5y L@$ h0j z'a@$ h0jy111o^_[]USWV$$x$|$$D$x-D$PQ"t"?4$h0jny L$|L$1$p0L$1|. |.)ȅ\$^ |.9|4$ST$ RT$RPQ$P~R|$ =~. |.tP;CJ |.)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=~.t% u!$9$t4$h?jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=}.$4t1PW y#=h0jQw1HD$sD$$P$<B 4$t=Vh0jw $l$ l$\$ 5l+5|.W lj\$11ËD$ 9D$D$D$|.}$4$t$ L$ QL$,QWP$PWP$@ ى9u15l+5|.$<2 ljޅz11 ͉$03x$3|$ uRD$$P$8$3D$\$3L$X $0<$\$t*Whǫ<$Whjt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[];$0h0j8u1K<$;<$W$4hi0j uUSWV|$7t6|>/u/1N=|.MWh js |..|$tjh W V]$=|.|._ShVP]$ƅE<$8$S x<ShP$\$wyw[:0=~.t5}.$hVjs15|.$fm$ :Qhv0js1N^_[Ép6USWV|$?/tGj/P ƳUWu/Fj/V ƅuhW= ~.t$$W jWby3UW襹u%D$ PW)jUPWV/Fj/V 1ۅA4t*PWɸt1K#D$1=@ۉ؃|^_[]/WVD$t$ $P+ yu~x8Wh0j r$tDPF}yJ8$hˬ0jq$uk1$|.^_USWVD$Et$$^߅tP y7Wh0jpq= ~.t<$8$W 1 ~.tt)$($u7=|.uj` |.PR |.|.!UWp+ p+t%1PPL$H$X$T$W$tJSW y!6SWhܬ0jpW{$j1$|.^_[]WVV1uA|$ t$t$W\ t(5}.6WhL0jp1N^_Vt$#D$ PV3 t%5}.96Vhj0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=p+t =p+D$PV5t5Vh0jKo_=p+u&D$DL$HL$$Mbl$L‰T$=p+u'D$PL$TL$D$ Mbl$X‰T$WVM t6158Nu} u&WV u5Vh!0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVhjm 1HjW |^_[USWV׉L$]D$PS蛴t6St$ th40wwS tՃ} tL1@_1=}.uTG3D$ 3L$ uKG3D$O 3L$ u9t$h$jUl 1St$hSVj6m1He^_[]ø#D$=@u%hS\%tS 0ShjJe*,t$8h,t$8h0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh|.S踸 y%\$,SV0je^_[Vt$ xFP蕺 =}.t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$(轸 ǀ$1111틴$(3x$3|$ uUP$( xLX$3D$8T$3L$4 uF1VVV$('xE$($\hԮ*h.hj%c #v*$(h 0jc1N|(^_[]V=}.t|.=}.t|.=}.t@|.=|.uh L|.t01x&=}.tDyhmjhb1N^WV|.tP8 1|.|.1N|.t |.tqA|.uj1+H +~+H +h+%tN;4m+u1tB |.9G= |+|.xx|. PW1t-|.8j5|.h|. |.&1^_SWV|$tR?tMj hKtSƋ\$WH~ </u>ۉ^F=|.t%|.p!hj`1Hh5|.5|.1^_[á|.t@=}.t|.=}.u0=}.t'D$$u|.tjP5|. WV=}.tB5|.t;11G~u)uhޯjA`6hhĻ+M vu^_USWV =|.u%|.1N|.u|.}$ $ $L$P |.t#HHf w=$Q!pha#"ph je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p赳 E& |.qhu0 ph)p j_e=}.t\@PL$QL$ Qpp p09Bx8|.jjt$t$t$t$phEp j[_ |.1N1 $ R!LJ$Ƅ  LJ$LJ$=}.twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G |. VqP  |.VqP 5 ~.h~1u|.@e^_[]fUSWVT\$tl$h=}.P($ T$L$X$1V8$U2 V<$3 rrt4$tVjQjRD$PhSI $u2@$%  RPhUh^|$x$hSIEPD$PhS}I$Hs Uhu# Uh+SGI SX^_[]Sj YUSWV@L$E\$CD$PSB{3jk9 |L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($ WVSht[d^_[SWVt$F=u1H|$Pt6t)G\$QjPS肕 VSػGu܃^_[Ã^_[鼻USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V}.~1F1u}.hİj9W^ÐSWVL$D$t$|$U6|.t|.tt\^_[? }\1KZ|.teSP;ti:tdx:+9}j U6@+sPVW hV|.:-u/|.È|.n|.|.`S6h+=S6h,hĻ+C?^_[f1Ã=|.u1á}.0hѲjV |.t"H |.p0hhĻ+UC5 ~.hGu_sUSWVd|$|j/7[  ~.t@l$x ~.hGPF= ~.G1C}.l~.D$ D$1D$$jhm+h޴WUHЃJw$R!;t$$@$tj,VÅtj=Vtmj ,tdAE0H@|.=|.t }.s}.uhDj6B1O^_[]hXhhXj B4$<ɋD$L$016WV5 ~.hhĻ+I/ t(οPhihĻ+!/ !uء̻+H ̻+~Ļ+H Ļ+ hĻ+j i2^_SWVPωPQd t4Ƌ$| tC$Sa+t'ǍCPVWs DG }. }.1^_[USWV$t%t_݊M\tS8uEEhrj@Ej*UEƃjSV-U t3l$hUVP WUhڹj\@S:$EE<\t:uCCU貶 $AStRC1fGt,PtStgtstp1B ы$J@u $A=}.tZ}.HVV 4$!:Whji? 1H^_[]V V9h }. }.1Vo 4$9WhUSWV\$tK;tFj)tLNjl$1pSsG woD$G95}.t%}.x!h(j>1Nh==}.=}.^_[]WV5}.t;11GFu)uhjj^>6hhĻ++ vu^_USWV}.1 l$$=}.Kt(=}.t!9t)@tB9uKKt8<}.CSc8Dž$hj=z$uEP!t?NjCt /C;WC |/uHC C$#hj2=Ct/C1N^_[]USWV|$LJ$}.tOwCu kPUC |/uPV3 t2[u1=}.O=}.=}. 2$=}.tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=}.tGtlD$@1G8D$@1D$\1GEt$ h9j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhSj59tNjE|$tDD$@t:$t$PVhhĻ+Q"VhvhĻ+<" $t+Et$h PV 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVhj31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7H }.Ļ+WVVjuD$L$ L$$Vj@ VjՠuD$L$ L$$Vj Vj謠uD$L$ L$$Vj Vj胠uD$L$ L$$Vjż hȽ ~.1(~.,~.0~.P $~.t$,NFF FF |$WVj y|$ujWj WVj y|$ujWj WVj y|$ujWjn WVjZ y|$ujWjB TWVj. y|$ujWj (D$,WVj   WVj 0=p+t3i=)‹1@?9 tR=<~.t3<$/>3i=)‹1@9 tR @~.1QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=8~.ujh=!8~.#t\u#uGWtjxGj jWK# I/>3i=)Ë 8~.,t 98t#@u $jt!8h $1(Whj9- hĽhqj!-^_[]USWVP|$1N=<~.ujh= <~.#t\u#uGWtjxGj jWN" />3i=)Ë <~.,t 98t#@u $jt!8h $1(Whj<, hBhj$,^_[]USWVt$totij/V 1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhfj+1H^_[]1jÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWh$j*S8%hC=@~.t$D~.X Vh~jW* 4Vh@~.D~.1Whj** S$hG}VQh˾j*USWVPϊۉ$ts+11JDhu.e[YAuۉ4$Åt>VB,FN4A1R113W1J 4$$U!G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=H~.u*jh +H~.uh~j1(1N^USWV H~.1Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉ÅujËl$EP $$$KCs{ D$C $C1^_[]Ët$ h 3Pe  1$$CHC1FwCE3x!So!Sd!hj&1NwUSWVH~.t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDhjY 1^_[]USWVT~.CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u T~.-\~.X~.X~.-\~.Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@X~.=\~.l$T$s}ډD$0! umщjt[\~.=X~. tIjt; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Phj  hj1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=`~.u*jh=`~.uhj1N^WV`~.t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(t^t$dtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W!h/jj ^_[]USWV `~.1Kt$/>3i=)‹/uPV Džj$tWWtN$$QVQ4y8~V Q(y,~VIlNF d~.F5d~.3Whz!Whzj VVhcj ^_WV5d~.t~1Fd~.=~.u~ t v6蚫p+ p+tWWvvvv 6踫=p+t v6ά6 V5d~.u^_jhÀ=h~.u1WVL$T$t$ h~.11H<>u5Guu%P=l~.th~.11@^_V|$ |et$>t\jhEP t q+=q+t#hj|j q+1H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPhj^_[]SWVh1NjhSu3hWu!p+u9p~.Džu91FWSh Vohhh9V WShgjL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD Shx~.ht~.   Ph~.h|~.  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ7 7x1D$ereRPQ ^_[USWV $ $Hw.$@U! e| Rh{=p~.x1ۃd|Rh5Q1l$ hVU $ jdPU$,h $$$Hrjtr$@ L$ D /f@ 0 whhhh$F1 $F2 jdPV躕 fF0 $j j0P }. }.t<}.T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U[ $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U| $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ hS$%$ $LJ$m9rD$ )yQj0U/ 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%hpj 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhEW詅 t1H^_jhW菅 u(=l~.u~.u~.hjjUSWVl$hUh1N\$1h$WSi K$ǃ4$Yt"Yh PQ Ǎ A/G<rH )Uhx~.ht~.o   Ph~.h|~.G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP yEtQQP  ƅ(8$VP yElQQP˳ 1D$@$$$$$ȃJ-σwY$dU!<2ǃ$)$Qgtxujh -u~t6h 2VDžu'j0PVhcjH+1FUWL$ t5Ë$rt$Vhvj$_Ft1N1+t W0^_[]fVjhU xKhP蟿~.t)h 2V舿~.1u;5~.V$V =}.thh2j 1H1^WVPD$$|$t }.t$}. }.t"=~.thĻ+j ~.Ļ+5 ~.hmW 4$VWz Wj  ^_P~.t$L$T$ $RQPL 5~.XSWV|$1N|5~.t,\$OPWS4 t;j S聘1t^_[SWVPD$ $|$t }.|$t$}. }.t"=~.thl+j ~.Ļ+5 ~.hmS 4$WSy ~VlPh2hĻ+ hĻ+j j ^_[fUSWV} u74 hrj\$1hWV LtPt߃95+D$h׈ ƀ8/hNVushVtua$PVDtKD$PhDt4$3D$ $3L$ u$3D$$3L$ t1PPS ƅu j02V+hl+ޜx+@uj[hKyj/t PhRhĻ+Z j0USWV$$6 hrj1Ɉ ~. ~.1ChcVUp e~%q~3كrtރvt_x~.ŃV.PtrكRtwftAi~.~.뒃Wt6duq~.z~.l~.~.W~.I~.;u+9|=~.u 1Ĉ^_[] D$h8 j$D$,$S | I9v9/u؃@]9v8/@tj/S t@À;.uCt<.u{t0\$u hC\$~.EHu]j$8u ~.P'j耤~.a$8tӋD$t$ VWbB ~.tRtD$W2Q =~.u8ts8?ti8t_WhgHtj PWh7 +D$@uD~.u;Wh~.;;=~.uWڀ=~.utV/tD$%=@t/==~.u uWWD ~. ~.х ˉ4=~.u Ő=~.t@jPt$< u hm7PF u=8VD NjGHHf wO$U!=~.WOwP"{jWVR GG \=~.uWOwP:GHftIfgft9G =~.u P PW}G  Gw܂ ~./8=~.uG ?tow { PUh7\ c=~.uO1zuSwt)~.t 裾8t1虾8?t'菾8ut/whc~.V7D Dž6=~.u =~.t~.wwM h jm ww PVh7jm 肼PhhĻ+ j~.USWV΀=~.uLVh}hĻ+ hĻ++H ++H +01C=~.l$$#E=jR48D$Pu~Y =~.uvVh1Zh+膹Ɖt9 t4+H +~+H +h+Fƒ1ۃYÉ؃^_[]ÍD$x rt1Pu 1Pu VPWSD$PhhĻ+rUSWVAӉ΅:#K1jhVI $ǍD$PW裞.D$3CL$3 D$(3CL$$3K #D$ =D$WI 1PPPW D$$h PQ衷 KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWG D$L$D$)T$T$ 9D$t;$SVW;~.Vh:`)~.Vh`W?I 1@e^_[]F WH u1PPPWԢ uh h$P薶 KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PWF D$L$D$)T$T$ 9D$t1&F WH 1PPPW* h j$P KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWE D$L$D$)T$ T$9D$tuE WOG j1PPPWy Th j$P: CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PWF ;D$t$$P$!PU L$)L$L$L$ |$D$ hD WaF |1PPPW苠 fCXK\D$L$ȃ|or \$9ËD$| S$PWDD 9D$)؋L$D$ظL$|C W.F 1USWV\$l$UEtMƊAuA)k').j)UXGG SEG~.<~. .t^_[]Ã=.t^_[]USWV\$tKƊAuA)k')Ƌ,~.1Gt?uSktmt&uSRu4~.jVJ1^_[]ËD$t @ъ@uA)k')~.WVt$ >tVG t|$u G?.ww W .u=.t^_WVt$ .1<~.t~.VPs8uG'u .t^_Ã=.t^_^USWV|$tWBuA)k')~.1t(l$sWtu tC uމ^_[]jt$ }t@1ËD$L$ pq蒦SWV.ƍ1P1 ~.tQ:t @ C'u9 .u=.tMhW jVWn~R1ۋphLE)p3r+HQPP$r+Q C9uW^_[h:?WV11 ~.t)~.Q:ujPuFȋ G'uƉ^_USWVj_.8H .(11CEj=PGtAQUljUtGUhL5(w2r+HQPP#r+Q UhV5r+' ޡ.H .(X1^_[]VhBstauj4.t$1P ơ.H .@u1^ÐWVP5h.+DBuFe!ut t- `.]$U!NF밉jWVP t.p. e!j`.x.1D>Ge!uGPp.WVPP p.8^|~u$PPh~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5h.^_ÊVF|uܹո ѹ Ǹ É)B$:@Be!uVPQhkNfUSWV|$,t$(S=`.jLV谁t:xIuxNt@jLPj V菁1tE@j P|)=`.5d.5h."1,=l.uƉSϱ^_[]ùV=l.)u ^5d.QhnWVr|$ |$wLq+ Pq+ .>t'F .Q.N@>vuڋ7 .Q.t躲 @뭅訲+Lq+@Pů58.VrƉRPhZ# 1 ^_USWV8׉ˋ p.t.D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhUjVjVt$ % USWV Ջ\$$St$$tƉ׃=l.%up1҉  ډD$$=l.&uU1ۉ D$p. t.ME \$$L$SPy t D$$ ^_[]ùSWV֍Qȋ\$L$|$$dV!  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹QbEwSWVP=8.x.8.Q(Ɖ=8.=q+ttxt>u -1ۉSPV诓 Ɖ9u$8t*8u+$t@e! t$@u^_[ùo@ USWVPՋ\$St$gƉ׃=l.uKh$p. t.MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաl.HwSjP ljաl.uND$p. t.N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THp. t.N"ىWP1Eكra$"ى=l.#Él.݅~hl. p.2É׃'1Hp. t.NLىWP1 1p. t.NىWPÉl.Lp. t.NىWPe$É׍Eكwl.|$4t;~l-l.b1A1Ǎt$WShUjVjV5p.0't1I1@1l$QPhUjUjU6 ؉^_[]ùT J3@USWV֋] $t$ơp. t.L$ D$T$uPV֋=l.Ww,i!8i!}uPW ֋=l.ȃ}tً$VPt$ ֍Gwi!;E Qȉe^_[]fUSWVfq+$1hB=etuj.0\$h|.VSjS'_U_@PJá|.)QPS |.)١.pQ莿V^PS A $>jhKa#ƅu)h >-u~u5.u5|.$>t<.u 1.D8t/ua$Ph tGPV t6$3D$$3 $ u$$3L$3D$ 1e^]Sh軺t/h診u.8Ltj.8j75|.uj=|.5r+r+f`5|.r+HQPPr+Q 5r+r+@u1[h]Ԟ0]Ph2Ch9SWVW!WP[ u2\$V迠肞8"u6WWP) tV螟|.V胠^_[Åu>0Phhj|.tjPhl h=fUSWVD$ r+fa1Ƀ|$‰tpыLhS襏$thG7S萏u 1t$.4NJ]taM\uNEU\rw$V!\0u!11ЃwxAunjt$>r+HQPP r+Q t$.PN    ȉšr+HQPP r+Q<$t*r+HQPP[ r+Q 5r+ r+Hu 1^_[]ÁfHh|jf.u莘L$ .jP, V=.t .K15.0ppp VPju( 95.t =q+ujVĘV^jpPT$=.u .D$ $1APV..t1It$aLVPL$T$ D$$PD$.jWVP|$t$D$$4$ WWV׉Ρ\r+t Pr+9ty u hPr+C =..uPhmhdr+P =.t5.hmhdr+/ t*t$ Whdr+6 x4hPhdr+xVPhhdr+ r+HQPP r+Q hdr+o ^_SWV|$t$\$蹙SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$S4$w^WVt$ |$3WY^_PT$D$ $1IP>XËT$1It$)VfW!T$ L$9upu'0fuQhƄ j h..@^1....WV|$ |t|$wLq+ Pq+ .>t'F .Q.薜N@>vuڋ7 .Q.t j @.15J+Lq+@Pgơ.PV .^_USWV\$0t$,|$W58.jVi j膶=G8.=.r+ 4.PQ PghZw Or+HQPPGr+Q=ur+HQPPr+Q 5r+juw I Sw5.=q+uZ.t"u*.H .9.m"u.H . . .5.D$P ^_[]USWV|$0t$V袏@O 8.jPw+ _1=.1{t'G8.$pWXWuuޡ.[tZtT1=.uI=q+u@l$41; u{C8.Us t=.u =q+tʋ-.-.V ^_[]USWV\$K1t@ .PSwƋk1OuD$}t 1{PuV_y uR .u=.t~ jW1|$x4$I jt$jux W! <$t$ mE{t Vv1 V{. .u=.tA^_[]Åx W 0PhLUSWV$$D$1t$ .D$$.D$D.D$Ht$05.$P5.E8.L$XIEtH1F\$Xljtw蔹uG8.hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG8.w.tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P8$D$XtH$r4$ ȅu$1ɉL$@=q+t=.u|$ ~ $@D$@D$ )$=.r+4.58.PP$l$41dz=u)r+HQPPr+Q9}j=WZƉt>ur+HQPPr+QFPpU 1Ո`1t$XtOË$t)r+HQPPOr+Qv É΅u$u t(PV5r+ مt ȋN΅uءr+HQPPr+Q 5r+W|$ +t$4~jhX!W5 u|$$ƅuf|$" L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$6 fD$D$" f=@.t*fsD$=T t= u ft$}u$D$@f%u D$.jUqD$,ED$D$tD$L$` =~q+u f|$t$Ut$4$s t@.|$D$D$`t$d D$,F L$.=.tYD$t;=.u.=.t.t$` jt$hyL$D$Hs*|$" toD$ t$,;u..u D$ 1@t$,o.=.  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ] .D$( .."J <NjD$ . D$( .=..Y1PPWW O1ɅȉD$PPV.\$pf.D$ H.$ć.1ȇ.. .L$( .L$L .D$D$hPZ .u=.t$jV 0.D$ 5.|$t&D$1f|$tH ..$.h t$8n.H .=t$L$QPy ..t$9D$( .D$D.D$H.D$L.h.膚.t$pD$ .|$Pt j .u=.t=.u 1..D$@z$jW .D$ =.h!t$8H5.t$Ut$8>oWt$Ut$8pD$ffD$0fD$8D$L$D$u#|r+r+xr+r+@L$D$.D$pSD$l.D$ 1D$T$PW t+.D$|$D$.=.D$$ .9t;D$=X) t=6 u) .D$(1 .D$TL$$PQ t$u |$ uD$0ufD$D$4.1f|$ˆQPW$.$.ԇ.1@T6+D$.r+f`4$t$T$$L$t.D$ .wr+Pr+r+dr+|$Tt!D$( ..D$tD$p.D$D$tFD$t D$f|$t$lQ.=.t|$" t j|D$ur+F xr+)Nr+|$@tht$Dh  $P^_[]ha5.t$1=.ȍPu =.u"D$4thB p;ȅu~5.t$ t$,Pt$=.uS'hh..t$p|$Pt jNt$hLD$( .D$D.D$H.D$L.D$ .jPe }0 .u=.tVPhrx.u.j{.t.1s{WVt$tr|$w$\X!j Wv M $@Fvu;Ftj WP( $jpV ыF @v 빃^_V t$t8>u3Ft,p蓨tF .QjRp ^SWVQA t1OS jjP t6\ >F1"jjP tv1 ^^_[USWV|$41GGG =q+l$0\$S}.AjUfjUPh uA.=.t 4$ 1CSt$WSU\$t$g $w .u=.tS=}^_[]haVP.u1PPVPjhq+/tF$P`{.t.1QQVPjhq+.t.@=PATH5.`. q+ q+^á.SVhrޔ.8uj1^[1ۈq+q+蠎5.thB v65.A .SSQPV.á.ËD$ ..PËD$@. .1..Vt$ |$|v܉Ph1@ .9~1Ҁ8cB. .1^WV15.Vȓ.90t\W'{.0PjPH5.5..@.jw5.JW {.^_USWV$ .$j/WMJt@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVuD$ %=`uVyjWS ƅuWhWh WhL$.x .V|$|D$ p ..5.uu~9} ~ ..^11@1USWV4hr|$$W T$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h5r+](14^_[]UWV׉΋ .uj' k< .11D$ T$l$ D$ $,$<$\$ D$D$V?6u0uFjh+W/ %W/|80uHx.t x0@te^_]fUSWV|$7j/VGu#$jVP uaK$$WV4Su Pu+ 1@Ɖ$m=.ud$$UVuGt8t8t8t.t8 uPVt tVvju$P OfSƒrtt~ .7PSCPVh7jSWVt$|$t$VWq tt s^_[Ã|$u0xjWC6u..V!jUSWVPD$tnt$ t%1;t <:t9tGt$,,89-Pq+}v,; Lq+t,WSQL$ >ML$ |9/u 1xAA/D$PL$Q.E9u,;E-.L$Et <:tEL$<:t1ED$(Q, $+ Lq+AQ:t^_[]USWV$1C1D$ 1D$D$D$\$hnHw5$X!\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ .9A.93t$$1CjWtV@wM$X!|$t&|$ t4t=0q+x'@ |$u.H .8u .PVD$ PW9D$ft $|$t $|$tftjWt jP:4뇉4|$ÿ./tPEȃw?$X!|$u/|$ u&u |$tf<u t$Um묃h.r5r+,r+$@th]1@$$$$^_[]SWVt$..t5Hftfu950q+| Pf9p}Ëu̓h.r .t^_[Ã=.t^_[USWV$G$$X!o .EjWS PqM䃼$$twh1Vh[GPh`.wPQ_ .u=.t heyD$Plhk_/thILhR?GPh t*r+HQPPr+Q*r+HQPPVr+Q ^_[]ÃPWhoSWV|$tWȊ Bu%iC)ʾ!)!.3tFWP_tc6|$tT.W&PnƉf@@ WPj .u=.t u1h.^_[.h.Q臠 .u =.6USWV$$$j/$?turfEE^ .9tthV't $j$q1Ʌt@@t`tm$umtisD$ P$UxfE$KIl8;l8-l$ u=0q+x $u  \u =0q+y& u $MƋ$1Mtfyu0q+YL$$j$P 1OD$VmG.tAPh{t$t-'5.h{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=.$Nu$j8tj8t jD$}o$E$\$|$$t$t'5r+jS\P$hy VfEo$T$pƋ$$.|$ÍD$ uj$HfxT$ ufBuω7 .u=.t ׅt"G GfEG EG fEGE fEEĜ^_[].T$ Éuj$fxE$ufBj .tbiVP"C+Lq+PujVtij$t3fxu*SVm$=.V$hSWVP0f!1t8|$8f!L$8u%tWPWZL$ t us^_[SWVP@g!1t3|$Hg!L$8uWP ZL$ t us^_[V@g!t%Hg!jPf@NHu^V. 0q+trft fuxB =h.r^USWVP\$= .1N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPhwt1<:CG럡0q+y x50q+1Ʌx $y $Q50q+^_[]SWV..>t+fuwW߉?u׃h.r .t^_[Ã=.t^_[WV|$D$ .jP+@ft*fu vfFGF GF GF .t^_Ã=.t^_WV t$D$L$ .fO q+fOPGWVU .t ^_Ã=.t ^_jt$itfxup%1USWV t$811G$1D$h<ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP.:KB.*#$1\$ D$4$߅u U@=<]!t,]@]!<]!8uUPVujU*ƃ<$t0vh4$.H .(t|h!j v(6tuh/vh*.84$tr+HQPPr+Q l4$t%UhPh?+h  ,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$ Y!D$j/U5jUt~b0^Ph>:uhh:YuhaBu hw7t.Uh+ . t$|$tJHht$.H .(ouh^V돡 .D$ FjUD$PK P.dN<$ur|$tLPhESht$ct$1 ^_[]hctrRVhVh1PPt$  5Lq+@PbUSWV|$D$\$=q+tl.H p. Lq+ t. Pq+ .1ɉ x. .H 8.Sp.tH .~t.t.dH t.t.+Lq+Pb..u%Vjap ..s.UVW.-.5.x=tE.0va5.΅u!Idt..2V'..t O.G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t.t D$r+ .D$t.+Lq+D$?~uЃtRWT$4$ D$1@D$ wy< .H .ft.e$!PVVoT$0/>u!y@u=D$ D$l.$.H .Rt.Q=l.unt.+ Lq+;L$~[xuUHt.Q.H .t..H .t.$ |$D$5ЉD$$ .H .t.aT$,H t.>~=u|$ D$ RV"T$4| u8..H .~#t.%`T$,H t. X~`T$,H t.$9Ut$ .T$4t.+Lq+jPHPT$8 !`T$,H t.>.H .~t. _T$,H t.8 8._T$,H t.8._T$,H t.$^_T$,H t.D$$ 4|$tu^_[]USWVt$,\$(=.t.t$D$ r+&j8\XNF.D$ x.1oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=...u(Q9PY.NQPS5.謋. .u=.tP.9t31Ʌt AuQP "u=.7vA .6^_Vt$t".0v5.΅u^V5x.t1.6P5x. .uۃ=.t莻1.x.^USWVt$(PYt.+Lq+PXLq+Gtr}t  KvC#:t /tQ t7=q+tAL$,u8 .Q.*[O@랃tPgY^_[]Ã=.u Z.Lq+8t!P>wtx P!Yu$hKljPXGËD$,tÊc!$< t< s4< w*.H .~t.RZH t..H .~t.(ZH t.Gw/u}/uE P#w USWV,D$DD$L$@9A|$$D$t1e!‰T$D$D%D$ j=L$Q['D$pD$$L$(<$ L$ u:|$L$D$ PQV1ڋ\$L$ X.T$)11Gt.+Lq+D$D$<$u \$H l%t$l$UPRT$LQT$L$ t,1t}y;@ڋL$ ul.t.+Lq+=q+\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =.t1C L$@11ۃ9|$t$ |$Wt$T$RV; WqL$(/<$ }D$1|@uD$.H .~ t.ՍQt.BWt.MPt.EK1ۋl$$]|$ D$EÊc!$< u..H .~t. VT$H t..H .~t. VT$H t.]EuKl$ u% t.Lq+)t. .\$\$L$ D$E< w..H .~t. VT$H t..H .~t. UT$H t.]Eu1L$ }D$n $Ip$HY!|$t.H .~Tt.R1G>L$u0L$ QV1>t5t.U7t.ۋ\$uh$U\$H t.=t.+=Lq+t$ t$(St$ WVdut.=Lq+t.)=.S1Gt.+Lq+t$PS  <$t[1@Ftuրut܋ p. p.̀tuŠQ1ۀ؉Hu,^_[]ÉRPhdkL)Ѓ58.hF׊t!#u(HL$IQWP58.h D$ƃHQWP58.h/USWV5t.+Lq+D$.x.D$ |.D$$.D$(.D$,.D$p.-Tq+Tq+|$0WhQ+Lq+PjPD$ P$WWpQD$,.D$(.D$ L$$ |.x.D$.p.-Tq+D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 .u=.tJhWt$ yN8t.HD$EEt< uD$C낉$L$}1A9.} nRL$ƅ~N$ . FK1:.H .Q FK1Ƀ=. R1ɉƋ$|$tc!$< t$< s< w .F$ .F.D$ x P D$t PZD$tPi=.$u+Lq+jPt$$ 5t. .u=.t˰^_[]USWV D$4L$@-t.5Lq+l$)hP#D$.H .~t.PH t.=Lq+UEWD$ PNt.+Lq+PM58.W=ljӍD$ PNLq+ t.t.) . . iPt.SWhUjPt.xt$GF9Iu|$"tjVU0 t.A t..).D$ ^_[]SWVt$|$\$.t#9Xu 9p ux2j0L .x...Xxp ^_[WV=.t$ 95.~?=x..?P ~=x. .u׃=.t赮x..t?9p|.8P}.8 .u=.tn .u9q~)q$95|.~ ..x.5.^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`.H .~t.WBH t..r+.5t.1t.^_[ÃЃ w=j PV =8ű$<=tuw~;5.ć.b.D$5ć.ØD$D$‰؃AD$$Z|$ T$L$T$|$,c!$< u*.H .~t.AH t..H .~$H $ t.Qt. @t. $Q$ Pt.$eØt2t. $Q$ Pt.$eØt2H t..H .~$H $ t.Qt. 1>t. $Q$ Pt.$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G.P.=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡔ.9tH9u wM8/t FQ D$;5.tF/}tEEGXـxs@<$uokt$ tdǀx .u.uN jWt$G t8tG@u@/UPWVP5.=.tt$ tWE/Q .߀xruX@8tB@9tD$P5.x5.,Ą^_[]ËD$1Ʌt AuQPFWV|$ W@P7WPPj7p ..^_USWV\$D$|nOʼnmIWP)|$SUÉps'x 7u߅u҉3D$^_[]SWVt$(\$$W7C p.Lq+t.Pq+..js.H .~t.k9H t.t.+Lq+P{6jVP W7^_[USWVt$FPhrr+HQPP謥r+|$Q1ۃ|11E4E9uSh衩r+HQPPRr+Q|=1C4轤r+HQPPr+QC9u1^_[]hTrhThԀ.H Ԁ.~؀.H ؀.#=~uԀ.H Ԁ.USWVP8q+H Ԁ.t+u yԀ.H Ԁ.~xhPr+Ӥhdr+Ƥ ܀.18q+~PX؀.hSpw {e28t_8q+xL28#>WjW !Pjj  h n8q+p܀.8q+@1ҋ؀.  ؀.@@P t 1+؀.Ԁ.8q+{tXAˋ-܀.M ܀.~ @لt؀.أԀ.=r+t$5؀.D$訢5r+JD$؀.H ؀.0~^_[]øԀ.܀.1܀.Ԁ.hvUSWV=8q+w .^t)kUy~D(< t< u kt!Zu忀ރlt puԉпɁu.tg8tbPhq m=q+u =q+u@.tA5r+jPvW:.H .@ujp W5r+ 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPhp W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thjD$P ] .)i5rOC-Dq++9tti-;)t RPhjl$ U蝖\$D$P{$t+,D$0hjShS\$JŋCt:tBuM ,%PhjQD,ingD,Runn}=tQHkl$ ,j SP0 D$xxl$ ?Sl$ ō,@)QPh0 h% jQ芕 ݍ,PhWD$P赐݃FD$ ݋\$GHO WH EuݍCWPj$u/1M|t؁PhKWx N1MM|FGHO WzH GHOl$  WVH|1GHO W2H ~T$KW衐D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =q+$tCt>5@q+ 89t%5@q+)PVb $=.~y\$t$1=.tEt*t t.<$u u/S0=.u WE;-.| $^_[]0YhhjPhx:USWVD$4\$,tl$0|$WUS ƃu{8=.t...D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o.D$ .$iD$ 9T$tcu tQ=.t 1=q+uL$,uP9tPtu r+P .u=.t^_[]Vt$.9tPNdžƆ1z .t^Ã=.t^#WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h@W5t$ntpu؇.D$D$D$t .8D$t(1PPS IjS!A=.u|$ 1.-.~6@ .D$u}t!AH Et1jPƅt=u ED$u >u G t$Eu.t Dt111D$uD$.L$L$t$D$\$l$|$ .@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$.C$jU9 L$tc|$tNuJD$1rȋi4hrjD$(P9l$D$D$L$D$u UD$\$l$t0~Ot)D$.y\$l$D$tUD$tMjPSx ?jVDžtjuSW =q+u V| hŃ퀉0^_[]hDA{Sha6{Shw+{USWVP1$1C11h~1it"gu$ڃjt puЉ̉( .t yjPƅt,1t.)i5rO@Ph4H$t#tH~1i0 tPhp 11G^_[]Ã~1i4hv蹊r+HQP~G ;| Z %PRG ;| r+Z;|lhyhyV1=.ujt$ Ot1+^V1=.t. .~$A.1F:uI}^V=q+tO=.tFD$t+ .i5rOA1ɋr+u0VQhR.^USWV=.u65.~%=.Ft WN.l$.~"5.HI}.tfiPƋ-.=.iPUV ~ ;uKuUFl$hnƋ=.5.i 1҉AJw)׉=. .u=.tw.fdž=q+1.1B|iP .u=.tv^_[]SWV\$|$ƅtt.VSt$W\$<$D$ #^_[70\PhvUSWV|$ .tW`W4~*15..l.V:V~5.l$t$t%t =q+ttttk0hWjWjt uumul1V Vh  tOh huVj uV5@q+ tTWj{Wj{t*=q+t!WjzWjzWjzu.^_[]0F[h|Phx'uUSWVt$ l$|$1ۃ=.t/t*=q+t!ttSV, u5f@..@.^_WVt$ 訠 .NJujVj 瀾tW5@q+B <u%+.i5rO9Dq+t ijVt=tu  ρπtt=ttu j u VG .u=.tr^_0YhPhxrSVD$L$ =q+t1ۅ SPju ^[Ët$1҅tހu1=.u2.u) .~.:tzt Iuh+~.1@SWVt$$1@=.|$(1@' D $Y!Whbjvu h(Vhtjjvjv 1~ h21@^tjs%;thPhjvh,# 1WvhC1WvhHWvhTjvu h(VxhZkjvm~ t+u h(VGhX:jv <u h(Vh_cRjvu h(Vhq7hv h)rjvhpjvu h(Vhj;hvkFp]h)rP~tF1SwJhO.Sw 1> |tP uhh`vhv'1D11N9tQhrjWWSxuF x%PhrjVVjv S h 51^_[hMhMjvUSWV fD$ . .l$ 1D$U$u1!" $,Z!]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ  t,$$׃߻ !$}D$} u$,# )4$<$zT$tvӃuxu;Hx@u8/UD$PV苆x D$pL$t 1D$tD$p1ɋ.9..tH1 8t:tGt89=Pq+Z 9=Pq+~.5Lq+WPV >? <=. V2: fiDle cDhangD ged߉Vvr+HQPPvr+Q D$pL$t ..E;-.1-.D$PĔ^_[]fUSWV<1UjkD$hhh UPjܑ $9u 9È`.j U(  d.jh.hrUNhL q+,$Uhl.H t$T|$P.l. ..t.fD$PVWVW(=`. Àu@{=q+n$h).ttQu . .<$B=q+5=.(ȃu6E...$.uk=.u7r+HQPPBtr+Q hdr+tD$P.=.tg$$=`.u>hK~D[!t1Ph6QPP[V$=q+uq+ `.t N=`.uEt$(Vh@ t8t$PBTPV$8.=r+t =.tjZ!luD$P.u/jM=q+tFh2rhdr+Ss*1ɀ=r+ˆQPi=r+u=.t4q+8.5._p$$#uSWVD$8t^.jP ƅx jVK .u=.t&ex"1=q+t=.r+t.r+1G ^_[11=r+t r+1jLV3V:=q+tt.r+ur+^_[ USWV|$(V11C=.tCn1=q+u4t0j5r+qjhdr+qq+P =Lq+)Pq+ .u=.ta^_[haObD$t Lq+) Pq+Lq+j hnj! )D$ Hq+ Lq+H Pq+H .H .H.ËD$.H .P .u =.FaVt$.Hq+;t Hq+P\0FLq+FPq+F . .t^Ã=.t^`USWVPq+<k.-Lq+5Hq+.t|F9uuHq+PVH* Hq+Hq++ Pq+ .Lq+=Pq+.tG90uC Hq+ Lq+H+HH x@WSUP  5Lq+=Pq+ .t^_[]Ã=.t^_[]`hai`D$.Lq+)Pq+ .u =._V5Pq+Tq+x'|V5Lq+Po N5.5Lq+Pq+.5Lq+^V5Pq++5.sPq+)𣨇.5Lq+^ËD$ Lq+) Pq+ Pq+Lq++D$ȣ.USWV(L$@D$D$@t-΍i11P%wDGÉ,$Eu1ۋD$PWh3XWhWUSWV(f11CD$h_AR t!HuStau׉\$σʃŻZ!C9t;[ uVhoW1N.ɉL$|$xtD$ hl=Qte\$ 1 waO11ہ̉ځ Љ ۉӊ€A ru1G11Tt$@1ۄnD$ xjWhjޑ9ىƉߋD$ \$ D$ |$Z!C L$QPCsP\$3hf\$ utt$|$ t$|$t$1N11 uhl=f+D$@ jPWt$ƉRPhqf 1 PhYfgD$x @ #t$C\$SP|$D$ tMt L$L$|$t D$D$|$FSP< ~unjh.]uT$tT$|$T$|$1I1Ѹ1 uhe FjPWRRPhce 5r+a r+1Ath`1@e^_[]t$hoThSseT0e:PhKTt$h=T0=:Ph#TfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WV t9t9u1u^_VhSSVhhtSL$A1@҃Ѓ wAu1SWV\$1tZStMPhS 1Ft5WhqS t"uh~S8t Ѓ s^_[S_ 1ɅfVt$ |$F.(q+Ɓ6r+uq+j. .u r+ =r+=q+u't#j7tj)tq+q+<u=r+u q+=q+uq+.=q+ut 8-uq+(6r+u 7r+6r+7r+uހ=r+.u:u6..H ..jP#... .t/t_9tZA..Qt ..ȣć..8t .Ax@u. .^{h5QUSWVt$.H .-t+C11C<-t1Eu{-1Eb USWV1\$@<uPƋtPEu1ۉ]h..=.5ć.ȇ.^_[]SWVP\$t$t2uhV1C$"h}^ZP(0r+u*6r+[4r+RQPh^uȡr+HQPPtZr+Q (0r+t"6r+FVt~QPhh^ u.$(0r+tPVtu[VPhrM<$u#5r+t(85r+uƁ6r+u숟6r+h1 _q+t$]q+t(85r+uƆ6r+u ^q+@uă^_[V(D$ T$4r+9tu[RPhFLt#5r+t(85r+uƆ6r+u숁6r+^WVt$ ~t)~tPuv^_USWV jA .t_y 8-uUD$$.1ԇ.P  .y8-@P1F Pơ.)..=ć.~-.Ft7.1Nć.1ɋuȇ. .=.[J1F5.P)ƅ.99St. .ć.lj4$މt$\$)1*C/5ć.9rL$ 9v!\$ۋ4$ P; ć.w4$ 9vQ9wȇ. .u=.t[IWv1 ^_[]hIhIhIhISWVT$ ԇ.tstm8u'1z:trrD8uAÀ~:u"9u .Q. tf ؇.1ɉ ԇ.D5.>1t6?-u1t+O^.-uta5.1^_[PhbHPhuH|$u1PjPPge.jw.8t PI .u=.tG1ËD$Ѓ w#j jP uȇ..ËL$~ND$tH  ć.=.u ȇ.̇..ḣ.hȇ.QpphGUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhrh)Y J|$:uUD$8@?jPh)Y ^jUh)Y 1|$D$0)@<Ph0hdr+V jh)f1?\$D$01@11T$4*l$Phrj UVhUh[Y D$EEjUt$0X u0^_[]À|$:uD$8@:PhDK1L$0L$4@Uj EfVD$ u:<$ t=uY$)jWPX |$l$$uS\uN.H .\FÚ u%.H . F4q+#á.H .ƈF tq=v4q+W=t h|]! u4q+=Lq+)FV  $[!=a!u f|>z .4q+BסLCD>fT$ 豘T!uhЃo茘0N,s05,/L>=c!fu .Bn׍MN|$ @01fD T.fTT.fTT.fTDc!fD1AL$!(ljƒ(M .FD .BvNO|$?@81ɃfD T7fTDd!DfDfD>  = .\G'T$ t$>Hff .T$ Bf|>D>u6t$nMn .}f|>  .BFfL D$$D$f|>tD>t .Bf|>u D>v .BW .B*Ã{t e! .}E+=Lq+ .E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $JnMnD.=a!u . ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDb!fD .T$ B1AL$ I) NjFfL .B) 4q+D$MN1һ|'>$@0L$1fD t>ftf\fTDb!fDu6t $}FHF .B}= t]\t 'u t =u 4q+t 4$t$:ŀ>ts4$flT$ )Buxkjy1$&tu>tyu6EBE9E0E"EEEA }$B2V (. jjV0 ;Hr+~=Hr+9t V51 ^_Vj 苣tL$ T$50.00.PH^á0.tT$0.9Pt u0 P~0 USWV$|$<\$81D$ $D$1F5T65+hWS~a !1tbhΎWbh WLuo1<@.tE.4@.@.t jV .u=.tF@u@.>hWċth&}W貋t D$1p@|MD$K}hI Wzt8D$D$h j5r+1CKD$D$u}h v11 t=t8<@.u.u hv VaPh  GF@uh2A F@uu=@.tk1uu莩ND$E11P@É|$t<@.tW4@.hAh<@.t4@. h {SfPh Eluh5r+ Cu|$tE1F-.D$t P贘1<@.D$t4@.D$@.t jS< .u=.t2Et h211<@.t:@.8u.u h aVLPh   GF@uh2/F@ut h21<@.t?@.8t3h4@.VPhm F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=@.t61B=.tbu^1Ƀ~7t@tuH1=q+4 @.t1Ҁ9ƒ (u1=q+B1ɉσu1BD.1t)9t`tbփub1^։PjS% $u=q+d1@ָ PSt^uD.u jS 1D$ D$D$$K?r 苔 1@ jPj*! ^_[À=q+u=.u =r+=q+1@V.@.>t8t6Q@.r@. .t^Ã=.t^SWVt$u @.1ۃÿ@.t6@.8t+.SP .u=.tD.=@.ru^_[,^_[V1=@.u#@.1A:t2>u @.r^WV|$ 0@.u"t$=.tg=.u^.WuS =H.tӃ<@.t>@.8t2t-..=q+tu=.u腒0^_WV|$t$ D.uWVjD.<rjV~uƆD.^_á.=@.t1Åt8uUSWV.1G.<.u@@uu.=@.u΋4@.tã.ST-.VjPV!t<$tS--.m .^_[]ù@rA<.tøWVt$ 95.t)1Wj;Wj0Wj%5.^_ËD$..USWVhD$=.u.)=.t.t D$D$...=.tt$,jV u 5.et$,jVj u45.=@.u%=@.t?t1@.PWt.jV! u5.Bjc|$wfs 5.觎1ۍD$X XXPjlR SW\$\$ \$\$O?r 贏1@ DD$jPjN 6?VP uf5r+t$WVt$|$ ?t*FHN V>Qu95r+u V^_5r+t$WVt$ Nfu.FNtF t0fu^~. ?NQPޏF N)N.v衏F FF .u=.t V N^_Vt$F t-)t'VfxQPR yNFN F^5r+t$USWVP|$t$j'V`t~thVF <k>t!h|^!V 1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=r+uUWMGHO W]H"WVGHO W3H"^_[]WVh|^!Q j'V^t)19<>^_hPr+ohdr+bUSWVD$~@|$l$1SWU" t 蔋8tF r)~1H^_[]ËD$)D$.\r+tP蛾1\r+Tr+ .u =.>PD$L$ T$$RQP XVPt$t$V tt$ P4$)^hQPD$L$ $QP5r+ XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+8.+.Pqq hIjh$.i$.SWVP.^!C PVw u,$$w9CGσCGCuht.Vhj8 u*$ h.h.l.p.^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')<|.t>7t9^ uSUv t61^_[]ËD$t8SV 趨 Ƌl.`up.$ l.utn$;tD 7p.㟉l.t$D$$C ^[WV<5.1$|$PW= t $D$PL$LT$H=.PQR 5.$<^_USWVL$T$tHtA|$9t91e!Írjt/9t+1e!tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U@VcƋ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh|WV<5..$|$jW u"D$LL$H=..PQ5.$.<^_USWVD$ èu|$=^q+uÍD$PQW Ƌ@.Nt$݁ uF @SPуF`u vaF~tuF1Ɏ! s%t É^~܊.tȊ.u.t jK~ .uk=.tb[r2jXxL$H @ $  $#`uW莸`u W~fy^_[]vv h D$@!|$$~L$( t 9-uD$@-=.u0@=.tc@=.tf@=q+ti@=q+tl@=`.tp@=r+ts@jPh,WVt$|$ .tw蝅VP? .t^_Ã=.t^_CWVt$ t|$Wv 6u^_USWVP\$.jƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR賄SP}j=SjUS苄UPu< ؉G@58r+58r+hXq+P\ ~ F1gjt$T.uQG L$<=u5.H.2UjS $81F FF.T.~ .5 . .u=.tw^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ .t8Q12<08uF=u =ut j=RSF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWV|.1tr:1҃Љu.r׍P节ƻ|.Nj+t7Mȃu%EttUЃuEmŃ.r^_[]SWV|.>tLGu% uwճGu#Wų@tw詁Gg;u.r^_[2SWV|$tfhW8 W_99uWhV't*tUj'WRt8)WPh h GhWhf^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhqYtUhqY>=uDr+HQP~ j( P r+j)n~=uGuth EUr+HQPPr+Q ^_[]USWVP.u. h.T$ t$\$|.1<$?tIOt !T$ ttуt݋ .9|QPYT$(.%.)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPmYI1>?f u%PV_1u%#L$1PV1t1Ʌȃ|^_1@Ow$|_!1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$蟕 t$TW 19{USWVӉϋu@.fx@$_!$PW?1ۅD$PV'r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWp1ۅD$PVX$L$$t$<|$@11$;D$D9t$ aZ$PW1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVWe1ۅTVWe1ۅfVWueVWae1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]6oQ9-u1tQyt8ytBÄthQida!t1h) jjha!Qh) jjh`!h) jj h`!RcËD$L$  )VL$D$ 2)u AJ)^USWVPqj PV莢 ljq8t"qځ8"u 11E9s:$9t( +@DQ@uuN9t ڃ^_[]VhVhUSWV׉9 t 9Fup  ^^R 9uM1PPR ~ōP rPUR ~ LH;NuS+#~^_[]ÐUSWVt$(hrjźD$,^H $x?-Ok-u)sstdluu~xwGWW Åu"+DHt'1Ʌ S膼 كhh+DH\ƃ~ƀtV tV[ Vhjރ $h SDa1Ʌt:SU u+$891V5r+V|-$K$8ʉT$hI W`1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UW u.JU |u $4Ph 1@D$l$t jWH ;nj D$PUV ljӋD$9t-ف8ur1u m8tQxrUPhT 1@D$\$ $4h/1@D$F \$ t$|Phjg.PPPPh5r+2jDWVPΉj WQU 9u=у|=}^_Vh>jhQhkj5r+jWV@...5@6>t)j=W>thW>u Phrj@VЎjVhe Vhr+h <2VWh[  ;tD VQhC j,hjhpq VWhbL^_L=.t 1Ԁ.܀.?CPkAQW1^_[SWV|$t$h!$g!Vw vVw d_ t"Vst Vw?w<#N@F1Vw q#w #N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uh!E$0h!Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tÃ|$USWVPu }D.H.r+f`|j%vl9m O1@ 0L.D$,P.|$@t$(q%v>%L$ hV <*u C hwuSܻ 1N .u{*u{ 1HD$ChwuS註 1HD$  t$CD$'C`L$&~QF0 $h!. D$׋L$ jj D$tfL$tjWt$QPhh.TFu$h!L.l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Phh.eL.L$ Q0Q |$L.H L.T$ l$=H.uM|$L$ jL D$tbL$l$tf|$ L$D$$h.bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$h.L$\$L$$X8GL.0L.E ƋL$ cjl |$D$VPt$wL.L.L.L.1  L. L.Wt$*|$$h. \$$.d.t PVPPd.҉D$xF\$wZ$Ti!a=&t1"u@"*\\t#'u0'btnv fre\qFuZ+AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V.T.T$t P跕T$T.X.t P藕T$15X.5\.Љ\$H\tF5\.X])P0tXM\$u/^t-u#F5\.벸^tic\$>T$ j5\.F5\.{ +1:DYt 7GuF5\.\$DF5\.ȋ\$+1L$ jlD$t1L$t5WQg.L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hh. PRQt$QP  E.FPFX. VjxP\ 7sX.T$t t$L$ t PVRQhT.螸 MT$L$ t1PRQhT. .VWhh.1PQ*t$P PQhT.O tT.`.T$z \trB<]*<0tu$i! ?$pi!."'#Eu uSh( D. 4$+D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hlD.\),ҋ4$u|$ uWh<D. ^_[]WVPL.0tpL.)[1ɉQPVk Nj +DQt$cr& L.+ P.VQP D.1^_SVˡ`.H `. u:r+Prp~r0 P{r+Q 밅u`.)r+HQPPDr+Q^[SWVPL.0t"L.<'t<"u1B^_[11fY1ɉQPVwB lj+t:<-t6 +DAu)L.+P.VPhU D. $ڃ^_[SWVӉQǃArVhFAD.GPVhh. D$e.f.Ƈg.^_[USWVP׉1PPP肻 ,>UF@PUQf x$tG9tCL.+P.VPhi調L.+P.VPh^L D.$^_[]WV9t"΀:t9L.+P.9t\VPhiZL.+P.Ph/DHX8"uD=L.+=P.j"轢PVWhFRPh# D.^_USWV\$$8l$}hVE j jhj!Utƅu!hVE j jhj!UsƅH h]B uD$L$01HÐWV|$ ww 7whg9zj!t%j!NLQPhz  uW WG PVhy ^_USWVj:t$$0(@L$hk!D$P诃 ƀ8j=V'GPhWC k^cihlwVG+hW VuGPhvWC $L$A$ltkou|hwV5Gh8W VGuTPhvW:C $L$A(hVFu"$L$AxhVFj!j!:uPVFt E ujEuPhvWB E $T$L}t8|$Y#$L$$L$A܋$L$A Ѓ^_[]É1u hj Qhj fSWV t$ \$81?-uGF(8hH j jh k!Ppt0Hu~(u+t QIN4tVP1@1 ^_[WhWh 4D$L$01XEVD$H8PdpjVp$RQ^ËD$x(t2#H@KH@@8+$@#HDHD@<H8"H<#HDɀHD@,ËD$#H@KH@@8+$@#HDHD@<@,Vt$v4+ fFfF0^ËD$@K@M@PHDᜃCHD`9@,VD$H8PdpjVp$RQ^Vt$~(t D$Ph`t6T: F,^SWV\$1PPhF x ƍC8j,PV[ Vp yTjb P a C8Y C D$<$H $xd|$<tWjt$* y hBq s|$@t'D$tPhgtt$* y h jw]5U6h.1D$@D$#uFj PVk =8u$8u؃^_[Vhj^ WVhXj USWVaOf.̌.N .ƒ .Ќ.O .€ш .Ԍ.HN.،.܌.h~ t ho t8ƿLt!PV.tG uVhjG  $$1ɉhSU P6$o!.kj j5U6j ƃu-<8"5̌..v U6fԌ.Wj j5U6/j ƃ _%.j j5U6i ƃu;8"G5Ќ....1A5U6? 5U6h6>V,tchV,K..B../Ԍ.#:8"tD5،.  9u،.rCjho5U6hT#Vh5U6h; 5U6h"j u h ܌.t 1ҁ‰..փ95Ԍ.u<9Ќ.u2.9̌.u#.9 r+t r+..=.u\1ɅQtTh +=.t)ͅt=.ut 1jhh.P4]$yh.hj =.u1D$(Pt$u#D$0=u ..1N1$tp! $$hV$ ~t$hQhehVZV`}thP0$Ph .. $=.=.p.B=h 2tD^t1@$$Phmdt$ hhh|tW Wh $=.u . =.u . 4$h. T. $$1 uWhPh. 1 .$.(.,.tjVh .  h.\ $RhS .h.VW0 5.VWF5 WW1l$t$D$ 1ɉHHD$UD$ Pj QDžy#58#Bjf .x߉DžVJ{ x9ujUjU 1|$nh 2$P[<hjh.1 ^ W~0t $hXhl+ +H +~+H +8h+n1ljt9 t4+H +~+H +h+.1ƒ߃NyjUjA h,2 1.l+h.VW4. 5.VWj3 h.dtd($Ph $Px1@PNjUj g P I P# h"Cf tǍ$PWhV D$uhMZ$Prx1sjPhQQQ ƃu W}VMNWVθ,Xq!PV(%t uVhj G Ԍ.Ќ.Ǧ.G،.O1.t^_^_WV΃=. .t>܌.t49t09t6>9t6>QPhg 5܌...^_SWV0@v! USWVPύAPjhhl+VGw4u!h*Phhl+hV l+w(h VRV w,h'VAV w0h.V0V w8h5VV w4h<VV W4O<W89tQhhChl+UrOHtQPhLhl+UrOJtQPhVhl+UrOLtQPh`hl+{UrONtQPhjhl+ZUrOPtQPhthl+:UrOTtQPh}hl+U<$f$1۽al+PjjhwVhl+PTwVhl+PTGtmÈJ9|6{u;[tVPWh` D$(ffL$(D$ 1ۉa)D$u!)tPt$hH]` L$4 <)ǘ΋I<9vt$hu4` $N<.”T$9vt$h` $D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h_ D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( ..t$(L$QhVk_  D$ 1hV+tG<$hV 4(1>tYj:WrD$AL$\$hS: ,1tD$h W tkhiMWhKW\D$PhmW D$q;،.ef.ujh l$!U l$u!1tUPsQFu!r܉1hD$ Pj <$Wh] D$ D$t$ <$}trÉD$hU2st:hU st/hUst$UWh5;] F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhU\ D$ D$d.FʼnD$uf5 .l$u D$l$l$hDWh' WhWhWhW hWrhW\ThWFhW0hWUhWkhWhWhWh*W<w ~W|$Wh> [ T1<$`.jD$<$rt$Wh Z D$f .@<$Wh|Z ،.f.jUh.jUh . <$t$ht$0VZ J21jD$ Pj< D$0.뜉1jD$ Pj D$4.q1jD$ Pj uuD$@.J1jD$ Pj uND$8.#1jD$ Pj u'D$D.1jD$ Pj^ tt$W|$Wh`Y D$<.1hD$ Pj uD$fP.1hD$ Pj uD$fR.a1hD$ Pj ^D$fT.11hD$ Pj .D$fV.1jD$ Pjc D$X.1jD$ Pj8 D$\.; ،.sr"jW|$WhyW|$WhY΍L$$ t$.|$.L$$ L$.t$.rhV0x l$}}p!1ۋ>t.W@Lt t uPUWG ÁHq!r D$+MDHu D$"91hD$ Pj t4$hV D$ \$"r)Ut$hV hV D$1ۋD$.ND$.Wh4(t$|t%hV w  L$1Ҁ<tʉT$D$< w'<$$p!L$ L$.<$tL$$L$ L$.|$.cL$$t D$|$.L$.16FL$<$C fF|$.L$! L$.|$.t8L$$ D$|$.tL$.11A<$D$ h.1D$ ȁ(^_[]4$h U D$ WVPθWEV..f.h. f.=.u=.u#$}h.hgdV 1h.hfdV y8t 8uv$=.u(PhmdVn xX5r+hq} {?1=.u$h.hgdV2 y 1G^_ùh-i뙃=r+tt$ t$ t$  A1HVD$ t$=.thPh. ^D$L$01Vt,uVh-t"uVhYVh) VhVh$S ^h.hmd5r+& USWV8 $RPh h.Q? . .v|Pt$hqR lj D$T$1D$ XƉ 11 ‹l$4. ..9.hWD$P $;D$r=.t =}t=}uЉD$$=.tȋ .=WEVuT$tf9،.rD$Pftt=.%4$t$UhQ  D$t=VEW=.$t=VEW4$t$UVh6Q =.|4$t$UVh Q =.$D$PSt$Ut$Vh6 @=.u $h.Sl+V 5.SVI SGSt$VhVW .D$ L$D$11t4$hJ0 8^_[]USWV T$ $11F1Ń=.|UhP  QPWD$Pt$? 9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=.tUPht" t9t+DJ@t1^_[]WV1t>΀9t7hV <t#ƍFhPl 1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)WhWh L 1۹.؃^_[]ËL$9/up@.D$\$A/jPU u$D$ 4.D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh9K .!Wh#K .1 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhn D$$ThSut]zv!WPWS '> uۀ$U-$T14w!D$XP_tpC"uD$TPh&s8$T$끹 w!j" $eFMu SQЃ {Sh 8h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h' /$PQh@R~$  Vh-t<1$1D$$49E9l$ u׃ |$ $h jWSH1t1A_ 1 ljD$w1@D$1t+H t+;+hl+j 2l+H l+ $hl+Sբ l$;l$ smS 9}HÃt+H t+;+hl+j K2l+H l+ 9|$hl+S` 덡t+H t+~l+H l+ hl+j 1l$E;l$4${;^_[]hj D$L$01IRUSWVH֋] } t>$u ~ˍ|$@WVO 9t"b&J~PH k$Tv!1OJH w@$|v! B(D$ D$$l$ CtGtngtbcB8D$D$l$c ɋB(D$(D$,l$(B ɋB(D$8D$<l$8 ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=IJ.uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph)h#)~USWV|$t$t$hV%, Gw4Lx!hڝPhV+ GPShV+GPShV+Vjjh GXtVjj hGXtVjjhGXtVjjhgVj ; w(hV[+ w,hVJ+ w0h$V9+ w8h9V(+ w4hOV+ wu 1<1A71Au01<  $jj@PD$Pp D$ Ph C9u<$u4t+H t+~l+H l+ hl+j &1^_[]hj覬 fUSWV $ $ D$-@1Ȳ.̲.Ȳ.в.Բ.в.$ز.ܲ.ز.t$ hUS c~!P$@y! .˃PtdT]=U6?1AJ5U6m .뒹 .U6ز.hrn .b .D$.T$:@=Ȳ.lU6D$ Tnt uBxou D$ 1Ɉ .h/ V) tȲ.hr`ءU6$j:W3C-в.tWutmв.S c$ \W.t.t .+9$ 1ɉL$tVh$P tj/U u Uhh5Th$ UV诞 DžuV Dž7h$P Ƌoh_Wt(hWthWpV 1QQ$ 4PU7L$9C9$ $ 9tU! lj?,$u1QhD$PQVh.hzd@PY tq$ PhedAW? W荇 |$ W D8$9",0z!uW; .,$h h 5.P Ġ ^_[]hj $Phj" Vhj h{h*zʍD$ Ph D$ Phj D$ Ph롍D$ Ph땍L$ Q4y!h USWV։ϋl$j Va UV CCCOK G^_[]!hz!PhUhĻ+jrUSWVP׉΋tAS蝰W蒰4$4(VS WhpVt$ Pw W É^_[]USWV|$1_h_St$hSthSu\Ȳ.toU3t[u=.t .=.t%ز.toU3dt [u^_[]USWV$D$|$в.rtW3t CÅush<-u(GD$tj=V*t>FD$ GDth/ D$P" u|$1F1B,$֋$$$,$D.tPrt P$h)( xF1Ë$4h C9uj s t2ƅ|$t t$q'4$f'tA710h9r |$t t$<'4$1'^_[]ÍD$jPVt[ x!L$ȃtuuh 묁tlP">PUh7' 끉 .utD$P$2 uW$P$u2tPv vvhhĻ+ 6蠌 $SWV։ϋY Wss ss҃ l.t~j a Wss ssԅuA l.^_[ÐWV1t$|$ ɉ @4u{ȉXȉX\ȉ\ȉm{M{-{ PQ40z40<8z<8D@zD@LHzLHTPyzTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40y40<8y<8D@yD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7%yVw wyV FwwxVFwwxVF^_USWV\$l$EffEffCEffCEffCu uxS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuwSCuuwSCu$u wS$C EDȉCDu,u(wS,C(E@ȉC@u4u0mwS4C0EHȉCHudhVŋFN.tbSQP .x `.~,=8.tffOfGG@ Չn,~$N()ǃ~$N(=`.9<$D$hP-`.>N,ș)N,)n$F(tehV$FN.tbSQP .HT$<L=8.tAf=8.t4f.<$ ^_[]ȸ.`.F,)F$N($fOt@ ȸ.븋D$L$t$ QPQPUSWV$$$ $$$(hqYSV\1j ; D$SVWUhP@؃r_\.95X.rPSV Pt7=8.tf%Y=@t(nWQhd WhwT^_[]USWVP|$\$s s@=8.tf9uR0.t=.t=.tj:D$1PPPs sQs s6Ot.3C p.3K u r+&=8.tf%Y=@t(nQh胣s s/)SUh .u =.t:yj h.th.=- =.uhu=.8.t7t;f5ȸ.D$0.jhS-^_[]Åtff^^_[]USWVP$h$d|$1SV(=8.tf=8.tGfY@t(nPh/SVz.=.t)1=.L L hE, h{$p$l tRQf@ t.p. 1VW r+L$@D$DD$ t$|$ .pt958.tʋ .58.T$Htt tɉL$LL$QPh=.uh515r+PPPjt.p.  5r+RPjjt:ܹ.=.h:* D$L$ t.p.5t.=p. tYjj=.H8.tt,fI=8.tftfI=8.tfIfHVW51t.p.9.t-j   t.p. djjQP t.p. AQP=8.tf%=@5t.5p.8,$t$R=\.X. t# Fjj WSZp9ݹÉrFND$P9|$P$d닔$hjj RSp )ˀ0^N9wh.訞hLJtf5t.p.15r+WWWjt.p. CRP5r+jj_hhW1ȸ.1P^_[]Ë$d#p. t.$tҍt$PtV$lSUQP4$SU fH1G@u5t.5p.hBSUu.$l#$pthB5t.5p.SUq5t.5p.H=.8.fA=8.fhȸ.hxh2 ' jj5t.5p.D$DD$3L t$\$ VS@@PD$PQVSf@5t.5p.tfA=8.tfA$l$p!fHG5t.5p.mf@5t.5p.SU5SUh t$p$ph =.j USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ.@4 1WjPQWWRS 9=8.fr+ `.ffr+=8.twfr+ `.ffs+=8.tjfr+r+f s+= .tr+ȃ=8.t]D$ Yfr+ `.fr+fr+ `.fs+fr+r+f s+= .tr+7D$ G UV=.l$$tApQt=8.tRP`A(=8.t1ҋ .I4-.teQRP .xtt$V/11jWpq =`.=8.tf=`.fr+.;x4})}jhr+Wq =`.E .A49rE =8.t<$fGj \$l$u6_=8.tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=8.tfUVfXW|$$Wf@t$$W=.H8.tt,fA=8.tftfA=8.tfAfH ^_[]UUSWV$$1Q \.X.9;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=.pt$ =8.t ɋ=.8.L$xtt tɋ=.58.1L$|1ɅDT t$t RP<]5`.UVRP虷  tE{[|$t}SW]ljUVSW\ )SW\lj_{[ |$t]SW\ljUVSW )SW\lj?UVSW )Ӌ$xX#UVSWȶ )Ӌ$xX D$4PS $$W$VWVhPWV .1ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =8.t SW[ .L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ =.<$\$T$|$(t$,DpLtL|Dx=8.RSZTtDp.D$0X0vvZRPZVFvv}Z RSlZVFt|tx|$8RZD$T$Rl$$D(D,=8.tFB\pTt.B0FN FNDxD$L|׉L$L$؉D(MU =8.t]RQY .I0VPYU EMhɡ.@0 ȃ=8.t3ȃ=8.EhD,t($.@0MU EhEhD,=.L$ tL$D$D$=.,$\$ 1QOP\$  t19}#8@#pLp0l$$ .ɋD$taVt$P9 .x4ƍ$5`.pS衝 .@0fPt$t$ .x5`.Spa `.=8.tf؋`.fr+.B09}+^jhr+Si `..B0N9rF =.tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL .taPt$t$$ .x=.t$,|$(DxL|DpLt1҉TxT|FN=.<$098.QP1W)RPWVF^vvW )RPVL$(D,D(D,EM =8.\$QPV .I0)RPVU EEhhȋ5.N0 )ȃ=8.t^ȋ5.T)FN^FV )S\$L$4$*5.V0)EM Ehh )ЋL$Ev8QS ȸ.1Ą^_[]Éjhr+png $Phk=.thTs h'ۻF & .@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fw ^nFD$hF$D$pFD$lF.pt =8.tɡ.=8.L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=8.tf)9F=8.\$tAf)=8.t4f=8.t'fL$=8.fVT$Rt)f~T$JR>>fD>= .tq1@1$CD$ƈCCEUL$ q/G9<$u1A=.=(.\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=.t Vt$t$Ut$h 1Ƀȃ^_[]1A=.t1=(.<$\$ HfUSWV $8$4}tE1ɉM4M019 .‹DT 9 8.tRP]PM$U(E$f M$E$U( u ^_[]%=uLI.(9‰|ǃ=Ը.t<|u=.tFNFh1 t.tD$hVP誔 |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =8.t RP_O .I0VQRPZ։D$D$ ЉT$t .=.Q8k=.L$$tL$D$ =8.t QPN .#8t@DQL!!IT u‹$8U t#DT tE=8.t!RPzND t(=8.t1҉EU}@U=}@|$ȸ.EM QPQPh$3WWh`聇h#uQ{u u .y0ƃ=.8.t:tMPWM?UUlCD$T$NQt PWoM~V ~V hX ,..@ 뛋5.F8E -.T$$tT$D$ =8.t RPLv0 I)؉$ʉT$t*DT tZ=8.t RPL$8D t6=8.tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wȸ.E$8I QPQPh$3UUh`薅h8$<t7.Ht)$|$-.Cq qƃ=.t0FV=8.|$$tJRPK)RPwK4FV =8.|$$t&RPUK)RPGK)FV )FV hX ,..@ USWV|$ \$t\.9X.a|. x. ‹-.t9ˉrux9ˉ\$؉jL$QWPJUց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס.t`v0WUH ..pxjV|$(WS0 )Љ x.|.=.jVPS  .A^_[]WSh0.@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$.p0vv[ $G .y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPBS19rÃ=<.$t$ \$ti=.t,ۉ~A1_t41HT\$F9uۉ~1O ɋW @9uG W5(.茲t$ D$x, .;Xt|$#=.t JًL B tmt$v vh7hW WVt=.t$$B1ɉL ȸ.t$ $$Bt$ B C.;Xt`R5(.贱T$\$1ۃ=.t%JًT tN=8.t#RPFBt/=8.t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbȸ.L$AI QPQPh$7WYWh`hxT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=.t+FV=8.tGRPE+D$RPE1FV =8.t*RPE+D$RPE+D$ډFV +D$ډFV hX ,..@ 1@$5USWV\$41F~3|$0l$,|!L. H.9|)S9у} ȃ^_[]Éދ.K89}=.tOI.A!1‰9)=.l$,|$0t!t$4PWUhN .PVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=.!$l$|$ T|$0tN# $ND$T$RPWUh2  .<$\Ttq!qIVPt$ Sh $@l$19=.tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUhq .t$Sh T 1Al$,|$0USWVD$,\$( ..փσ5.=.11 J .9.6 ...9.@D$ .=.\$jD$ PL$QT$RLց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =..t.8.T$t.‹D$ȉ...WUS5.5$.谬=4.l$$-.+l$(=.|$`5.1VV=8.tf%=tjvdv`h@VdF`vlvhT@VlFht4:@TCut4@TCuG9a=Ը.t< .(1.SS=8.tf%=u1=.u(x$CS =8.t RP?9Ƹs& ɉ @u ɉ @uG9wt$t$t$5.5(.衬.1Ƀ=. .^_[]PShPawUSWVl$|$.jVUW;  1ƒ ..|.x.=.-.=.-..9.8#{H1ۃ=.(=.-.1..ډ.t@. -.=.Wh.t^_[]UWhsTvhJv.t P .USWV l$ =.1ɅDT =8.t RP= .Y0މD$ʃQSRV wÉD$4t,P 1ơԹ.$.QPt$0t$0x $ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ .; .u3P5ع.=ع.t-ع..d .ع.Q.4 ^_[]h\tSWV|$t$Թ..QPWV4 tH 1P1 t^_[WVh tVԹ.tR .~%ع.46;5ع.sԹ.P5ع.1ع.Թ.^SWV\$t$s sǃuG=8.tfL$%Y=@t(nRQht s s=.tfhw| p.t.{@t1H1PPQQsHsDs sq SW=.t6hh.We -h荠u7=.{놹 .s s.H ȸ.^_[WV|$t$ WVh C\.95X.0WVhy =.t7=.pt=8.tPt 0hqY'=.pt=8.tPh  =8.tfPh  =.tqPhm 1Ƀ=.DT =8.t RP8RPh =.tF(F=8.tjP|tPh b ^_SWVD$H8=8.t3P PP0p4u'11C9}QBRQp=.RMT$=8.HRP_(9L$0ơ.@0 T$D$=.D$0T$T$4=8.t$$t RP'Mt$t$$=8.tȋMD(.@0T$,‹t$(΃=.8.t+tMVR'uVFt$t$ '7KVRi'MQ AD$:MQqD$T$AQ!EL$DT=8.t1ҋ .q0RP| ƋL$ jWSQ胂Ӄ=.D$ t7~SPt$t$$_NjT=8.t RP&|$)~SPt$t$$(=8.tȋ|$1҉\$$ t/f .q0RPُ xËD$L$ L$0|á.@0 T$ʋL$ȃ=.L$0T$D$t!D$4=8.t)PQ%D$ T$8=8.t@ɉL$ D$ WuhW_qи.N̸.?ĸ.bB j 5U6fظ.Phĸ.=U6hWhWcj W..Ph$ .ĸ.~mSfj5U6r+=mPh  A../.$(.U6D$ ....и.ܸ..D$ L$uD$t/=.t=.D$th, D$1+)hD$=.t .jjkth&m jW=.th=m j?h j0 |$D$ D$4CD$≠.u PZP;Džu6hK%Z|$ tND$Pjt$6}xND$t$eZL$9|ȉD$t$ (L$9|ȉD$6h[0 WtK;D$=.D$te^_[] Phj: lPhv hĻ+ j¥ USWVP׉΋\$t$US0 M9t 9u^_[]WVhuj3: USWV Ӊ5.QW=.t=.t hX1SW[u=.hX0.=.u<.Ph{XCWt heXhXXV=ȹ.t>=.t h X=.t h XhA X/=.u he WX=.u h W3=.u h W6=.u h W<=.t=.u h WT .|$Y8֋T$  SP5l.5h.5t.5p.h Wd,$kdы.@DWSQPxD$T$iщډWSURxjj RP RPt$t$t$t$t$VD$Ph% 蒫 $=. .+X. \.p. t.p. t. tQPh[ 5 =.-.KC)s, h.-l.Ջs4HS8\$ ډD$$+H.$T$L. $ $ډ Љ h.l.tRQho } =ȹ.t8h g 5ȹ.tvvh J 6j \ =й.t8h & 5й.tvvh  6j  15й.5ȹ.5̹.95 .tmj+  .405<.h QVy, 5Ĺ.Vƍ=8.t<.PPҞ5<.z@.=,.t ȸ.j .y,t+.1TtRɸ. .F;q,r.P訸.=0.t =,.th S.1= .=.u h S=,.t h= SGRtgD$PhwMB u1D$t)L$ jQPhwMhBqqH t-=.u h] S  ^_[]1USWV.D$45.~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B P.l$9؉|5.|$0G;~,$LHN4H~KT$މ)1@ P.9׋T$9|5.1҉t$L1F, l.h.t.p.9S,SދD$4HxL$HD$81ۋjV .ׁ\Tډ\$tQ!QЃQ SPhh.A.5.|$D$Xt1NPSWUWiʼnFظ|߃\$ <$w4F.<$t LX FuWBsT$ p.t.$@=8.tfL$fAf|$l$$j hX й.й.T$ =.t| $=8.t RP RPh l=.gq$ʋT=8.t RP WURPVh 9 ($DX=8.tPh  ȸ.h Eh brT$ '|$@@u' T$t$SUt$A x.t$D$, F=.=.$@=8.tffu$@=8.tfft}SU{$@=8.t?f=8.t/ȃ=8. $ApfAAt$f=8.t $ApfAA $AtfA1ɉ . . . .l$T\$X.pt4$9 8.t ʡ. 8.$tt4$tʡ. 8.1ɉ$dtX$t $D$LPt$衹=.=.t=.u,$$@\=8.tȅSUh C h*(p~SUؾ19 8.t1ɉH\H`HdHhHl$f!B=.,$(E\=8.tȅƄ$E\=8.tȋ .I0H111҉,$L$ D$t ߋ .Y8Om\=8.t͋ .#8߉@DYL!!ÊIT u,$\$lD`Td t<=8.t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9.H4 D$|$׉D$|$=.t݋AQ=8.t-RP!Eh=8.tȋt$|$1҉11 ˉl$$WVRPSUhRuA=.th} h@m|$t;SU蕼ƃ=.D$|t1$=8.t RPsFVȸ.=8.tȉFhܽ$|$jj$$$$SU z $A`Id=8.tEQP $plph1$D=8.tWUPVhs   $AhQl D\$C5.;^,T$$L$ ..׃ƃ=.5. .9˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-.t$| ؋T$(tu3D$1 Kl$@؃,Ut$HsƋD$9\$(s+l$ Uh? >j SWUt$@hc h8 m=jWsUSWV |$ ow@u Xw VUp D$t|VUhw w . .ʃǃ.= .|$ |:w wh = =.h mjG $D$|$tjVU¾ P.<)1CVUhD$,p p*. .ʃǃ.=. j Ghp ̹.tH̹. ȹ.9tDy1Y1 t 9u,h.l.$|$ ,̹.ȹ.Q1I1 ы|$ t̹.$G0W4L$Aڃ]D$ p ph J< =.t)hR 1C+ȸ.h ;h h1Ct ؃ ^_[]ȸ.jpjJ fUSWVP$T$1B@B)0 ȹ...x,11=|.t>Q:.x,$kd1PWSQhhĻ+ |..1ۃVU聶tzljl$ t$.pt=8.tʡ. 8.1ɉT$HtttȉD$LVUz8tD$PWbu(C.;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$.ŅtTM1ًU1 u3VShw w.HPUMpX. ̹.9tmu1 ̹.ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH ${!h)F9hLehejj聴=.8.f@=8.fh8hNaeU1hPVPVҜ1Bh8hL#et21VWhVWVW莜1 tah+7ȸ.h du<tf@=8.tf @f= .tjjxfh\: j5.5ع.#T$1B@Bo: -ع..  $|.$Wt>E6+5ع.=.kdPWVQh^hĻ+ݎ |.uF$hvv 躑 `.A1ڍF$hcvv 6ǃ=.F$ 8.&jP1 `.I F NQPQPhSt=.F$ `.t%QjPSh$h>6#ȸ.QjPSh$h36=.th.; =.1F$`. I1)щN$uhb-vv *ǃ=.F$ 8.$Wt jP1҉GW1҉GW }hjD$\P&c =.8.D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=.$tD$\=8.tL$Lu$D$PD$PD$XPy|.;,$/ȸ.$W=@.v@.5ع.;4$]|$T{$AhjWa -.=8.tt0fD$T@js$&tPfD$T@js$tFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=.$|$TtD$\=8.tD$L$|$TtD$\D$PD$PW٧;4$=ع.;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_hss QPTh$^t~s sqf@fNCKK CQPhBss oOCK =.thss QPCKhBQPss fN ȸ.;<$=ع..4~^1ۋ/uu p]]8u9rۋ=ع./CK tS  StQP HKX9rjj轄`^_[]ȸ.j"ej| PhB/L$D$@, +A,USWV $0 n8$=.ui=.t`E=8.tȅtNE=8.t$;X.\.s&E=8.tjPo@E$F0N4 utEhPR)$0 F=8.tȍL$A= .AAhhQ . 8.tD$D$L$L$D$hv v薉 E=8.tfM9v%}EPh9.`h+0[4/E=8.f)=8.f=8.fEtf=8.t΋$0 AI 1 hQP辈 hZ$0 F=8.tȉE$+PlZEL$fAWQU $)fEPUV =8.tfD$fXWPUd $0 G0W4w wmfH$Xȸ.$0 = .t>}t8hv v贇 hYu EBȸ.F0N411G9 v vGD$@=8.tȍL$A= .AAhhBQ 8. . tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=8.t2f)=8.t%ffD$=8.ff8. )fD$1fM$0 A0Q4MT$ tjQkfHD$=8.tfPjU6Y D$fEutEhBPNl$L$Aq $0 JR ωtljhRQUW݅l$EMك9v%}EPh*hmWD$$0 T$ 3F0V4=.h讴 ڃD$=8.t΋D$p@ = .X}$0 ~hqv vڄ EhVJȸ.B$0 1GPVtXD$T$ F0V4=.h ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV? D$fXSPU, E$t'$0 G0W4jPAifH1G9$0 .1L$AA EL$fARQU $EtMw\}.uVV4~0|Juh } .u8hv v% EhU4$F0V4=8.tȋ \.9X.s5hjuv v݂hT4$= .E=8.tȃu}uE=8.tȃtb}u\FN U=8.tʋ4$hjRQPX=8.t}EhT1 8.EtjP|gC$0 A4y0($0 t=.0=.JR u=8.tPjVRQ菁h_SƋE=8.tjP1Ƀ=8.t f8.1ہ@€@t f 8.fGȸ.4$Crv $0 A4y0AI U=8.tʋ4$hjRQP褀htRȸ.zE=8.tjP)Ë@ C$0 A4y0AI $QPQPhRcE=8.l$\$tȋM=8.t1퍜$UQUPhScShP$"PhF %9-.th l$\$ hvQƃl$\$$0 A4y0| AI KC= .taEO9tU$0 AI U=8.thxjRQP%GEhPu $ ȸ.fO4$E  ^_[]ËM PSh"ȃ=8.tUSWVT .ع.,=|.t>)"=.kdPWVQhhĻ++{ |.}ww cO W $T$ WGO ƀÄ:1=.t4=0.t+=.t"uGO 1F9ƺw1 tbQPc8uS=x.xJ1v6KNj@ $GD$wOG tQPb8u E;-x.|E;-x.=4$hb"hORv6话11|$D$HNL$D$D$D$$D$D$ d D$TD$D.pt =8.t ɡ.-8.L$Ltt tȉ݉D$PD$PRmu h!D$TPv6t$t$~tyD$ ? v6ΜL$QPt4t$t$af@jw wt$t$~t t.p.1JQPBafpع.9)T^_[]fUSWVT1ۍT$1B3L .x,@=|.t;.p,kd1PVSQh.hĻ+ x |.. .<\$11ۃVU衛VUi`$t$l$ .pt<=8.tϋ .8.1҉|$Ltt<8tϋ .8.1҉|$PdtX 8Džtɋ$L$HQ${!xtCVUztV=.VUhV^1=.L L tOjhsй.tuQ1y1 t6 u_VUUdtl=.tHVUht 7jh$PxyQ й.P蔃jhD$P C.L$;JWD$ P@..tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5<.@..hh ud.ǀh P5<. 5Ĺ.5<.,=8.t<.PP >5<.@..@ <:P^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhwMmUQ=.uR<sJ.1\$|11 ʍT$ ٰBPVQ6 D>/|)Ot$L$6.2.$!D$h8J.$ D$tB?JL$h)PRQȗSWVD$t$ \.95X.r==. .jSPV̐)޹s+94v t^_[PVh"GWV|$ wu$P|!1XD$@uPw w Ph.=.th"6I h!t ^_Ph!躽|.USWV$\TM@$ 5uh`h`VPa =.t h"{H =4.1ۃL뀃=8.t\,L$UPQz DPP~$\, 8.L$L$UPQH |$u $PPD1LDffLD@9u=8.t8PP\8.L$UQP t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h&",USWV\$t$=.!ߋ,t9Xt6@u|$t&jVt1ɉH HHXh1^_[]hM"ĺVD$ L$5.#p9tыR9u @^USWVt$|$VW/.!t7^Fu+11 33 1u{ .tqt$0|$,\$(l$$T$.t9PtjRQ .(Xxp L$ .t9HtjQ5. .(Xxp ^_[]WV .1!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$~!$1Aȋ$sY9U|!<|!Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$`|!4  <Qh8#h#船D$P`wZL$ D$$p|!1B(ɀ!1RhD#h#SD$H`wPD$T$ $|!1C%   [QhT#h#襸SD$H`wND$T$ $|!1C%  [Qha#h#:USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWe ƅuWhJj迖 $$<$4D$Phd@U tg1OVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uht$H41 ShU CPhU* C PhU CPhU CPhU $@D$t P1-Uhzd@$<W  t1 VhedAW hjU D$ P$4teD$, 9L$<L$9u0$S11:/8tx$0ha艊 b$11҉ $ƅ*ŰPj PU赞 ^_[]$0hyjr USWV01ۍD$,ShPSu1NtAljSPSWuWruMU D$t$$$Q1e^_[]fUSWV]D$D$ PS_d$1NHD$ D$(%=@= j/S xr)ك$0PSQhn#hR D$jP| ǻ\$$0PS.: Ou\$ |E tÉ\$D$D$ D$|$$D$ PSb1@$D$hh Sp ƅ%D$ PV\D$3D$ 3|$$  D$uH$0PS! $8$P$TRPV VpD$4@D$1$Vh#jSZ VjSo ƅxc1GD$ PhFV"  8u;VgpWh#jS jjSio Gy D$t P<$t t$b&1Ox Vpe^_[]D$(%= tn=@u$0Shv#hPn S%&Ɖ\$1@$D$:\$ D$ PS`B$D$jSn}tS tN$PhF|@V x4D$t PU$$JhF V$USWVP1hUU= ƉRP*9-8.t1@fC}+PUUS'G .;A0u $ytWVD^_[]Ë\$-.58.SUqRPX$@ `.ؔؐh P5<. 5Ĺ.5<.7=8.t<.PPC5<.J@.[USWVt$(~Ohol8.tUQsՉ 1=.L$$t| tWVsƉt$$H$á.@058.QPWVsUC cMhml=8.tUQXsՋt$( }.@0ˉ9Éʉ\$4$rQPUt$ LPDTGlOh|$ wL$,=8.tȋ|$.1ɉSh$(=.th:03 ht$" .QP%$T$1RQQD$PaAá.;X0t$~~1Ƀ=.T$DT =8.|$t RPnL$ pL$QSRPvyǍPn.$|$1D$D$t1)ÉعF@jPD`r9w<$r$l$T1C @<$9uG<$;|$}.X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡ.@0)ȃ`T$1ۡ.ـ#h$蒦=.th 0 h ع`֋,$L$t1ɉȉD$ օt$ tH .i0T$,RQUt$> .;A0l$,} $L$l$l$,.@0D$Mt$ |1TT1PD$T$ ʃ=8.t RPkL$(ωQM D$H 9tet$C9\$t$$h$D ȸ.4$F4$;t$SD$`1ȸ.0^_[]ËL$ ʋ .f9u Sh$ԤD$`,t$$h$蜤j .Ph>$sUSWVT$L$D$0(D$ X=8.tSUjʼnӉ OD$$.@09ʼn} t$t$5D$PSUt$< .;A0 t$~QPSU ~t$4SUWt$T$LtL$A L$ Q58.t9RPt$ƉT$ it$1ӋT$1 t<$G RQiD11 u5\$$9t ;D$t`GPD$ GPWTt RPi$<$G L$;L$t9ta щʼn$;D$t`1h%^_[]USWV .$.x0UWt$0t$0sƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PRs .T$4$1B srl$,$ ȈU1wX=8.t .!9GX=8.tȋL$,1Ph%ʡ .L$ $  h%詡=.th + ht$D$OPWTP1GTGP^_[]ȸ.1USWV|$,t.1@$.sll$.t. L$ =ƍD$1PQQV{9 .;A0-T$zu D$`1]l$z$Ń1EGpD$h2 D$ Pt$ u&xMt(T$h2 D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh%=.th#& * hK%qt3s ss3st$Vn[E;,$uȸ.1tPh$`j USWV0\$T|$HOX=8.t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG8.҉L$D$td$PQLeÉ׋n11 D$Hpډø4$uRWPS Dž1F $ LBAWNjG ;C wjTjM HMH MHX,O(HW,щT$PW@ODL$HT$,POLL$4H$OHL$H O $H(_q1Ƌy 1 t $B8HB8tQPQQjC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"h(< Ph(, O4$VIVh'h0(h h&载h'h'h h'hy'hWVt$ F,t@.th( F,P<1~,>d9~8uv0^_h'h'h h&2D$x,u@Pt Ph'h&h h&WV΋I01t*N8~2IN8tPQP PN0G;~4vɃ~8u^_h'h'h, h&蘼h'h'h2 USWVEH1BT$x,1h1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vSe^_[]h'h('hF h&軻USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hU(h(hK h&諺USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h'h;'h` hQ'h;'ha h&USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h'hg'hq hQ'hg'hs h&8USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hU(hB(h~ h&菸fUSWV\$$|$ l$t$.t5(.SWUh( USWV5(.71^_[]USWV\$$|$ l$t$.t5$.SWUh)@ USWV5$.C1^_[]V=.th@)2j5.Gtahu)赌h WtS.xL~61 . s"@Pt4h) ..F;pL|^5.vj .t'x,tP.P.á.t x,tt$t$t$t$P1WVt$|$ VWJ=.dtX=8.ts,.`uau33 u1@1^_WV .t1 . .1!`u/aʀs2hlpx1Ph)Ph)h 蓷Jh). ǀdƀah P5<.b 5Ĺ.5<.=8.t<.PP5<.@..!1111QWRPjh.hh*h 赶lh) . ǀdh P5<.a 5Ĺ.5<.=8.t<.PP 5<.'@. .dPs+aʀu Ph)PhN*)h ˵h6*!.ǀdƀah P5<.` 5Ĺ.5<.-=8.t<.PP95<.@@.^_j USWV1L$ AL$HAL$@AL$<L$ t!L$A p!Al!Ah!}u ]h*WV0y k~lt$tu4D$PS,buD$HPS]# D$ PS%t9PD$DPD$DPD$,PS(uh$s+jƉe^_[]95+ujhh!D$P u1PPD$Pjd95+t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQWRPt$8t$@t$8t$@W1u2h&+R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQt ]S_rt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$PhrhVf^D$@w ww7VPh+S 1h++hd+WfUSWV1L$(AL$$t$@L$ D$ }] h+WSu aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9+u~]#D1غ$Phzd@ tN|$$tOh 1Ʌ\ S $FVP1$^Tjhh!S~ l$k,S(C K$)̓$$|BShhD$PNUt$s$s D$ Ph.$C K$jSjUt$QP$d l$EhVPE$9.1C]2UWh8.S$$1Kt$t$h\.Pftt$t$h.UGPSWVPt$|$\$$80PS ^_[PD$tu-Phm D$ L$ $QPgj XUSWV \$$|$ hjGƋD$(D$,(D$0,D$4$D$80D$<4t1jhVPW<QP($#D=$؃u E:j n1uaWh.I QhWV] h/h /V7t P2h/VV1 ^_[]ËM)z G1SQWD$P蘓9|RPh/Vy|$$tRPUQWh/V؋T$RPV # 8D$11WWPW1@PjPV؃$jS $jQUWL$  t$hs/V $Uhd@F tYMɉh0/rRhd@ t4O tGʋM$8hL$h/hG/jV tH h]/VG1Ʌ A I$ 9؉$jQPVZPL$T$ D$$jPXUSWV Ӊ΋l$ jURQtn=Uuq1tu@ yyu݅tj ud1PPhy4Vih,.V%tUShR4V;W\tUSh4V |USh4V1@PWPjPUSVa D$@\$4$1= uD$ Pt$h4t$  $|(1RVRUPQh4t$] $\$SqjPjt$ t$jjW X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP&DE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q $q H @AQ@A$Q @QHALh1S3h1h1USWVP\$|$tus$+ $$jtQ1@PVSjPt$8t$8W E1u>4$h74W VSh3W4$h4W 1H^_[]UWV} uOʃU6|RQPh2VJPRQ x& $T$W1ٹ|$5U6h.2 5U6hVD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhh!V 1OujV5U6>uW?,VQ>~Ih>2Q1$VQ7 t1PhP2Qx 1O^_SWVP|$1N?u;j S5U6 8u1u5U6ht$ ^_[WV|$1N?t5U6C 1t^_h3t$USWV 1O1;B։ˍD$ j P5U6 уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5U6O x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`S~ljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,&jhh!t$ $ tjVt$ $ jQV$Ѓ $V  I iTh j$U$  Vd tZs0whi2VIz1t^_[]1;BB  Fjhh!P 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hy2W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph2Q 1HUSWVt$|$ t)l$\$$jWUS}  tWUSh21h2V*l$(\$$jWUSJ  tWUSh2V1H^_[]Ã|jWUS`/11USWV\$1s3h/ 5U6+t^1W!JtuWh-3t$ 1N!! Ch/ jJ+Džu^_[]WV|$ !!WhI3蘲 u^_USWV t$@\$~D$DF D$HF$ۋ|$@tFj(j譳jŋT$0L$4HD$8ED$ l~Y $!|$j D$(P5U6$ D$D$$8aD$OHttTU6D$,PS& t]D$`D$D$d$PHD$?7D$Pj8̀}1ɉQQSV !уt $D$L}8tQ}1ɉQD$,PS< D$$D$(9u8lh}8^ $1HD$"5+9(T$uH +9 T$H + $s+D$$s+L$ t3PQnt%ԃ!D$tPt$nuD$xt$ t$$hD$8P x t$,#L$9-D$@$u fy{F1& 4$t$t$$Wt$$t$,PQg Ņt#SVUD$P t1tUw1GĨ^_[]#Sh[:j+ t$ h9t$ h9WVgzhGPm:t3:Ļ+h9VQWǡ Wjj hP:N!h ujn fUSWV$\$@|$;UPWUT$@ toN8jHQt$VP"$H(K$t$11+D$t$9L$w‹t$V n$SV(n,l$ $G9%4$諩^_[]V1ND$~t!t#u%0t,u Ph];t$ ^WVL$ vAw$X!11H$0!tuh|$t$ #r?Qh:j@h. .*81 *#!PWh|;V1 ^_ÐUSWVPt$h 2t$$V4 u295+u*t$VljjVwth;hs+j ^_[]jVJjV9 jV(jVt;ƅ tDE h$1݋@ 1 t:sPh3<V; G t0ƅ uh<t,uLjj2h;V1Mt +Ai UPtσ tu'SWtjjtjV1u1UjUUV@ t|jUUVtu1hUPD$ o $fǀUUSWP41@Pt$jUPUUV PVt'hf<Vhi-h~-h-VUSWV΃tuw++jp Rp pt$,t$,V Et1PV&t*SWh<VN1(Rh<VWh<Wh<V 1H^_[]USWV Ӊt$$t$$RQT1Ot, D$$+! D$+$8$s p ՉT$K Eh @EMKM$E OEHMLEu UED$0Vt+t$t$h =V1%Sh<V 4$h=V 1O ^_[]ÐUSWV4\$Pl$LT$H1 F0 hz=SU[0 tPVW4 u9-+ujh+VWLhs+j'4^_[]ËD$ t!H p!H l!H h!fUSWVX1L$ AL$A\$HCL$ u} D$h=VW/ bt(t?qt0PSD$PD$,Pu\ulD$PuD$9=+uHD$|$|Yu/tJL$T$xupt 81ϋX1 t$@uht+jƉe^_[]Ét$ t$Lt$Lt$t$0t$0}W!1NtƉT$4D$\$ D$ D$D$$$WbtCD$@PWOjhh!D$LP輓 tXj$t$t$ 8_D$0T$,W;L$T$4t9_t0uh=uZSh3WF \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQ肖 L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh=P%1D$Bh= D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh>u1fUSWVPM(,|$8O] D$1hI>uSO, sujsWVVuutqD$9+1t$u_ht+jwOt$S4T$,D$$\$(ju t Hth>u_1Ne^_[]ÉD$H@ D$ juVjVH A D$ $Y$jV jVs tuh>uD$3D$3L$ u41D$Bh>u-hY0h>V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhh!V2 tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$thp?SG 0+T$x|$yRt$h?udhC?D$t$th?S11A $1A;L$0D$4D$,L$ |L$Vt$VjS @L$)΋T$׋jp jRQWVS 6 $p q fB  yq @N F$FV0~4j\V軻FSȾ H @AQ@Q A$Pƃ׃q0y4QLAHS?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu1h?h?Sh?SfUSWV0u1L$ L$AL$AD$] }D$hB@VS& a~bt1iugD$ PW*u5D$PW$D$PWut3NT$T${lh _1D$|$|HWt;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 9+uD$L$ t!T$ T$th t hAm he-`  1A AAt$QhrhVVhAhAhA ĔhB~ |$uhusuqVhBohy-~ uuulhBBtrPRhA~ Ĝ;8jmWj$VzVhrhWWhAH~ Đ^_[]USWV΋\$$|$ ʉl$͍L$jj hrUPjQ\yD$SWVhlB} |$tUh2} j | ^_[]USWVDt$`l$\\$XT$1 t!G p!Gl!Gh!B0 ChCVUF Tt$t7ltytdPD$PS uNtWSu1HVt2jhh!WA~ t9-+uWhBD$PS htt+jͽh 1D^_[]ËD$L$Q P QPIHÐUSWV(]1L$L$AL$A} uhXCSWI a~bt)iuRt7D$PV"uUt$D$PVtD$PV`uht+je^_[]Ãluh <1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=+d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H p.H l.@h. d.hd.19p.Fl.Fh.Fd.F^Vt$|$uD$ ht.0.FD|.F@x.F $fƋFHt$ $x!И^ hShE PD$E|þ1${臘Wh9CPa= PhVA CPh,GV@ CPh7GV@ xCPhDGV@ ]CPh V@ BCPhSGV@ 'CPh\GVe@  CPhgGVJ@ CPhtGV/@ C PhGV@ C PhGV? CPhGV? <$uh$oVt$SGZGU $ɿt$ D$tQhGP6 D$Phe-t$6 ut~ 蕖whGP5? jG8Phrh$SShGVB 5GP[Ph +V^= VhGcD$D$$$Fm~ 1B$ϕKƋ $Qh9CV: "Whrh$SSh V7A Whrh$SShGVA wwhRx V6@wwhF V@w$w h V?g(jmD$Pj$Wo|$tD$PhVw@ 0Vt$R$B$$L$ AA H9t$hHt$~4 t$hGt$a4 t$ v5t$Yt$xh U<hUOq PV l+tlSE aht+j& VHxhG$91OSt$#x1Ot$x6hl+V V{}1*Uh,$ Ť VY}t$w^_[]ÅtVwhFhHh hGhGhhGhGhhF&CfUSWV]} D$D$ h HSW  iu5U6tFumD$ D$9=+uUj]$,(9ǃD$T$ЃD$,jSit%D$t6h$Hht+jzjS5 D$ tjStD$t h;w@h V{::HtQG"hFP?)j$P hGVhGD$ PjhPn D$0Ph +t$3 D$0$L$ 11t$ L$ D$PhGt$(< bD$\Pt$ tpt$hHS> 1O1PzV"u0hEHhfHS VthHSt$t֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$PhGS. $PhGS. t$(wÅt$(w$fǀU1PPPE)!ƒ[u$t$ ;$4t$8誹D$t$wfËt$01 |$lD$Ph S5 D$lPt${D$PhGS`5 D$|Pt$G$PhRx S- `$PhF S- B$Ph S}- $D$PhS4 tj$$Pt$ D$DPh9CS+ D$D9M$ $ȃhL$pQP t$uÅt$uU$61QQP'!ƒ~t$ M$$VP 9U]$|$$D$jRP'!ƒ=M$$VP 9E$1SP|$W2; GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uohSMD$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hoM MHtU4uL9rRQP t$|$t%u@uhV tI,81tSul|$tDEM9rQWPF u@u`V u@yu@u`Vq teEptUt$8ЃtEu8uXVG t, ^_[]h MhKAh MhCJ5h Mh$M)u\u\hMudSh3MjbwlhjfUSWVt$v1tvt$xt[SPatCP!Vt$BztPUWc{ uWYSMa1S@aWWv^_[]USWVu]Ph+MS  t$f1j?1Nt}ǍD$ PhGSA td\$ t\hjD$P& jS\$S= ShiW t$E L$Uf jQh+MP~je^_[]PPhGt$ u1$YVPt$ t$t$V tPhGV u1$^USWVt$t$wt Nj\$ Pi9v)? )1N*Ƌl$WiVPUn )SjU% ^_[]USWVt$t$3wt?Nj\$ P9s9Ƌl$W VPU )SjUR% ) (?1N^_[]UPhc u t$(1H]USWV@uPhMV ] hMV^vtPQ|$ P\$$ShiV\@ |$ jS藏PhMu Dx VUۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP>t!PhMSw VU1He^_[]hdhMhhM!WV|$$hMW^ut;Pu1VAjPVC VhiWQ? t^_hMhMjVhM hNjV.hu+V V .h7uV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhLNhV=>tVhNJ V FߋD$t$j7QPhLNhV=>tVhNI VT F߁^UVuPhUV& t3$L$ AQhiV= u hU' 1e^]hdhUhhPUVuPhUV t3$L$ AQhiVe= u hU 1e^]hdhUhhPUWV}W#ƉPhW; tZt4$P<tW@PV(tGPhiUu t t>VW1e^_]hdhUhhPhRUhUhU hUhVj=hUt$/rtPhiUt$Yt Hh_ hdUhhPWVPt$|$D$PVW t2D$t u WhQjP)6 D$L$AËD$L$AËD$L$AËD$L$AËD$ {+{+1ËD$ {+{+1ËD$ ${+${+1ËD$ ,{+,{+1ËD$H@4{+ 4{+1SV\$ Sh8{+q uCЃ r"CrCr 301H^[h8{+a H?r  ؈8{+1ыL$t .1ÍAЃ r)Aw AwÉ1HUSWV1t$ D$hVP 0{+x.t8u^.ǁ....... ..... .@whlz+R&uhTT0hz+9&uhwThz+ &u hTj$5{+tvh$v+%61*.+.,.Dz+tz+$h8{+$U ƃV B~>CN,.F v/FwD$D!1.Au"hOqL $!-.xu>Wu4D$P1VhVVj V5U6 8.9t$:*ƀ.l `C Lvmsz+Dz+uw+/.0.r..3.D$P1VhVVj V5U6 4.9t$taY*.>+.O2.CatTl5w++wtzDz+9tlz+xw+$ÿ`w+؉$Dz++ 0.$u =3.uB=.=+.=*.u|t =3.u =.uftu^3.uS$ttH)ŋ$L$ T$ RQL$QWPU%u^u&h!hO,5U6hB j t$PD$P & u hOD$t,DtVPyDžuh!hOJW WtS)uh!hKWuh!hCJ0{+t H9t@h!h P$@ uhvPh!h*hP VWЃ Wj@/ USWVP]uhVhOjƸ8{+jmP rrtMWjL8{+P tSWUSWhVhĻ+9 ({+t VSm#MWurWWWWWQWhYWhĻ+9 $VLAjr. V 0{+1tT$q9t Iu^WVΉhjWs D$PhUV tZh' V`tQP{L$PyRPQ WhiV* u hU2 Ĕ^_h_ hUhhP WV hRQk`t;P,{ u1WN{j PWP Whui V^* t ^_hThThihP hTjhQj 1ÃD$ 1ɉJJJ JJ BRhiP) t1hQj$1ɉJJRhiP) u 1ĐhQjfQh8{+ USWV΅t R\\rZkZ0($D$Pr !\$D$1t$$tsVsD$tVPVhGW trC=-.D$uCt\=..uCuM=2.uCt>=1.uLhj$V  VhiWn( t!$uۋt$$4u=0.t ~ j 2 hl+s Wt& 0{+ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhRh$V3VUhR 3 jl$U$VC" Vhit$q t$,$t!PhR2 VhRp ,$jt$V! Vh~it$ t$tPhRn2 j 1 ꍄ$P$$ j:QPhRh$P%$t'$Uh^S1 Uy E}uj:$$hRh$PV%$t'$UhpS1 U E}u- {+4$tVWUmuj|$W$V  $$ DŽ$@Vhit$V u$ h}S 1 1@Pl$U%jWl$0U;  1@D$81D$ PhiY( ht$D$;D$t(h( ht$ ej)' j ' \$#|$hZ( 1AP!9xu H uh S( t$(hjV Vhi$ St$<\$8hZ' X!Qt8u 9A uVhZ' VhHY8 1#X4hrh5T' j & jmtz D$ ~[11ۋ!9uIuUPhuYF' hY9' hY4j ?& D$ 1AC9|M rV6ļ^_[]P[ hGJ$h+YhKhMh\Y h+Yh8YjVjmuH.hDVV2^hYj謲hĻ+jjHhZ UVuU OPh&ZV t!#@. $ @.1e^]hdh#ZhhY USWV(ӉQtoh0ZU Pt@.H1 Rh8i(U u 8uIjh0ZS t)D$@.t(^_[]hGJVhjZjdhWZh:Zh\Yj|SWVt$T$;hdZV_Ot\Ƌ@.PJjVjPW t+Ɖ߁PWt2 É@.11H^_[hZh|ZhhY hZWV֋|$ QVWPhZj腰WVPt$T$thYVNtkPiVNiPWD t>ƉPV5@. ǣ<.V31u @.$hZ1H^_hZhZhhY WVPt$T$hXVMtbPhVhPW蜮 tIƉPV5@. ǣD.V31u! @.$h 1H^_USWVt$T$1hZVUMthƋ-@.P@hVhPW t6ƉPWct>Vp2 ݉-@.11H^_[]hZhZh2hYm hSffSWV|$ t 1H>t$|$\$jopPstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VetE$$PwCt/$F ~G F1  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r i 8"t$8tW 1H^_[];sC| C 9s} - "WVn3t/t$ L$Ps(,tD$$F ^C F1 USWVuD$ tV} ]CtP7JtEC tP7rJu/D$ Phc 7 u$D$1$b 1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V@ t|$,$h/ W) D$ tD$1{tj/t$ tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$M D$4D$4D$ PD$8Pt$ t$ w ÅuD$ x 1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr8 1X \$TfD$t7|$0j WP[ t9t1ۉD$=r "11HD$$P-|$1OL$L$D$L$T$PQRh6[V1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PNjD$fVSP sD$ t P 4$W`W+<4$uM S]s {te|$t^t$Vt$t_@PW_W+tNVsE0>H ߉Vu%ۉt3EF ^C F1Vt$h][h>[h][hU h][hVj衧WVt$tV r 1H^_V t3t$L$|$ Pwt΋D$F ~G F1S USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'# <$t@1@> .1-t P#1GG GG 1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7Ct+{0t>-uUs t>Vs t)u  1H^_[]Ís s(CtP7BuCtP7Bt1@뿋C$1$М!4v6*!6z Pf v6P,tMtk $t$ 4$UQ t1t2Wb'6VWGo 1N^_ÐUSWV$,h[U$<h[U<ÅVVSVƊG:FhjP( \$yPWS $yPVW |$u9D$0;$$t{|$ tt1FVSVWPhJiUm 1u1h\輒 "j`h[h[! . 1N^_[]h[ h[h[j讜WVP.h|+VVX.hkV`.hWVW^_USWV, $@ 1 8,.t1ۈ$+$*|$hjW WhKiVb l$(EPƀ}u jUH$GL$$*SjQhRPU u jW $L$ $+SjQhUPW 1f|$0t,L$f|$ 0t,D$ t`L$ T$QUR$6QPh+\% , ^_[]hĻ+jj7hE\d jhIit$  t1h[j WVt$ |+9tEtt]V# tXjt$W耝 D$8t!D$Ph5]V t)D$fD$$Wh9iV 1uhY]/ 1He^_]h]hKjWVl.h|+VVt.h[V|.hWVW^_VL$jNt*D$ $ut]tRPh]# ^hĻ+jj#h]h SWV׉1B BBfBQt&jhL]P u+KDHu|$t$1H^_[Wh:iVT 1he]j耑Vt$D$Ph]Vx tPhiV t 1^hdh1bhNh` h;bjOVPt$ D$PhcV9 t!D$ Pt 1^hdhah4h` hajVPt$ D$Ph"cV t!D$IPxt 1^hdh bhAh`5 hbj艐WV$t$0j!jW D$j Ph]V袶t$WhiV t1$^_hahajhajUWV uPhbV_ t<|$WhiV t=$D$WhiV t)1e^_]hdhbhh`C h[ahzaj萏USWVx$t$xhVh^W&^1@D$D$1L$8DL@uVhkb)jVhsb蕛 u$D$ +DAt\~:uVЍ\$C1|$8+jPWh/ Vƃ uր>$t^h|bD$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh`j4 1Hx^_[]h`bhMbj迍WV0t$<|$jWh]V萴t8Wt7HfJBRhiV t!10^_hahaWhajKh^joSWV.hT}+VS.h(}+W@VgW^.hV3.hjW.hkSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!hb $HQPۍ\$4|$fGWhiU t$bf|$*ub=+.t P fD$(WhiU t$bf|$*ub=+.t PG |$fG WhiU t2D$*=) Ph c =+.t hc fD$(IWhiU> t2D$*=) Phc =+.t h c 1Shi8U |$Dh'co 1tPDL@uShi8U t$HuM1|TuD@uD$L|C+L$P9Dzty:t|$jQhkb螖 uVh/c 11t j, DLxPtT hkb v<u h" j $PhiU tDh3cV $t$h?c8  hFV) j ? PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJREPhYc $=tPhcc j $=tPhOcq ^_[]PhbjVhĻ+jhhlc蟫 ÃD$1ɉJJ JJ fBRhiPm t1h^j&8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h`jӇUSWV,$@$PhiV tr$A jjj"n xgljj2 xi$-hSWd xB$/uE$0uf$Ciu.h.^| 1H hl^| h^| We1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^h6h^h h`h^h_QL$4Qh^ (D$f($-D$](E!L$:!PS E P@$EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q .t .E.tIAtcAtCAtPA tSA@tBAyAAT$h.UWt$PVt$D$VPRRh^ ,l$ }"E!Ê<)\<$8!=+.`Cs|$[VPWl$Ph_hb_ #<*<0<2=+.<$_<t%_sQh D1L;ryG`QRPh&< G/ 9u<]K%C=PhN_hX =+.S<$CPh_6 KPh_ K s k t?L$D$F_PWh5T NM@ ܋L$D$(Mu} L$D$D$F_PtPtPu__ _zQPh5TW NM@ D$ŋL$D$(ȉ</=+.%<C<$l!k`=+.CPh-_=+.CKSRQPh:_hk_ C~@sFNuQPh_u IRQPhu_] Muj>m l$ L=+.?CPhC_% (sh]_h =+.<$CPh_ KPh_ Ck tAt$D$x_\PVh5T OM@ ܋D$t$)E}twt$D$p_ttu__ _zQPh5T" NM@ D$<t$)ƃl$ rPh_ j> <$€I`$X!R`rQ=PuJC<u;hS_h~ =+.yCKQPh_Z ]=+.PȹX_6<"<`[` ``v``````````hS_h =+.<$CPh`s 1D3 rt<`T3 ׃l3 URWPQ!h`1 uj>? l$ <``CPCHÃ)gj EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]hB^h^j}WVD$(1www ww7fWfGfGwWhiQ6 uh^r 1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ† ;l$D$tD...P ^_[]WhQ蓆 1<$tɍGrD$X1.Ph_Sdw E;,$sGwUSWV։ϋ\$Qh Wl )Ǎ 9~)j< t+~'K1.Ph_ 9t OE܄u j- j> ^_[]ø wܢ!øzøSw!øzVPt$ D$PhFaV tD$P^hdhCahh` VPt$ D$PhbV讳 tD$P^hdhOahh`g WVt$(|$WhiV tND$PhpaVF tCD$D$WhiV 1uhzao 1H^_h[ajLzhdhkahh` fUSWV4jh.芅 袋y 臌y h+dyo hLOey hCd[o jhd\ t\@h L$0jQPb1 iD$0tPhjo jhd $L$Hj jh% hWVވ ft&stt%PhUd&~+h.95+t hld1 VPh  VPUSWQRPh$1EVQPUhVSh 1H|$G GGVSPPUPP P P PUPPW!8VWjT |$www wwVWj VWj VVS~VWpV T$0B (L$VVPQWRX| 1I9u 8tމ5.5~+31~+=ht/=9t.=t-=t,=Rt+1=d)fsfrft fmfTht/9t+t't#Rtd(sr tmT=.tyhUD$8P Shij D$`P fDŽ$vU$P f$~f$|D$0Pu hiW 5~+։1@4^_[]hjk j $ 1AjQuhdjujj貋hmjŋu8rjjVa t|jjhhjVh#qh1sIj _ j X USWV`.z~11t$HFFF FF1G>l$ UVjc \$SVWT c ƅ~+1MjSj, tFNj$ 9uF$=h%jjVR 8~+9tt1VD$$Pj VD$ Pj ~+>hiB jjj, 1VUjZ VSjN h`^_[]hi)=~+u$=|$\$ u(.1VSj VWj 9뢉tуt̃ u1Ht$8F FFV_PPh?j1VSj VWB1;iWV tdD$8x xx8WPVP "q{jhHih+ 1sSWqWhij= V PD$L$ $QPj  XSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á.H .t$Vt$V Phhj< V D$ttuR 1~+.VPD$$Ht5t$ I?r $ !P$Ѕuσ^USWVl`(t$T$1BqZBinitL$ UQD$PQjVv tw\$`$CD$l$T$11BsB4B$wMjCroot`PD$PVVjD$Pu ujjPl^_[]USWVl119=&D$`VVPh.hh[ t@t$.u"h.y N9uf=./hhTqhhCF 8uXD$PVh-U t9T$11B$B$D$ j`PUUjVt )u1AM=u>..rx3djjVWS> VWS2  l^_[]USWV(] ƅ@1MjSj' tKNj$19uG $tCȃu9hdh1shE F$P0`fF$v0hf j vh f ^_[]ËF$h.0h/f jɶ 1A AAPQjD izy hfF,P0eF,v0hfg jn USWVP.t `@4=@1F4$.t7ËhEPV^ t$C4uً4$WQ?DžumK4$9tVPUh+g3G t0t*cىNt CshVgKCtjPD1D5.t$FuFFt jPDv4ظ^_[]WV $.tHэt$ V|$WjWVPPt$phg $1B^_SWVȋI up(rtp1ۅÍ|X0SpW^_[USWV։ωhjU SWUo $fF|$$SVWo $, $$$tJH RP jPp $$f$DVn vƃD$ jVPۇ P`uWheƭ^_[]V_B=.u-hvgh.hehV* VqC^Á^==USWV׉΍i A tPv$7whU M1ۅtrF$tAG1Ct\N(t QGPc F(F,u/n(gVgvPubE1ۉ^_[]USWVD$1@ xՉj8|$x11 $ $@$($Shh5TP L$yt'T$t%4$F4D$tp4F0$Q $1 5.F0^_[]VP~+u1AH5.t/~u$tOFFjP+n ;v4͡~+u8jVjg t $~+t~+RR^SWVQk P41t@h!SNt!h!jjNu Vq^_[WV1N=.tED$@ L$1҉RRQWjPf t4$ hg^_WV $=.tH9t=ƍD$@ 1jQRRjP-f u4$Vhg/ ^_SWVP.t H@4rʉdjjVWSVWS 14!j ?u 8t].j njWj t $=.u 8 u趰 8 tFuhhh^_[fUSWV$$D$D$D$,h1H$11D$hjWSo f~/P w`1A$(!5U6D$u[FtR=5U6D$,D$낃gU68#u(@j L$ QPU $D$8LU6P@$)U68#u)@j L$ QPU D$D$8U6L$QPWj D$ P5U6hU D$D$8c1Fj D$ P5U61U $D$85U6hk8+<=.u-.~q5.1ۋtVPc uJVh FtPhl FtPhl j -.C 9|?,u)É\$(k <D$joD$PoGx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0" 1ɉQD$ P4` D4D$8u 8tz`Xt$7.u .-.CPV袞 t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP`jm|$tt$ VUWo UW2<« 8C|$$8D$@PW, tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWG t!t$ VUW4o#|$$tS9u$UW;RW_=$D$utSPW= uWhkXP 1ļ^_[]Ë +DQu S VP1PPVPjh~+^ u=4$.t01QQVPjh~+^ u$.^h<hMjYSWV|$uWD$8H  1҉P!9u$  e!9u 1z!1ҋL$1^_[hjjh~+t$M t@1ËD$0t$ WV|$ u;D$H! 9w9t!P!re!1z!L$1^_SWVD$L$t@P% wruP!rbe![P p! 9w сr.P!rKmr_m1z!T$ 1^_[V|$u7D$ H΁ w9tP!9te!1z!L$1^V|$u;D$ P% wr!P!re!1z!T$ 1^WV|$ uBD$0P  P!we!s 1z!T$ 1^_V|$u;D$ P% wr!P!re!1z!T$ 1^V|$u;D$ P% ?wr!P!re!1z!T$ 1^fUSWV $ D$ $D$!11D$hvm$ Ve c~$!.|1EAtauv1A밃L$_L$X.PL$IL$BU6:ىyL$ $<$T5U6$U6D$ىA4-+).f(t$ CeÃ1t$kh_U t$hUΖ thU輖 u#4$suK mLtBÅu+hmUu t$uKD$Ph$Pj kK1PPWs Vt$st1EBÅ $$ 4hV  Ã<$L$hn$ 4L] \jSd1ƃut蕣 8$hSVy] j/VΓ t@V\ @9vHH9wr$jP0ƃh.hzd@VV iD$PhedAV9 V11tS\ DaFk<$$P$ 4裺D$tV Gu=V $t Pt$D$ u|$ jWt$& 탼$u$(hl+P2 $(jPV t"$(؃tTu*uCh3> 1C؁^_[]ÁttPJPUh7 1ۃ$u=.t$, PUt$, UhnJ=.uj $t7t$&1FV&Vt$]u hvnh= i!$(\$(SPhehW t$WE蹗 8tUWhz= u藗 8uD$(PUPhn< j' USWV ˁD$Pj VL$ Qhn #+t$1!Gt6t =.t#tFwPh5T褺 G!Ņt G !rt4tUrt-FUQPhnX 1tKtFPhn. t 0h hr =.tFstspPhnй =.tPh觹 sds`sTsPhn莹 slshs\sXhou =.|Ut$ 1|$$hVPPhPt$5u(|$ t!j Vg tVWh7o h,#  2t Ph ^_[]fWVt$t-t|$ PW tu.4 1.^_WVD$ 18nuxou .PC t_1,tu@APWtCƉ8j,Wf 1Gt@Gj,Ppf 'h 9 hM9 W}1^_fWVt$ |$7WVUSWV$$l$WVSU$$hhU3Wh[qWuWVhjCD$@t.D$t$QPh!hVϷV& jl USWV$$$1hWS 8D$$81G=T6=+D$ C|D$D$1D$hJqUVyR T~H wV$! $׃Gt!M5U6L$ 뱀L$5U6-$Ax|$뎃UL$5U6($At|$_ $V $M5U6L$|$0P$hT!5U6k&P $+)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PV" t\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]h/j@VhQ PhqhĻ+Ѷ j觫 fWVPt$jWV6 9u9t x^_Vt$hej@Vt$Vt@^hV^Vt$V߰t@^h1V|^WVPt$jWVY6 9t9u x^_Vhwj?WVt$|$ VWӧt$?/tWh*< VhC. ^_Whj{?fWVt$ |$7'WVSWV$D$\$VPWS$,$,njS7VhBq Su$, tu!D$zt$Kj : 0PVt$ hj>USWV\$ l$|$t$1E1@T6+hWV:N ou%jSh8!5U6tEP袙ǃuA+)ރu4t$$V4Nut$(t;^_[]h/j>轌 PhhĻ+= j fWVt$|$ VWt$?/tWh*h VhCZ ^_Whj=fWVt$ |$7SWVUSWV $$l$WVSU$ $ hU3Whrq.QuWVhj(=D$@tY$$QPh!hVlV$$$$$hq蛰 j USWVMu1} ]hD$ PV D$ FxD$D$D$D$D$hqWSK L~)Hw;$!5U6Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5U6L$1@D$kjuhT!5U60Pߖ=N|45U63 1@D$5U6Fp1@D$5U6L$ 1@D$+H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W 0 WRi @$N|dže^_[]h/j:t$h诈 Ph3rhĻ+/ j WVPt$jWVB0 9u9t x^_Vt$hejy9Vt$VCt@^hV^Vt$V?t@^h1V|^WVPt$jWV/ 9t9u x^_Vhwj8WVt$|$ VW3t$?/tWh*蜽 VhC莽 ^_Whj8fWVt$ |$7WV1^_USWVp|$o$o\$WVUS$$jHSuWh_LuI肈 8KD$  =d.%D$ Vt$S jHSt$D$@D$ $p QPh|!hVaD$tS\$O$oj j ShWt$ Py tP蹉 Ph|sK t$ SWhsf t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hs( 81p^_[]WVhj:7jS SWV\$D$@u+t$|6 t;SP t7Vl1 .C.C^_[h j6j USWVPL$$T$ l$\$1$1@+֍zhrUS1F @~7M$!OӃ23=`.d.먀'룋 U6DF@N@늋 U6IF(NnOe U6R+KF ?+0O' U6aF8N \.O U6g\Pc D$ p4t$ N @OPt$(hܬ!5U6褐Ƌ$t \.t'tOt@tO t=`.d. s=d.`.g@tOy +sg st1A T$ J shlVjh.$fyhrVOL$ A$I$shrV-L$ A I$shrV L$ A$I$shrVL$ AU jD$PW$lPjt$hD$(P t.2,$AuU=d.uLD$D$ 1@D$z  $t)ɋ,$t;|$ hu. 1l.$p.,$ h.D$ @tL$L$fQP$|BD.D$ HJ@BBp.up.ȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 5T65+\$ \$( \$$} ]D$,D$D$D$D$ D$hvWS8 H$D!P5U6H53$L$T$,Jjuh!5U6uP$뇉=U6jh8vW& t5jh=vW& tZPW4$T$D$0PW D$0t 8D$ D$(JD$0PW D$0t 8D$ vD$$c5 $T$$MA QD$5U6D$o5U6D$1@D$Q5U6tD$ 1@D$35+)h4u1 }WtD$0PWQ |$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5U6hvh/ 5U6hBvj&WhwPWhvWhw PWhqwjd&Wh\v7u PhwhĻ+跜 j荑 SWV$t$$$$\$VPWS$H$HTj S7Vh~q:D$@t$hyvԙ t$t$hv这 t$ t$ hv誙 t$jt0hv苙 jt$hvv t$轑t0hvW jt$ hvB t$ hv1 1$^_[VhmvjE%WVt$ |$7WV1^_U0E\$D$,1ɍT$ QQPRhKw4 uUD$ L$$L$D$l$ \$ D$L$ |$D$ fD$l$|$l$D$T$]hXwj$WVPt$jWV 9u9t x^_Vt$hej!$Vt$Vt@^hV^Vt$Vt@^h1V|^WVPt$jWVa 9t9u x^_Vhwj#WVt$|$ VWۋt$?/tWh*D VhC6 ^_Whj#fWV1t$|$ ɉ @4ue ȉXȉX\ȉ\ȉ     PQ40 40<8y <8D@Y D@LH9 LHTP TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40 40<8_ <8D@? D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7 Vw w V Fww VFww VF^_USWV\$l$EffEffCEffCEffCu u8 S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uum SCuuY SCu$u E S$C EDȉCDu,u() S,C(E@ȉC@u4u0  S4C0EHȉCHuW|Z hWfZ <$t=U6W@,U61"PPhPPV.Yjj5U6] D$,9U61~PPhPj . =<.=U6jh$.h+WsPr U61HPPhPjT.U61 PPhPho.rU6(.a1@D$(SU61MPPhPj%.(U61'PPjcPP؀+=U6h1WX hWX  4.H.=8.8.=<.=U6yWȁ@U61PPhPj?X.BU61xPPhPj+1GhĻ+Wj>hx8 =D.<$=U6hxWW uL.G=U61!PPjPPԀ+1@D$$U61PPjPPj8.mU61i~PPhPh<P.P9U61yPPhPj\. =U6=,.j:W6 Aj/W6 .?y0.U6{l$0UU݋\$UW|$Pv d.`.s+DH,W D$hWU hۖ WU .W 4.N1PPhPj ܀+,@. +DHW D$<$.hy+=Ԁ+_=4.tVhyz5U6hzyj5U6hxZhyPh/jWhdy9Wh^.D$ =8.u1=<.@8.$1󫍄$,B$.Al$$+D$ -<.t1$ 1D$$$MljL$$ PWB ?t$hIzP.l$Ul$RQP/P  $׉ȉ `.=d.1| hz$t/$$T$9‰sQt$t$WPh${tFtA P.WPUlX u5d.5`.t$hg{|$(F=$PU舞uRt$h{B  A#$=`hh.hqz1=H. $Vh$u Vh{al$VjD$PZ `.-P.-d.݃=8.~VUWt$h{ǁ |>9|Pt$t$ k )̓ }4$\$l$ ..ɋ|$  .=0. d.5`.σ|,@σ|1ҿ9  P.9|щ .|$ D=H.Ejjhh. .hh.hz.=0.t.0.t&hQh| 0..t=|hPhH| = .u1=.1@ .=X.u .X.=؀+,=.t#jh|h|h|腐 .=T.u=Ԁ+.T.t$t$ t$4Ut$$Vt$t 9t VIt U;=<.9$Pt~E tƃhdž,<tx(=0.dž dž,dž(Ɔ ܀++u(jhفv =D.-5t.u"jh|v =D.,5t. .N0.F4Qt$Qh3Cv =D.w,5t.F4Ht$Ph\v =D.S,5t.F4 P.9}"QPhu =D.+,5t.F0=)hPhu =D.+5t.F0=|)hPhu =D.+5t.F0N49}QPh ]u =D.+.t.;.|QUUUU)ʹ3333!!сis{09\~\{0\\5 .sXș9}%CX=8.~QhGt t.sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h_s =D.**t.{4$=P.11F9tA uPhjs$Kd=d.5`. u։<8=Ԁ+[ WVhs =D.)t.<$C4$8=P.`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQP> Njs8ƒPVRWnv )lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVhԃp =D.'\.tm t.yxH1҉$q1ҋ8$$)$<$$1C$I8$ X.=t._x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$Wm< 1C1 t׉Ë$$QPV$$Vy 9s($$$V< É׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPd ƒ$$$$$$׋$$$RPVQ $9wȃr$9‹$֋$r‰$$$$$B1WRQP;9 Ë$Ë$ʃQPRSq )ÍC4$$W$$P$Q @$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ7 j$P$$ @$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh*j =D. t.B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=Ԁ+$_|HL!ʉG41SSjhjPS .N t.I4QSP@ t.H . . .P44Q5.щ .`@#HL 9| Hh ؀+H< .HX T.H\ .PTXH fǀ$p %=t.O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=Ԁ+5O _(HLJ$4.$$$t!LJ^F=8.$$߬$$ڌ$ ݔ$ɊOd t1G0 T$D$\$t$ED$\$$d t.$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$Xfd =t.O0 9| IУ..=<.u\Tu))У.1VVjhjPV .u.9..5.jP]< =H.Gd. `.1ظ|(RQhc =D.d. `.5.5P.~ ș)dہ|4P!GuȹC=0.tL1$PP$$5,.V1=P.VhZN P.1u;1$VhjVu  =.5t.h`VW =@.tWV5t.x\.hhP: 1@$=8.h =8.|o5t.N,I\Tt~!NȃN׊Nd1 t1WPhpBRR)` $z+9u1H$Whht@P% PPftu!ѡ8.t $ Q$=H.u$|&t.H,$$DŽ$%$ t.I,$1$ DŽ$1hl+] t.$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h6f =D.Y t.j5x.7 5x.FU $F +$^t.$~J`^p=Ԁ+uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=0.uFh$ NlK`ڍOȃ$ډFd;v&h裒 =D.t.5x.F $11ہ~U uv`щSAt.$~!ـ1@ x.Il t.5x.F=Ԁ+Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5x.N uҋt.B8H!tk)D4t.B8)Nj5x.$9sE)ȉـ1B~U uv`5x.F$CHu͋t.B8$؋N9ȉ$J`~U uv`щSt.$~!ـ1@ x.Il t.5x.F=Ԁ+Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45x.;Vs2р1@~U uv`5x.F$Bɋt.$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$.H .V$P V PV~x; .up=@.t.s4PP t..@.Kd15.s4.. t.q4jPl0 t.5x.{0 9 .PVQ =@.t.5t.P5x.g t.y0.$ryxtG$\|| %TuCl$AP$ t.Ou$ց\TtQ!QЃyId t15.5.3 5t.\TG~8^xN`1?9'.+$~0lj$Ɖ$)ى$=.$i{ %Gl..9wߋ$9w$t.$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=8.} $H$$$~A=H.2$=|j.T 扄$rt t.ׁ\TtQ!QЃYId t1RP$VhaT $$;$$|W=8.9t.H,t =H. $$ DŽ$j S DŽ$Ct.;X,/$~ j R =H. $hjP1, Ԁ+ <.+ɋMt@U@f$$hM$lCɋuM@EfDŽ$AhO $h $lԀ+fDŽ$+t+$_ lj$DŽ$t.H4$ $ H5t.D@VL!! $`Nd8N o fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$+@ lj$DŽ$ t.H4$ $l$h  5t.D@~L!! $߉$Nd t1$Sv4$j2t.@0p9w Au1H$$DŽ$1$$tL  ǡ4.t.@05@.V$SQP$h$l @.ɉ$$$t RP $CPKT$l$hߍ$󥃼$$tA$ȃ=@.CX$tFDŽ$PQ 18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$v $pthj$P' t.\T$$i$$ $$$$DŽ$H0$$_$ t.@$D$@L!! $`sJ $h' $l$  t.Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h t.@$D$ @L!! $$SI $ $$h$lt.Hd t1$S6j$$V t.$ȔȐG$11F$t =<.$$=t.40=Ԁ+0w4w+_1.$`SWP $PjSU$ =@.t$W\=L.t.ǀ\8 t.=.x\hhP# P.QP WV=@.t. t.q4PP׸ 5t.HLNd t15.v4t5.95.vG=@.tt.p4VVx 5..@.=t.Od1Vw45.5.ڦ t.@4P5. e^_[]ÿWjV" 1=P.VW\hB J Bhх j&TA j%MA j(FA l.j 5A j.A j''A j A hLh˄BjA j@ j@ j@ j@ j@ j@ j@ j@ j@ j @ USWV=H.ua΋\$=<.tP.l.St$P 4׋ P.UPSt$$5.9u^_[]G% 0oPWVhH j$&@ USWV"=H.΅ .ut.H4H . . =P.;`.d.t.;}FWh `!1I!;HtG#P;Pt;H uV9R_1ڍ_5.P=P.Wh De^_[]USWV΋L$l$=<.t=H.teUjQ p׋ P.SPUt$$5|.耶9t?# 0nPWVhf-G j"s> P.l.UPQ ^_[]SI`wD$$!1C:QhhĻ+BI .  [SWV1ۃ=0.։ SjQ =Ԁ+@fF F)f ^_[USWV Ӊϋ5t.F Nd t15x.G=@.tx.5t.PP跳 x.yU +y/\$|$y1U =t.1=U L$D$uq`|$ G`Ӊ $u щw*l$$,!р4l$skPhhĻ+G =t.x.D$$F  l$uX<tR$|$ G8ʋL$;iЃ}AhՆ hhxy 11҉ ^_[]ÉՁ|$U u L$I` L$w$$Vj28$u Vh{ ..%.ʼn߃=.~VWUt$h{/ |>9|Pt$t$賗 )σ}4$Y> .-.uU-.uY5.=..@19lj| 19ǃ| .u .͋5.=..ˉjURP =.l$ .uA@19lj$ $t$u h.hzjPVW} v|$wext23$2fs3$ Wh h.h!Vh.hz} 19ǃ} h{ .t$VUt$  U t 9t VjN$ USWVӉ $= |$j W\$ S9 Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph1L$8ɉ׉u L$8t 1@׉׉|$l$ ` 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3QPWUt$t$h QPWUt$t$h t$t$hcjWVX Ļ+PhZV- 1GVWjhr Vh@!u W" USWVu} D$8jP =.5.5.%UUUU)3333!!щ%i.B.99++T$u tv|$΍Q..5. .VT$ ..ډ.P…Ƅ!) .1f1ҁ‰t$$r=..\$9D$ .T$.1t$$ËT$ u׍؉)9H1D$ 1. w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ.5.. +t$ƺQ=.D$.D$ ..D$..1 .5.D$8. ..S...N5 .$.4.8.[<.# f(.gf*.,. +f0.\$H$SW蘏93rWh@."5.|$t"V諼 YjVhP.R 1`....$.D$4. .+ . 1҃r1I15.~σRVPW螢 5.H19w+5.|$OL$)9r΅u 4.f5.5.5.VG%.YVjP GD$AD$ 11L$\$..tn<.tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& .@4.t . .@ .1H.L2 .D1\$;|$t.)á.f\0 .D1 .u\$fT1 .T1fD1L$ G;|$tD$ $.|$11t$..=.~i . i{5.Q5.5.PRuhMf$ . .5.PQWh?$ .@. .1QQjhjPQ .I 5 .jP =.uk. .1! V5. 1N1Ƀ *x Fu  1@D$$=.|>hьeX =.|(L$ . .1PQhpBPP! D$$z+9u1H|$LWhht@P PPftu!ыt$.tL$QT$=.uL$L$D$ 1D$L$ 11T$hl+J =$.t$tX<.tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f52..1. 5.D$ hh.P( 5..P5.Vt$ =.=. .15.ǡ .)؉1t$ P =.Wjh. .H9|$u_.5. .)ʍZ9s1Gр.B9r).VhP t$ 1Ƀr!11ƃ.Cω 9rωp 9ǿs"ˀ.CI 9rޡ.L$  .1Ҹ.Pt$ 5.Vj.P . .L$)QhP u1.@ u.L$ D .1Ҿ.Vt$# 5.jVk =.tb1=.t 1+D x.F;5.r.L$ D .1h.5. G;=.r=.t$|\tX=$.te<.t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=.|$T$T$|ʉj. t$몸r|$|$t . .jQt$,Php T$;D$_=.* .t=.u&D$ D$D$j A 1hB  ~ j  =.d=$.14.$hjVM fF쀁 fFD$8FFFfF5. ׉؉t$ ֍$fBt <.$,F܉VDF81 L$ F4D$4z .1CL$ =.W D$(\WD$S5.tPjt$0@ . 9`L$97|$0N.L$,ʋL$(T$.1GL$ T$D$ <.D$.D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP L$ D$1t$V .1CL$ \$. .=.t$,9sD$()QjP t$*L$ D$41ҋt$(VW'V*$Yj=$.t8.t /+7+(+@1=.à r t$hhjV fFA fF.ÉFD$8FFF5 .fFfFV .AFmlj\$r*D$p1ۋ .1zC9uߊ .1h.5.5.f5<+|$D$1ۉt$ >+x1ɉt$)r.RQP Wh8+.V 8+.D$ f. .1Vt$ \9\$t5.<+D$ CiL$T 1VhVD$pPq 95$.t8.t++'+fD$TA fD$V+ƉD$XD$8D$\D$`D$dqfD$lfD$n .1@D$pAD$| .1h.5.iL$Tj f2.1ۃ=. 5.<hh.W+ 5..P5.V 5. .15.ơ .)؉1WP5 .5.s e^_[]h֊h ,h%P` hPh֊hpVhRhPRhՇhVhhVh,RVhVWhVPhˌhvjVWt$hψgh`h+YhхRhKRQhB1V'h֊h"h֊h h֊h: h֊h}j]USWV.=$.tr<.tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(.Ѓ4.t . .Ѓ^_[]SWV=.u0׉΋ .\$QPSt$ 5.蔄9u^_[WVhhj覡USWV=.΁ /u=.1 . /.11;.-.ǡ..9v@1Sh!8!;HtH#P;PtUSWV Ӊϋ5.Vjh. Kt$|$$tE.@fGOPQU GEGfEG)ƁKu. $<ȋ\$;ft;L;AQPU ;ED;fED$ ^_[]USWVP=.1f .9$S7ŋ .1US..rA9wʉ9uA9u)t)D51sCuUF"1q|1BrdʈT. .1U5.U!.fH $$s .f@ .5.މ^_[]hM hߋjUSWVӉL$-.Ut$(D$ lj\$  15. .f|A .1WUEG G.@ .1W5..fL .<$..Ël$9ʼn-.D$1PSVU* щʉl$)Ћ.SRPQ ʼnӋD$l8\8( . t1$P5.X=+.QPVt$CNj|$ ǃ=$.t0.Pt$VW %=t((z5 Gdڋ4$V5.[V^_[]hh-VUhhgPjj hh jj hhIjӛfUSWV$8tWEƅuWhJj蟛$$<$4D$Phd@U tg1OVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uht$(91 ShUl CPhU  C PhU CPhU CPhU $@D$t P1-Uhzd@$<W t1 VhedAW hjU D$ P$4Tj D$, 9L$L$9u0$S11: 8tx$0hai b$11҉ $ƅ*ŰPj PU蕣 ^_[]$0hyjRUSWV01ۍD$,ShPSu 1NtAljSPSWuWwuMU D$t$$$Q1e^_[]fUSWV1@D$D$Pjj菘 /xjjjx /y hj耘jP8xu h PȪuh.‹} ]751HD$D$ 1D$؉h5WS辧 H41B$!؍|$W5U6 0/8 } r؍|$W5U63 `/} 8!M ؍|$jW5U6 9D$=} ؍|$jW5U6} D$} 8e؉|$L؀ / U61JPPhP/؀ /؍|$jW5U6 9 $/7؀ (/k؍|$jW5U6nj 9=D$؀ !/؀ /؀ !/ء /@ /؀ !/؀ !/؀ !/U61cPPh@/4 ء /@ /U6USWVX/ 0ff/030 03 0 /0f/f/1/Ѓuȉf /1t$<jVjP5/4jhx/jjh/5/pgy /t hP D$<jVjj5/yh0j/0f/ / r&sK0/0/0/+ 0ɸMb-0ʉ // /yf/|$qD11/C9ut /‰f/0T$1A xVWhx/ht  hm}~ hĻ+p  01B 00@ 00(00,00000 0 uCء0000 0 00 00 ؉+00D$HT$Ll$H0+0D$8D$85 v?|$ D$ fD$l$\$4l$ D$4Ӊ 00 wh0/ 00 0000ʚ; 006eĉ011ۋ00D$T$ ؋00D$0D$0D$50L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05  t$v 0050=0|$(t$(|$D$ fD$ l$ \$,l$|$,=0ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă50 0=0 /t 1A /y7/ /9}(0i-@=B'/@9u0e^_[]h/hdjDUSWVh0j`/ \$Du{'-00D$hD$h5 \$Dݜ$݄$h0ju{(-00D$dD$d5 ݄$\$D 0;$/D$D0 0 t]+ 00$$߬$0+0D$\D$\5  s=0uZ /tQ0 0 t5+ 00L$xD$|l$x0+0D$XD$X5 wD$DD$D 00/ w١0 0 t>+ (0,0$$߬$0+00D$`D$`5 D$Dw\$8/$fDŽ$jh0j_ D$8 |$&D$& fD$Bl$B\$Tl$&t$Tj$P,` SD$lD$lPD$,Pj5/5/5/_<h0j/D$8<BC97)؉D$D$8 T$ܸ!\$A90I؉L$A 0Iff9u00000000 0u00000040 / 1D$1 8  8l1A hJTv hĻ+A /<1A t$,PVhnV ΍T$(jt$>PhR D$  /t$؉T$΍T$(jt$F$8!h΍T$(jt$Jhz ΍T$(jt$bF$(!h΍T$(jt$$Fft$NfQPh< ΍T$(jt$؉t$hW΍T$(jt$^؉t$hov΍T$(jt$z0FT_hG΍T$(jt$9FPhؕ΍T$(jt$ ؉t$h΍T$(jt$؉t$h΍T$(jt$d؉t$h΍T$(jt$9؉t$h& T΍T$(jt$X؉t$h*)΍T$(jt$-؉t$h? h Ph L$lL$AQ D$iPh h hɔh Nh0h'y t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظL$dT$C;T0u#PhX0QD$X L$$ D$LT0PQhX0 T$Ҹu1GT$Pz L$r |$ rIt+H t+~l+H l+ hl+j  (  }T$A{^N2D$ˀ) h uPt$,L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhU hy? 9 |$ sSt+H t+~l+H l+ hl+j   }KF߉Ήs(T$h L$T$؅t%t+H t+~l+H l+ 1I hl+j > hl+ ء40;$/*؅tء /!^L$AQ T$Q=0 0 t+)|$L$p|$tl$p0)ЉD$PD$P5 0000H+vH+ 0v 0\$CfK%0f!t0 40T$ .KfKf0D$ 0@1ۺ9T$t$,L$IfɋT$8RD$4\$T$T$$T$ $L$J0@)t2(uK 0 /t1 0h 0  / PVh Phwhh"hCAfPh`hhhhʓhhhh!h2whKmhec 0hR 1BD$D$pfP+@)f~\ /tSωL$!ȹT$V!RPt$ h T$ D$, /t1RT$D$fxf5P+ /ruTt$,L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B/C9D$= / ؉T$5/|$7/)RQP8 GD$9L$~D$8:/uG9u߅uQt$,L$IfɋT$8RD$4\$T$T$$T$ $L$E5/)/t$>RQPhC_ /;/}0u h? Ph- Cы\$1B\$D$\$D$T$jhSjt1AhWV 880~b<0@0 t+Qt+; +hl+j. 80 l+Ql+.H 80by`)<0@0 t+Qt+; +hl+j 80 l+Ql+H 80|tN=<0t4t+H t+~l+H l+ hl+j <0@0hl+c hĻ+V 0H00L00P0 8^_jj 1A1=40P USWV׉E\$1AM /]E uWVh t h͑ Shӑ  /t5@D$ \$D$$ۑ  /fyuhĻ+j e^_[]UVh1AtD$x/$Q 0D$$< 40D$$' 0tD$$5 0t9+ 40} $F!L$LD$L D$Ht$H\$$i $ 40 / 0L$DD$D=0@|-0  H+ 0\$,D$(\$ D$\$D$\$D$$|  /0 0 t5+ 00L$XD$\l$X0+0D$@D$@5 ,0 (0 t7+ 00L$PD$Tl$P00+0D$L> QPhwl /tkD>L> QPhF|>uGD> /ufPhΖ "L> ffPQh ^_[WV!/u8jjV& t'86PWhߖhh0 "6qPhhh0 ^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h $t$t$ t$SPh  UPh t$t$t$ hn t$Ph T t$ xPhpY: r0G9s'GPh_ | KG9r߃$^_[]fUSWV̹ ƀ8-uFh3V u 0h\3V 1u 0T$,11CD$D$h5Rt$0Yz Hw؉$x!\$̃duE뻁뱀=0t\랉\$떁댁낃u1 +1;L$(uj1L$ 1ɉT$Љ $PHs L$Au $APD$t2ڋL$ PWDUWr f uމ$Dt uY|$ujSDžuzP`t8=0uIj Vh3  Wh>T1FVPhVhSU8Ihx3=0Mj Vh\3 WhKV \$rʉdVWSS jjVWSE\$uD1GWWƵ Wj軵 Wj谵 Wj襵 WV薵 Wj 苵 VWQFu hjhjj4Fu' 8j2uFDj2j jEt)qtOQx2j jEu轷 8t1Aj jhx3k ukWhpjh t$UGߙQ\ b 0WWYEtrVPSh5TWfSWh]jAV =0ur蒵 VPhhĻ+ j fD$tPhǚQ Y hȻ!PhۚhĻ+ j USWVPu } hȻ!WVv cR~5StET 0͍Hw4$! 0벃L00둃ftTdL 0t0e 0V0G$080) +Te (0= 0tjjh HC ,0ND$ jjj")e ,0jL$$Qh@hPju hZ ,0i )ލ<S H $ع!=0t1Aj D$<1CPSUD$D$ PS>D$D$$PS'D$D$(PSD$ D$,PSD$D$0PSD$D$4PSD$8|$ |$z |$o |$ d |$Y |$N F <0D$8gtj5,0qCrD$ D$rD$D$r_;-00S% t.H$1ۃ=0uWhfhJh >h S( g =0uh5hh 1C@0FLCSS H3 VT$W$! \$@1ɍP$к!X01A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12`0#@0L$L$# 1AD$ PD$@PD$ D$<+40R D$ Pj$<0+<0+<0+ H0L0׋t$#D$ Pj80d$zT$ ED$ L$TL$@JL$C<0"+-L$#d$d$d$L$׋t$h0:0@.0"p0x0 0\$ 0H0L0 t P0t H01SSP L$Y\=0j$)/jD$D$ D$rD$r00L$9a|$u q40 80ta|$  ‰4 D$=@0T$tD$1@D$ 谮 1ۉD$0蠮 hxSh0Ϊ atgcuL$0 00P0@P000000P0 0 0tJt$(~A|t100t|$ ObT00 0tPt$ tH@WVh 0 T 0=$0t=0uQ00tMD$tH@Vt$ WS =$0t=0uL$^00tDD$(tIAVPW}S =$0t=0uL$(l{00tDD$,tIAVPW0S =$0t=0uL$,z.00tDD$4tIAVPWR =$0t=0uL$400 tDD$0tIAVPWR =$0t=0uL$00)f=0=$0tP=0uG=00t4t+H t+~l+H l+ hl+j 7 01=0IWh05,07 u+[ 87tQ t)7|$t+u-/9|$Ph!|$ PPh{  83u=<0t"۪ 1ۃ8=<01ۀ?D$ t$ ht$$\t$(Pt$,Dt$08t$4,t$8 e^_[]jhe jXShCh hhj hڟw F(:!QPSPWl+PWy> h< F QPSPWl+PWC> V xdvvh V!Ž!t8!~ !tF\$(RPQhSXhl+S= V e^_[]FPh FfhF hrPhO F|$(QPh!hWhl+WP= VƘFPh FHfw6$l!h̞chٜ Phۢ Phۢ 6hɞ'h֞ hh  hw 1H9vh^-NT$(PQR| FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPh D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$Xh(Z PSVhС苻 hl+>p ^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV6L +D$  P31PPWSjVK |$dt$ \$hߢD$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9+tE+P{y$L$t h=hbQQh* PPh' C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP PPh΢h t+H t+~l+H l+ hl+j $ T$h9t$ hߢ L^_[]h jhjED$t'T$tt h=hbQQh* PPh'蜸 ËD$t%u\%tuLPhfCVPhN USWV|$<\$8D$4t$0~u/jU^u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWh~謷 Ph蜷 PWh苷 ^_[]USWV|$4t$0=X0uMX0hhY0D t Y0'j.hY0e t@hPhY0nM t"^tCt0Wv`rhhh`0.M ^_[]1w)ȉPjQ= SVUl fEu jU\WUu&Vh`0Shhh`0 `0^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh`0Shhh`0舴 `0[SWV$L$4D$1Gt!t$"tZ@:t9rD$Ph|蛵 ,^_[SWV|$t^D$uFD$jjP$ t1Nj0j.Vc t@hY0P范 u7ut$chVh`0gK `0^_[VD$L$ 1Ҁ0QRRhh`0VPthh& h`0c `0^Au yuyt$Qtu ȃP QAPhעhh`0 `0SWVD$`0Q4R[04R\0ƄR]0.r|I1AFL$ tWWVWhؿ!u;D$ D$ PGWWVD$Phؿ!tt$襶Ĩ ^_[]ht$ ltԉ1|$l$Vh$PVS蔧Ht$t$Wh|dD$P0k \$tN1D$;D$ 2i9t$sVt$tt!ʼnD$t$Wh|dt$j ul$$WhedAPj f$a$>ukSt$hh@ h$W臤 Ƅ$tl05z t菀 $QPW蠥 $Kà9Éu|$$Pe1hjÅ~A1ۉhPus ujVhh5Th$W豣 Ƅ$|$tl0\z t $QPWǤ C;\$ mUJ|$l$|$$PUSWV ujÛ D$$D$<$shƤVr thmVwr 3hU菍 Ƅ$hms?r ut s hmV蚠 tt s hɤVz t P*Bl0D$ hӤVQ tHáp0thPq (j,SQ tZ S. ,PD$PUw xD$!=`ÉUh$  S. Dž?tG<$tSWUhh?Qh$Va VhtEUhv Zhݤd ?Uhhh$P 15p0t ~siP苟VD$Pj > Ë} 9tVSh tNt$ t.u[D$|D$$chʦD$|D$$%:D$@|D$$,t$ }2D$6D$$r}D$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hh$S \$ =x0uD$D$ P$P̫dr 8\$t$Ph x0PUuuUh 1@$~#Qhy} 1@$\$$$Ĕ ^_[]$Phj!Kp PhhĻ+˗ j行 USWV L$|0$T$t-0*jh|0 0š|0$T$1i E$48t!u6$t$Pc T$ uF$t$Pb T$ tEM<ǃ hz> 1 ^_[]ËD$ t 0|0$4$݋D$ t 0|0$$ؾ0Phh0} uh0hjB fVD$t.})zhª1hɨ51X 1T轴E!PQh5T51# Pu51heL 1^ËD$ H^WVθE!PVa t)uVh51賕 1SGt8tPwhx whfuj whª1A) G11^_WVD$ t;51D$=X1 1u X1!;pt8@uVhj@u=X1thX1PhÀ Ph賀u51=X1^_Ã|$t 1Ã|$t E1Ã|$t !rϲ1Ã|$uh41h'51/ 螲1Ã|$uh1hH51 m1Ã|$uh1hk51͓ <1SWV$$DŽ$HH$p)Ƌ$ ƒtS!=1tatσ=1 =1 PSj $;rtr1Auu($$hPQJ te$P$$hPQ t8$(1;BQPVWEV蝟ְ1^_[USWVx֋$$t{tp11@=+D_t1z\t r9΅t<΄t45+AҀ|Vy5+TVP5+@u΋$ $t`1Hh1trʄt<$1ۊ1t8tCu 9s1B+$=FFu4$D$|$ 1 ¢1$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ ¦1<$؉D$¦1$to\[$uvz$\$-+BDEJ<0HB,t ]tVрy$t[+BDC$G)=~"B $tG)=BJB5A+<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$51h <$?uhVW! x^_[]USWV0$Du%$H$DhPQ y1E-1h8jUh0(t$H4$=1I1VV$PH Í|$0;=41=1$H515151s =1t9ƒ=D1RPSQUy=1uE=1t<D1D1$Hct1D1 1VV$PO Å 4$j1x10^_[]Ã$D|Ã=41t=@1;1 T$󫋄$HRjh4|$D$=41ʉǃ=1$H[L$05151j =1t9Ã=D1VPRQw=1u9=1t05D1D1$H1t15D1G=41-=1$H$HL$05151j ƃ=1t$H9=D1PVRQv=1u_=1tV=D1D1$H1t1=D1$$H4hé D$P!E;$Dnj=1t#1@=u1Hjh2P jh0iWV=1t@=1t75D1=Hb1D1Hb115D1=Hb1u 1^_USWV1@=D1S=Hb1FϻijͅtUShҳ51览 51: t$PhVh+xd+L$DH?uh1t$t$1hTh\1t$t$1=\1t 1hahD1t$t$a1WVD$ t+}&}.1=`1`1FV蘜1Ht$u8vh~V#t\hFVVu$`1FVWv<1v0hVW =1`1`1=1t?~?t5 151>gt5<1RPhQW} `1#51jj6hr)* `111^_h̫h@1t$t$ 1hիhT1t$t$1WVD$ tZ}UuZt$~h~WܠtOhFVWʠtBWy7vh51| 1H_1=11@11 11ҾFVt~ щ 1PVh 51$| 1=11^_ËD$uD$L$h%PQ[ tvD$phagu<=1u0=X1t51h6ZD$ph`tgu+|111֙1VD$ L$1t u]H 1HQtsPt8 =11t5h1hyPz 1(^KVhh Pjj$h' Vׇ^ËD$tIDuD$L$hPQ t$D$phUfu|1Ș1SWVD$-uD$L$hPQ  1G=1h8jlWh0輗t D$1VVt$ ǀ?tx=1tyD$thWheu |1=1uB=1t9=D1D1D$bt1=D1 1VVt$Q DžaSj致1|1^_[ËD$uD$L$hPQL tmD$_D$L$hɬPQ( tI|$BD$phѬ{du8D$ph٬bdu|1ÃtЖ1USWVt$ |$.E1ۈ$51jj,h# % u v1.L1^_[]1USWV D$ #D$$L$ hPQ L$ ȃ#D$$L$ hPQ D$ L$$|<$Dh t$A t3$8|t+4$$H$$ 3D$$h:0A D$1E-1h8j7Uh0臓t D$$\t$=11D$ H9=41tB9t$t$T$$VVP4t$Q1u?=1t6D1D1D$$" 1tA 1D1E_t$jV1$9t4$91 ^_[]SWV$tKjj tK~S9uWjد1uhQ Ò1H1^_[þVFujj苯hw1stj/V8>t@hQW =1t851V1HQP~ Q Pj w |j5\1hQWV jWV Vh> 1j1h SWVPD$D$t&D$t$hxPV製 r莑1^_[ËD$ph^u|$hXtD$x|$Wh^W PjWH uP|$ht D$x |$WhI^Wp PjWdH 1ۃuM|$ Àu*D$p Vh^V0 PjV$H 4151hD$17=1t =1u=1t#h1h51q 151jj%hW ËD$1ŏ=1uD=1t#h1h51 q 151jj$h ËD$uD$L$hPQH teD$phH\u<=1u0=X1t51hGD$phGa\u|1Ԏ1ËD$uD$L$hPQ螺 teD$phz[u<=1u0=X1t51hOD$phy[u|1*1ËD$t8uD$L$hPQ tD$L$QPhr ڍ1USWVh$V $|F$$h1Gh4V 9}hhV G9$uVhZu jLT|1^_[]ËD$t8uD$L$hPQ tD$L$QPh 1ËD$thuD$L$hSfPQ輸 tHD$:D$L$hPQ蘸 t$|$D$pphY Ãte1VD$t$5X1X1u hǮY%(1D$ phҮY5X1^VD$Hr1>5X1X1uh8YD$ ph"Y5X1^VD$t$5X1X1u hX%p1D$ phX5X1^Ã|$u|$t51Ã=41t 1PP)j=41t 1PP jVa |$u|$t܊1Ã=41th3X7V1VVcV a VPD$ D$t}uD$p*{1hEWt+hLWt hSWu: 1Cv荼tu&6h[51\ z1H1^_[t1u11P51hw51F\ 1VD$ L$1ʃuCuD+tK+VrtQPj h51[ u^Rzjpp 1^WV|$ WtQƋ|$@tPhFWdF=X1t3|$t,P6h51^[ Wh51H[ ^_WV|$D$ 1uIw_tAƋ@tP8hF6hز51Z 1^_Rywh51Z ^_V|$t.=1t65X1X1hF5X1(x151jj,hU ^VD$Hrx1`=1t$5X1X1u(hHF-51jj,h D$ phME5X1^VD$u5=1t=T$ 5X1X1Ju:QhE;x1051jj,hUg rQhRE 5X1^ÐUSWV@$(@u$,@tw~!$,@$(@hcPQ菣 tӋ=81~+$,@X11j US t F9u19u2$,@ph51X 1@^_[]ÍD$h@hD"1Pk 1D$@1ɽ $L$99` +OGGDA@uD"1ȃ$t \u_GGY +WDQuViuAG;$(@}/$,@Db1)Q4V $,@4 1@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@Db1)QtVa $,@t H10舆tƃu51h'51h'~ t;=41u251hS1D$@9G=X1t<51hD"11HQP~ Q Pj &Z j 6\$Su 1105Db1V =Lb1t'~t!1HQP;H~EQh@D$PhD"1 Db1$(@1$,@PjY 븃<$JE1A;$(@t4fUSWV1$D$jh1st%=41t 1PP1<$~KD$@$Ahjhj <$t(=41t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4 t0=1u 1D$ Y$-h1t+h U t}|tUah1<$~D$@$D$<$d-SWV։jh9Q jhAW tlhEWN tjhIW uYt F t8t4hӵt8tjhIWO t ^_[(11VPP ^_[)WShPjiUSWV$\$@t$<|$j hQW |$D$ 1D$D$SyƉ$P D0hnPs(t$Dhx$t$$t|$@t$t$@ЃD$;h1t|$tt$}\D$L$d).$`.$Y.$tM.|$Htt$H5\D$H|$Ptt$P\D$P$t$[DŽ$$t$[DŽ$D$Te^_[]ËD$lt8uu L$DUuD=h1t;P=D$HL$H+h1tD$Ej/t$Lvt@Pt$Dht$HD$t$h1L$D|$D$81t1p1l1h1$$9l1t1$Pt$q u$\$` t1p1|$py|1h 2t$LƸD$|$t$u$QP u5$8$<$$$\$` l1h1p1 t1t+t$j5t15p1P  Y=X1tPt$Hh&51L t1p1 tQPh151{L 51h2(1O$=1K1 1O$*|$pu D$TQhŶeZ <0ht$hW =1|$Lu:|$LD$puuhݵt$Hh,*uhӵc~D$L|1G|$LD$L8|$dD$t$h ~8P&$$WP $<h/ VR 1A$<$ǀ?tvj:W0t=@j $QPS ~޻t?$9u3;$u*W 9$<r$)PWR t/h/ VR Džm1Ft$Hh 1$t PmW$$u |$p$$p1 t1t$Lt VhQt$d蔯t|$dj%W t Whʹ1$GGG fGP$xPW# $u2$t'8t"$tJ?t1hwMW! tVh W $(2WRVDŽ$t$D$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB 1JBB D$(PRW$8$t ]9" 0lRtD$(Z$$PN-j j WhSvvt%hzPS j zPW =X1t+D$(xt!~<tPWSP51G v jv; Åx`=X1u~PvvSvx)$P$P$Phr裈ykS躯1KW$Phbo Nȉޅɍ$P"PW$4h#EU h1N=H1tJ$t$uP莚$$t$uPi$81~R1Wh7 tNu1h@hhD"1$ %u105Db1ދ$tPASDŽ$$t4W PjW  $tPSDŽ$$t4W PjW $tPRDŽ$D$(t Pj!|$D$$hUj$1<tQohߩ$辰D$$\t$ vj:1tV&=X1tWh51D t$$tI=X1D$tPt$hhh51D 1@t$ht$hhrf |$dwhҺV #hVhVӭ1tph{V跭 ȅup1 t151h请5t15p1hVq5t15p1h51C 1F&1t$lhV7 $`#=1t"D$$UtBQP|$hotPh|Wج hh{hW辬D$$0$|$Pt1$tttD=X1$tPh51B FWh׻$8WM $$0t-=X1tPh51B FShѻW t=X1t51h ht$ ۫t$t1V`}\$D$Lt$P5+Ɖ$$ىD$ډ׋$$|$0‹$4$8$ |1ˉƉ$D$@1S$P $+$$$$+$ى|g@By)Q聾 j$P $+$$$$+$ΉЃ||$`t$@$Dt$M$|$`tCt$5050臢 h50 M|$`=$@$Dt$hXֲ |h t$C D$8|jj n$D$@hPgD$@|$@DŽ$Ht1 p1 m!ڃt9}M#$H5l1h1$$!;$$=X1t51jj hv D$T}D$@l+=1=\1t1 p1ƒx19}%1HQP ;HQ#1HQP<Q 8tB$ڋ$!t h15l11ϋ$H1 D$hBP ht$1 D$@|$@tDŽ$Pt$D$@Ph>h2VhTO "0)PShgs hy%Pt$HhjBlhhM? bhA? L$D$ D$8t$4D$ D$0D$D$,T$1@މPj &4 t$ӛthٯ jct$@ $=P$#$1V$Wb $$$$$$t$@Ѓt$@Wt$u.51$P PRPhV/ t1=p1| jjkl1x& p1 p1t1t1; h1u1t1p1D1\$  p1 t1PL$T$ T$8t$4\$0r\$ X11tt$hY51. L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh~< D$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#1 7tt$hl51. T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h3< D$L$ L$8t$4\$0h < D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h $?; $D$8$D$4$D$0t$,$$1@މjh: D$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h"hhhc n USWVD1D$ D$D$D$fD$D$0D$8D$4jhIQ t}D$VƉD$j@P t%L$L$41@PPƉD$j:VR @P*D$ t$D$0|$jPW4 D$4t 8D$t{8tvD$ t8tj;PthPNhWNhWNVWh/8 Vh(8 1C)1C>l$,|$ $tc?tTj/W]L$9uut$@jhwMVܽ @L$ǃuC=@1taD$t$uI$t>thOV 1Ʌ $t}thOU 1ɉL$<=1=41t 1PPӼ=1 |$DhPW  |$L$D$L$D$ tD$ D$$=H1H1L$QPq=H141t=ut$8t$8t$ s t D$,t>D$Pj3D$T$ztQPhV6 "D$Pj詓<$l$,|$u'j/V tG1|$t>tFhh l$LUһ l$t$1l$ -|1D$Pj«9-|1*x1l$,1Kd}Z<$t3$DSVWa ShwMW SUW <$hh4Q t$LV' t$l$D$ D$<4uT5D1D1=l1?t$hP|$LW׺ |$D$Pj5D1h1uj/Ut@ʼnD$ D$$=l1tAD$Pj?>uP=1uDhĻ+jhh_ )1D$PjV811ۃcÍL$%L$0d؁D^_[]1Ehf4 Phh}j|USWV օ\$ |$$jh9Q l$t=jhIUԻ t;jhAU t9T$(.C fCPC fC C 1}Gt$j/U $t9lj)CSyS\$$UPָ { uG<$WxC Uxj@V |$$tZ{ u 1w@P}xƋ_j:S t@P\xG_Ot[uUnj]UA $tYÊ@t<:uL)SUV萤 Vɉ,$}:1j:V tEt$t$Vhh1ۋ\$ t3tHj PU+ }t $9ut=s fCt$t$Uh1 CC tWt_uk41KUVhX1 t$t$Vh1 \$ n1HJ381(urUvC{u{ xMtwMPvC1 ^_[]h1j_WV։2vvvGvvGF G FfG^_USWVȀ%t u7Qt*5+|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=1t  o T$ X1uv5uqrl=1uc=1t&t uu51h*51z 1HQP;H˃  QT$w+DXt1CУ11uss&5 иdtЃru+DXu 1@Au<1Ƀ t$|$ )t0sW|$ T$ dڃ( ʹtu-u|$t 1D$L$؅t$'T$9EPS B(=X1\$$t$uE5u@=1u71HQP~ Q Pj c 51% ~ uFuhD$,Ph1荪 1ۋt$tu 1tD$(Pу1|$t9ttCD$K1t 1jQ4$jQt$jQ=1tu jh=t0D$t=Pt@wu jT$=0D$ t=t@wu jT$50=t0jP$<t 1@ u|1ۉ1SHh9X1t71@t14L!h>51Q 51 14$jPt$jP'4$jzPt$jlP11(^_[]V 001jP=1t#1@=u1Hjh2Pz t0=x0u d 0^jh|02VN 0jO=1t#1@=u1Hjh2Pz 0=x0u  0^jh|022WVP=1|$t0hPjXOƍD$$PW51? 51h|51 1hWf 1ɅQǃ=t0t @w3t.VjNh! 11^_jփUSWV]U x1L$D$|11D$t1p11O=l1=h1 \1L$$9X1t?}t9:-tRh^51 tSh151 =1tSRu 191t jP}D$ |$|$jh00t=1jh2jMhjyMD$h u V tM>|jj KMD$~h 2WFFD$|$n\1D$ D$+\1u Njh0B/t$jLD$=1d1xPyd1|$tt$8 D$j1t1=p1jLh 2V: D$|$t~D$ PD$fxtD$xD$(PW& ux.#D$0=u$$ l1h1u hi51K Wh>Vh,胏 1D$tt$jKD$tt$j kKd1xPixd1|$ t|$t D$ t$Ѓ|$t t$ D$$\11t1p1t1p1e^_[]Ë=t1 p1 t^L$ hV1 thV u31HD$fxL$ D$@щυtSVh Vh|1WD$|$Y1;0v+ 0tQ10Pmc0jAD$ujj ID$=1tDx1=\1t l1!ȉ'D$ !jWPt$R 11HspL$1HfytL$IT$fztD$PV515050IE aPhZ NED$HQPD$~ Q P à tWtit1 p1;L$D$|T1HQP;H~0Q#51T x1L$D$L$Pj#a ͋D$@ @D$HQP;H~bQ p1t1D$HQP;H~(˃ tًz8p1t1PS Pj  1HjWQP| Ѕx,5t15p1h ߩu h J tct1 p1;L$D$}%1HQP ;HQ#1HQP~ Q Pj  D$@ @tu hZĊ D$@ @t$B 8 t h裊 1Ht1p1j>|$ tD$ t$ЃD$t$4 1t$Vt1=p1 Pj#a %hhh+h SWV |$$D$hWl t D$=1tD$1ƅu=1=1 4F951t jVth j$=41951t jVth0ht$ jh|0'jh0'hjEx0hWX  1|t1@v51h}M51h|j#1!h:jD$ t1p1 tQPh \$$SWh jE]j%#D$ t1p1 tQPh Vt$hj x01WW"W4$jCj"=x0SVh'51 4$jCjo" ^_[Åu1t PU"=1t j  |$1=1P"=1t j  |$1=1P!=1tV 11j $,y h=蝆 =,1t 1jYVV=1t ju!jk!=,1t 14$jQBVt$h t)Vt$h u=1 j =1{jklWVd011VA515t0|1rt suYg^dWPV WhV襚 1Iu1IPVQUl jh0$PhmjiUSWVD$=L1p0X00jjP8 d11tL$jQjhPk0<<=1w=1j=X1=1u X1hƉ=X1~&t =41u!h1h51 =41tC1=$ 51hjxh 1A =1=1=X1=1u X1h>Ɖ=X1~&t =41u%h1h51 =41y1=tT$ wJ51hw?tg1h =41 3t21h~=41PASV3Q LPSV3Q QEPSV3I1  $1=t$ <$$T$$$VRQPWhUh0`$:$:$:$0<0D$ff0k=P15d1jd1L1=110X0u f0d1t Pj0jjP蚋 d1=1u(QT$ RQhPd1 0Qh0P 1tjD$ Pjh5d1yD$1000 0000D$Ph05d1/ OD$0j5d1jy hQ =1" 0$t#/=1=1=1=11)L$ ׾0󥀼$u DŽ$$j j $Qh$QPR=X1=1u X1$P$Pt$hƉ=X1~&t =41u.h1h51 =41+1 0tPV0 0050=00SWVRQPhH0$ 0$ 0D$| 0D$x 0D$t 0D$p0D$l0D$h0D$d0D$`0D$\-00=0500 00PQjRVWSUt$|$$$$$$$$$$jjh,/X=41[=1N11ۉhG} 1A#hhu 11ɀ=0D$jD$ Pjj5d11Ƀ51h9q1E=01=$ w51hXhn| 5d1ed11AJ1;1=t+$ w!51hW51Qp뗠0<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph h0u, |$ |$|$1-0-0-0-0- 0-0-0f0D$L$  ȋL$$ D$( ȣ0D$ $ fD$ L$$T$(t$\$VWRQPSh)h0 1-0-0-0-0- 0-0-0f0D$L$  ȋL$$ D$( ȣ0D$ $ f0f 0;@00jPh05d1`1ɀ=0uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Phh0=\|$ |$|$10000 000f0L0@uD$ $ ff 0jhD0h0i 51h51h+51h51h;51h=P1USWVX=L1d1tuP jjP'a ƃPj5d1a t$d1D$fD$D$jP 1<D$T$ |$ Mbt$1PW輍 T$L$+T$ +L$(x@Biy1PjV>a u 8t 8#thpuhs X0t$4\$8VS5d1` ǃu+ 8t 8#uoVS5d1e` t׉5d10`=d1t$jW_ ut:|$9uD$0jPjjWrV5d1Ehv 5d1_d11e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$

 t1p1 )$fz$R|$0|$t1 p11PPPt$ E2 Kt1=p1|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q P  t u\$,ى;=p1t1|1jPPt$ 1 \$0D$HQPD$~ Q P9  " t ]Pj tit1 p1;L$D$|T1HQP;H~0Q#51裞 x1L$D$L$Pj# ̓p1t1D$HQPD$~ Q9 Pf ǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 p1t1gPQ ۋ] t1 p1;L$D$}%1HQP ;HzQ#1HQPQ 1JjQPR x~L$1HfytL$I$fzt$PW5|15050VP 8 t hi 1Ht1p1vu h i E @Ph>4Pj D$@ @t$ 8 t hRi 1Ht1p1$@ @tu hX,i j|$ tD$ 4$Ѓ$t$̾ 1t$V9t$t*t$h-51 51ha-]t1 p1|$| j%=T1D$ =PjSwBT$DD$@!уk։1\$HPS~ s{ 1CSu 膄751} D$@P臡 P6DPWhV Pj# h"h h3hͻ USWV\$j/S蝲t"wM9tjP /wMtjP~ Džxx01hSh01{ ƀ01.ue01G1dMt[G09tÉ؉jh01" x.0uO.u1GOtShf 1^_[]51hu6[SWVd|$t1F501j"jdhS({ 1Iu1IPSQM W9Vh01SWV1 f$D$@=u1H$jjSPp t h f hh51 51  1j Dž,y he =,1t 1j9t+t&1ONthSPM ju=1(u jju'hH=,1t 1j8^_[V蛿 001j t0z 0^USWVPt0hoj |$ 1te$011@K$101141E41 1CthQPx E1 <<0<0<X0X01<<11@@11DD11HH11LL11PP11TT11XX11\\1`;1VQPw VW1Pw q;1VQPw VW1Pyw 11;¢1VQPFw VW¢1P4w ¦1VPSw VU¦1P w 4$Vj=t0tt0jփ^_[]01j&=1t#1@=u1Hjh2PI ,111t0jh|0WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR1K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t51hU1Q 111j1xt5V9 11VhZ` 1jR4^51h7UfUSWV(! 1hrS@$@0014181<1h~t <11@@1D1H1L1P1T1X1\1`1d1h1l1t1p15x1|1511511111111h}tVPh1#t 9 I1hV}~t 1h}hnPtFhCzVtJhgVtm =wVhh1m 9r&51j?PVh| 11uhwM,1 V-VhPl VhnW\m h?vtlj1WQhʵ| ӵVvrrtWQV| ݵVuمtWQV| VuمtWQV|| VuمtWQV[| huptWQh4| hdutWQhfb | h=uمtWQh{ hutWSh{ UW62VjVj!VjVjh@!j9$<|$|$ $@j:0 t$@0<jh1hj+hj $@0j@V舂 txGp5T6h?T6?u D$PPPh"hl+U 1Ph+F 8P*11\$(ht$Si t$~$@@FF =H1t 11H1$<@VP=H1 41tȃujUS 41ȉ1t=u981Ph51b 51)=41d1|$|$ t&WWWv$@$@8jh1hj^hj O5U6hY5U6hL5U6h?PhU75U6j? PVh75U6hj?PWh j]ރ uR< 0Jt$$D$Dc ƃ=01tjWWX V PɯPVhnWV =1t>51h@1GK=D1thD1hqY51 51 jh@hD"1h+'tEt W=Db1k10t&ƅu''=51PF/~ tS=41tHb1j 6Wf 18105Db1V =Lb1t'~t!1HQP;H~Q~  Pj hj hj ^_Ã=1t1HQP~Q fPj eV5<1u<+t!+hfbP,tFuhj[5<1tPhh@13 @1^SWV|$1t*+t!+WPt Cuމ^_[V5@1u<+t!+hPtFuhjZ5@1rtPhhD1P3 D1^VPb1D"1T1Tb11X1 1ADb15P51O:tDb1^USWV1|$- +t}D$ +111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hVD$P֛ t uu ^_[]c;9ơ1=1tQh]P +t7+ 1ttPl#PV8 1uV-jV D$E3Vxtǃu&Vt$h Vt$h51 E|$tw7j h51 "j 7t$Vb t$D$PjW Mr^_[]USWVP Pb1T1$t!uLX1t.u=X1APb19!++X1 \1A t tu X1X1tu$X11BX1 \1$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5T1 Pb1;$T1 Pb11tu X1X1\1^_[]WVt$ t8+t+VPDtuVhjVG^_hf=+u 7+1@=u1HP>1;+USWV}uCjh1a 11 111 1p1 t1 11|$(jWa p1p1 t1 t1w+151G1; 1)ʉT$t$191s?D$0 1D$(L$, 111=1D$1D$"1ʃ|;D$L$y =\1`E\$ |$tY1${ {{;{{WSWBh ;{{{ {{|$$PS\$j U$1ۉ___ __$PWj֣ 1@G ____SW|$ S\$g =\1fDŽ$ x1t$PhhQ 1Fl1 h1ƒ\$x|$|l$x ݜ$݄$ L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)WhQP `19|ӡx1tPL$ \ L$ )΅~DQ4))hrShl!RhQP Ƌ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4T!QPh'SW L$(+ 1T$, 1\$0+1x@BD$ډL$hT$ll$h|$@t1 p11G؃D$@5 vqL$`\$dl$` ݜ$ܼ$ 1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4T!RSt$Dh4QP  l1h1ȃt1p1D$u݄$|9s0;T$ D$r$|$\$|?؍<)hV؍<)hIQP N+p1 t1T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh1VD$ B J1rrJVRVa$^Ã0D$4L$8T$ 1ɉJJJ JJQRPD x$1H0V+ 0j 0^USWVh=X1u=\1u }t$XjV/Y +1~= 1N+ 1y@BD$HT$Ll$HL$$D$$5 t1 p1Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иrt-|$d5|1PRQhqhWM |$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQrr-+|$QRhPt$ $ų i)s<$*<$Hrr޸t1@D$))kd΍ $1HQP~ Q P袏 ʍHr̃t"1$1HQP~ Q PY \t"u5$1HQP~ QP (1Gdu(11G $1HQP~ Q P̎ [~#\uE$1HQP~%Q'H wr? t:,u3P肎 t%(1GdzhP1N(1=(1i!h(1P芃 tu :v2USWVՉh(1QtDj.Vfc 1ۅt6UPu&)Wh(1VM u1ۀ(11C^_[]SWVD$=41t51h!51 nD$t$hqPV` uA `141t<1t$~Vt. 19PQ1^_[Pvt=`1t"=X1t51hi51I 1G=41 ShEhª1J =1=1Shh1I =01Shh41I =T1Shh1I = 1Shy hX1I x1=H11PPv hLj?WVPhD"1H ơ1?snt$hPV ƆD"1 E"1?)PRQh+5 x?t$|$ Db11; 1 ^_Phm(^ht$hO51˴ =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=1tDt Wh.$t VnhʵPD$D$ L$PQRSm:4$uu|$l$ 11tQSh4P۳ ShCPʳ D$WjPUh+tU51sƉ$t=`1t`VF SF <WFWt$P1G WhnVG WSVG $t PT4$VhuD$uqhz%t66hL2t$hO51ϲ 1kt$VD$VE PjV躈 D$PhvƋ|$WE PjW荈 u{D$ u?h$tt$VD$ VQE PjVE D$ 8PhƋ|$ WE PjW 1ۃD$  ˀuPh贝u_4$11F=1uR41,=811ShE} Ouh`赿1$tPp$|$t.WKD PjW? D$tP;D$|$ t&WD PjW D$ t Pd^_[]h@hhD"1D 105Db1EWhh1+u111V5X1=1u X1h/1t>hh1Br1ɀ1.)h1Ph51 jhh1$F tfjhmh1 F tN=11t1j hh1S uh51h<#S=11t11j hhª1#C thª1hɨ51' 1H1111111hݚ1Ƀu 1A1u ǀ1u 115X1^Vt$t+DH@tNFuhVtQjhHVD tDhVzt9hn Vht.hVVu'111 11^á1t P 114111=1u 1d1111t Pպ1=1t8101j=1t#1@=u1Hjh2P jh1ZWV 0jk=41tp1t1@=u1HjP51 1d1x#jPS5d1Ed141|$ j =41tD1t1@=u1HjP51芁 14111P8u  0^_Whj5D$tP55 t hcj5hj5USWVt$ \$l$|$WSUi tU> | u;HDO 1 t0 t"fO gK9uX +I +~+P+h+  + tuÅtBg t^_[]Vt$V躧t^Vhj4hh1苟t1USWV=1@1t`=41tW$tw1Phh1" j h1kV 1tJ11Pj 11tNjwt11t$h51V= |0/thhwMVg> hhVT> V 5$$P# X1L$X11$-\111\1$ t1=1PGt*1SSQPVhBu81d$$r t1$ t1=1PND$X1$1-\1h 2V/ 1V 1t2751} 1Vh'  h1^_[]USWV,=@1t8l$@11 SjhUntUhél",^_[]<$tދD$0S_,^_[]WVP5X1=1u X1|$=1tft$h艓uqj h1wS @j WP  =+LO@1 51jj(hT ru=1u=1u 11HtJ=1uA51h11HQP~ Q Pj 3 1H‰5X1^_USWV45X1=1u X1\$L=1=1!t$HhFH+j h12R t|$j.h1R th149 14$uY1519 11f u>h1hR51ԥ f120h1h51賥 1t$1 U8 VhUG D$(VUf !у $ X151jj(hR u=1u=1u 1tj=1ua51h11HQP~ Q 0Pj 9 # 1tUh51蛤 4$|$5X1=11Hƒ4^_[]t$hj2h1Q t1hj-USWV\$l$jWhW UhSE Džu&Uh(SE DžuUhBSxE Vj^_[]SWV15X1=1u X1=1h艏1u_j h1rO tL8tGx"uAHt.1Ҁ"ux"u"@1ZHt@r1Ӎ15X1=1^_[SWV$h$V6 V7hPn 1Fta\$SW謔t?|$/uH$V5 PVSt* 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh Pzvƅu 4$u1$^USWVHuI\$ $Cj j ShWuu oet zhVW- j VS{- 1]t/M I9Nt vuvvSY jjSs ƃPjSY \$fD$=1~%|$@jW=. 1O$Cuu SH VjP 1D$ PWhp D$ PWhuahl rr 81\$@jPPhSvv%dthhzS>, 6r 8ShY -D$ PWh r 8$\$=1~N1PD$P4- T$@L$H+T$+L$x@BѺMbiy1fD$ PjS3 u,q 8t|q 8#tj}udfq 8AuZku<FD$ t:D$L$ PQhhukat\$ ۋEu Y q D$ PWhrg 1He^_[]t$aRWV|$h<2Wb t.h Wb t!t$?tt$ h 1F1^_ܘthjK Vt$ Vt$ <t^VhBj% USWVHE ML$8t$QPV" DUt$F|$ 1ۅtz<$ua1tX0h 8uNWe! ƃPMVWPA 3.gz$PS ߉ޅu4$h^$%=t0=@Vh=1G51=1jV*DžND$PWJ $$PVhD$Vh!t$$t SENvB11BW%jV$=1$uXhVh5TPW 9r DŽ$.gz=1uhh W ) $D$D$P D$ T$4$=1u@D$ #D$Vh$$Vh$ t$vu hRV諪 D$ !=t D$D$pD$51hVW W |<ǍWhKW tI=1uC1u:VhH$Whh+P` jD$P|$Ww t $Vhb1PPPW$M =1$uL=1uLhh WS ƒu 1@P`D$ 1@PT$=1u:4$T$WjVVhF$Pt$ $T$ V1PPPGD$T$4$t huD$ tPut hRL$#L$1tGujjWa tV$PQL$5F tNWh_4$:u WN Vh$aWh$jWh: $l$pT$ 3T$ϋD$1 u V 4$$Qt$Pt$h4$o$WhM $1B1P 51} h&!hhĻ+衈 jw} VĻ+h&!hV聈 ` PhVm jC} UWVD$PjD x2=1t0#D$1=uT$l1hjKh<|$VWjW tt)u1)tu4h 6e^_]ÍD$t$1B1hPjVhPD$L$ $QPo =1u 1XUSWV׉ˀ=1u hٹt$1jjjSoI !ƒt7jPSz tuh>ql$h>11PUVWhXj ؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ PhgjVu L0L0D0.Vhnhl+% Wh觃 ^_[]PD$L$ $QP,=1u 1XUSWVpT$hL$lhu}h^D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RN T$ T$,:)QPt$t. t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$!1@ɽ9jD$0PŃ|$<T$1D$ D$,8@D$,O|$01PPD$(PDT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E81ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$1$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  Êt+DH@tKCu$ D$VVD$PV藖z Ǎ$$ D$ VVD$PVqT 94$ =<+1@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$1L$ QhP 111 |$ 1 $RGt1BuڋD$8L$ Qj P Ǎ$Pj t$ ^ŃuuD$ L$ }D$HPQ4xWt$ P(( $(4$hUt$P( L$l$ ȉD$<9 ɽ|$X+CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't +DQ@tVFu$$  Qσ s[ M j $( PSG{ L 8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A +CDP@t Cu;|kw+Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V E =1 hh V4 EKCDH@uٺyG=1 GKoCDH@uٺKfCDH@uٺ GQC t _DH@u' ƋD$pW @1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,1t!9}uEpVT; *mj 1xt$p@ 1>GWVZt$F1Ejhh12 Å1|$څ,5<1581h^|$t5<1581hA1 111<1t6 uGp5<1581h|Wu{߅uFu|1t@PE11P,1(^_[]R5<1581hjl5<1581hu5<1581hVQR5<1581h$P5<1581h4$P5<1581hcjjUj5<1581hlV5<1581hUP5<1581h>5<1581hI(5<1581hQ5<1581h5<1581h5<1581hjji5<1581h5<1581hA5<1581ho5<1581hn5<1581h5X5<1581hB5<1581h,$P5<1581hSh95<1581h$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u|1_NSFJ1<1tJ9ouwvS6 t?G $pS(x|$698^_[]Ë$@S5<1581hjOSWV׉HЃ s%j SVr G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ SC uC91s1؃^_[]Ë581=<1SP PWVhj`USWVP׉΋$1m~ w]$l! 1at*dt+fuC j   j j t C$1E^_[]USWVPӉ΋|$)MQ1?t@$M7Et*j @x ++>u)jH1҉P5+ +5ojnH@+8 +>u j51hl+%8 u 1PW hKyjP; PPhhĻ+b jW USWV\$|$t$ 11EtB5 1WV"q 41415 17 14181Ht8h 2pb  1 41I <1Kph4jh1+^ rf01",1 ...<1141@1 1 =81u18#uxnu 1  1W1 t,E-1@J}141R)ʉ1ɉ419‹\$k811m1 81Q81u>#u~nu 1t 11B C1ɾ8f 81@11ɋ\$u81\$t1A ^_[]É6 Qhj!USWV|L1uN P119u:=1uL1++<1T1l+X1KyH11NHQPPI6 L1=+P4 =\1tC\1Sh~ S5<1 th\15<1Ro\1=\1tMT1t=l+tPa4 VT15<1h\1\1X1=H1tH1P1 P1@P1<1=1QP rf|$18t0W5<1\1Vb W51V =<W5<1$V0 W5<1$U V U.PWVhWh\13Z 9h\1| T1޻t=l+t P2 hh\1,^ T1rH9tt$t$P T1H9tȋL$!QPX1\1=1u81<1T1l+X1Kyh 2P] L15<1hQ1L1$@1Q5L1P袐5L1hD1h@1 ƅttb@1|0 uNt$@ $@ $QV5@1P811@|^_[]5<1hj5<1hhh5<1hjhh>=\1uh&h\1z jP hg벡L1@ u:HQP~ QP1 t5L1PZ1=1t 1t SWVP1X1t^h 23[ t&Nj@HOW1 uW*0 [뾋HWPюW0 1F^_[Vt$V{Wt^Vhkj{Vt$ D$tVP=buVhwjSV^WV|$t$ WV`t^_WVhjSWVP\$|$\1t PqgD$jPSWPL\1VPSW\1^_[USWV81jh`191FD$h111JBtOz T$R uW|$+;A `1d11ыR L$y th|$ 81)щ;HT$7D$t{T$A `1d1+1. 81;H@ `1d1|$to1u1ۉ811;A811;AT$t1~T$ 1=11ۉ__ WjWSQPʣ|$t4JT$B8 81;H`1T$1511~>~ VjVWQPC1FT$11=11ۉ__ WjWSQPT$t tCsBtt$u 81;Hr1xt$t811BtȉÅQJA7$$!=h15d1$=`1FPj W} @) d1QPW 1Ҿ5=1 1R҉Y = 581hu5T1U u 1Pjh2`1S1P5151)1Pjh21S1P5d15`1S%1Pjh2`1S1PS =h1 T$`1=d1GPj S1 ƅ l1D$4)أd1l1 5x1|19a1j5151h`1j5d15`1h1 4 5T1rM T$`1d1D$<=T1l+=+11 |$@L$ɿ1D$@PL$ QSD$,PstǃrT$ 1 |$@1GT$ uGF;5+r5T1jjh 5T1j$Od5T1j ?d1-RuL$ tKQvD$ ;+r5T1jjhY 15T1WjSE t$ tsQIstejPh!: tQF;+r5T1jjh 1!)Ph5T1R Z;+r5T1jjh 1t$ D$13Ph5T1R F9ut$ t$L$)4+F9r5T1jjh6 5T1j$b5T1j bT1@ @9  ֡1 h1u55T15d1j5`1 =l1t5T1j ^bn jh`1Y h15 =h1( 5T15d1j5`1f =l1t5T1j a볋5x1|191+`1T$JQ1T$ut Q;P d1T$I1D=h1yBu%hh rf F 5d15`1P ;d1 jh2r  _ T$=1ujjhrh1 h1D$0d1D$,`1D$(l1p1t1`11l1L$(t$, 151L$0 1111=h1_ d1QZ=<+9`1 @ `1 d19r 1֍|1@PQ15x1 =l1t5T1j Wj< A81R5<1Phr q Bp hj5X1 8t QAkPVh7GSWV\$t$|$G 0A;OvGPwGD$u G1OVPQ ww0^_[USWV =x111E1 tui5T1tjt Oh 2tnF t:Ph jSC t5T1PUS Vh UV G;=x1vT1@ @u1x11 ^_[]Ë5X1c 8tT QiPVh7j1txt@ x{t1ɋjjhrh1^WV|$t$ 9tfF{t.wt8suOFHtQju>F@+6vFt P:uF6^_ËFp vhjNUSWV ՉL$11щT$Љ$ +1E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B 19r7 1P51111$10D$SPt$V it}ŋ4$L$]\4$L$t&uE\19r+1P51ƣ1151F1C4$11\$D$ 19ȋ$r+ 1Q51;111 ^_[]USWV`}$111D$hu W uu5U6>ut0GtgU6;uU6$8u +ȉL$91t*V<t@T$?D$D$t Vlj|$\$ |$t?1h/ SuIt+8ttDGhjJ1E L$3Rthpu3hj:tD$PW{uhۃ|$ tt$uh뼅tt$`uh.렋Cu/hw1stjh#VVVeSP!TQVh& 9 PhKhĻ+@ j5 UVQ6t@t $e^]Vh8jWVP։A 1ɉQPW蓲 V?t$8t 1H^_ 8"u #Ft1fUSWV $} 7wg6 1$A AAQj;t jةi ]17;D$D$D$ D$hWS H3$!t 5U6rQPA1묃|$5U6,D$덅t5U6!QPEL$PQ<J=h5U6PP@+|$55U6,D$ 11+|$ 5U6+D$ o bP{ U6$d`$?IPt$9D$ !D$rrD$ t‹D$L$tD$+tt )Í<1ɉT$ tpulhqK=1tZtw7jG1KiƋD$@ @0ߨu $!jt$WS C&7Nt$|"O$$F Vm:ÅD$PF1Kt$P:rVW98ƃP@F=1xt$PAXFt,t t@0hIVM7VG:Vjv F|$7LwL6cLvVLGF G FGu FL$AV6D$PzEyP9t$S7ǃP?|$G=1P@hݹjjWS 6L$h+L$hCt$whV7! >D$wFLt$|"O $$F V8Åm$ 1KSv h+*PF@$Vt$ .hr7h8 L$hFu t$Fuj<Fv P"=hG7hVhzh j$ P h"P/lj\$w jhhV^ uEb 1ɉ_QD$PS蟸 D$D$9t 9 8t#VhmF\$SDžu6L$1Fʋ\$r 򉔄S1{|$uj;G\W5w w;=1w<Å|$W?3t$hB=1tvq<Åt$V6t t$ Vt$h%EhnS2t$hhmt$h%QEy|$GD$Wjw d Gj:vwJCSt$4W\5tt$ WEAhD1K؍e^_[]hDKh h)hjhhDhDj裿hh\WVp ƿĻ+PhUW5 VhW5 VhW5 VhW5 Vh[W5 VhwW5 VhW5 VhW5 VhWu5 VhWf5 j<* SWVP։/ j PWn w  8u9<$t1 1H^_[USWV)$)uy$)$h)jhPj34trƍ$PhF8V tF$ $t63haBVx$)unhLBNVϜ$%shV7 t)Ńu@$hUV VP!Vhz\B1NĨ)^_[]sd>1Nt$)P0P1t Wk/Wh2t5D$+t7Gt01A0wr@0uhAL$D$ $K$;|$l$Gt PmFKWD$ Pw G/ $$WUh GH$ !1PPh $Vt$qtPVD$P |$d!`!h St$)=$ =T"=T=8  =Tu&=T= 8=TuoE1ۃ}Et)t8W2EbPM /WEbjWEbjP> WPD1ۅVDuD}|$m0< 1PPh $Pt$Ɲ$1=U1PPh $Pt$芝1Kl$4j\PUr D$EFI 1ȋL$PART1 uD|$u:|$ \u3D$$1T13 h!@\u|$r1Ch0 hhj1K 4$VsD$ tL1Fl$xXuH tPQP P<!މuӃ|$|$t|$l$h=D$ $) $n1AL$$$R10h芮 hJ=#D$ t @@W*4$聗1hrM=}|$ $ h/=W*4$@h=USWV$ $hjS u ut1O$h)jhSjuq.ƃu! 8Suhr =1u7=1tSuh9+ 1=1uVb^_[]USWV9th 2W. t}Ɖ|$|$D$ jh9WPVw1t{8t.QP=jjPt$ T$4u=4$S=jh9WD$PVNwu1*Whh1Mt$t$h=\; ^_[]USWV$ $؃1Our$$phU t#ƃu,hVWf WUhz:$@VhmPV lj^_[]hhhh_ $PhF$Q5 1uhO1H$SWV։σ=1rhVWhd) 1KtYtU=1u hWV葿 1.h)jhVjW+uVWh9 ^_[USWV։ $=1rt$,Vt$h( D$,D$ 1D$F L$,˅t[P=NjF(D$1t;F$;u/n(sq>9usI=PW [ \$H$$!j $jv=pjSA $jSNWv<h 2P^SP@Wdt $SŃ~ jjHËF$v ;Ck1C tK H1C1C~ F$~,t$ D$U=D$U=ŃW<D$W|$<Pt$Ut$t$Wu`t$,W<W]6tjD$0t CD$t PU=ŋv0Ik&Phh;7W5Ph5"7D$t P;1^_[]hKPhdjNh<jUSWV,1ND$@ ϋl$D1t$t$t$ D$u:D$u:D$u;D$$E D$ ED$(951t}up:$|$} ]uX:PSW|$t$ ha% =1r9h]K% =1r#uhl+>=1r j ?$ =1u,D$PhF$W uF 0h誦,^_[]USWV+rt$PQhhWE# ŋFD$ FD$F D$U $v`:v[:1ۍL$vjSShQPWt$ Ut$,t$4t$F(1t 119tF F$t G=u1HP 1Ʌ1ɉN< ^_[WVt$ f1t3 19tct,1= 1z(1_P WVL$ 1tr0:u >9P^_USWV|$,1QrI$!x @0uԅ\$jS{cD$PUS3^ D$uv4$ G G$G(jhVG,4$o0uh hh~1N^_[]hTyPhWWV|$ 1tgQrIwR$!x t2@0u׃?tw, jhG,0uR1N^_úSWV\$j4e11INNN NFFFF F$N(F,F0S Ph uWhR uWh! uWh4 uWh~ uWh3w uWh>_ uS >uWhH^_[Vt$t$ PVF^Vt$j471ɉ1JPPP PHHH H$P(H,H0p^Vt$j41ɉ1JPP PHHHH H$P(H,H0p^Vt$j41ɉ1JPP PHHHH H$P(H,H0p^Vt$j41ɉ1JPPPHHHH H$P(H,H0p ^Vt$j4G1ɉ1JPPP HHHH H$P(H,H0p^Vt$j4 1ɉ1JPPP PHHH H$P(H,H0p^Vt$j41ɉ1JPPP PHHH H$P(H,H0p^USWV\$l$|$j411INNN NFFFF F$N(F,F0WPhp t~$uWhF$F(n ^,^_[]WVt$ ƅttFtmxu@NH0xtJj41IHHH H1҉PPPP P$H(P,FNyxQH0FF^_SWV$h 2WƅtVIVh F?/t1WhhehSTh 2SƉ߅uWhPt1^_[USWV\$Xt$|$1EVjjh跡 Hw$!Vjj hVUjh#HVjj hz sh8j Vjj hVUjh3< shlPhHVUj h shsh.s hssh _1shW3 SVUjh臠 [01^_[]USWV|$(D$,ՉPD$PD$ P_ $|$$~D$$XVj KWhqYV W% <$~i|$$ /,EЃD$1ۉ3|/Vjjh輟 ~|$Vj GOD$ VP-CG;$uVjjht t$^_[]SWVP\$t>D$t5։ωPhQ$ t"4$SH4$Q^_[jj{USWV\$C t[{$wU։ParPUVhWC$4!UVhW1s,hV( ^_[]SWVt$\$3PhWV{sPhkWV`11s hu1shn CHs*4!hhVVjs PhS1O^_[USWV΋l$\$~GVj ZOUShV^_[]Vt$ l+t>thVtPt$ ^Vho1HUSWV D$$t$ N1Št< t< u t tEAuP$V|$D$hWtE1Phƛ thWTÅuS3 $F1 1$t$D$$( ^_[]SWVt$~|$14C9u^_[SVD$tL$T$ 1102F9u^[j+1ɉHSWV|$\$jƉXCSvWP N^_[SWVD$8XjƉXCSvWP} N^_[ËD$t0WVt$|$ 77^_SWV|$\$jXƋCOV@P>s3P Cw7P N^_[SWV|$\$SWWQSH^_[SWV\$S jljpFVwSPs O^_[ËD$WV|$ j}WhrP F>t^_jjwD$t$jp0/ SWV|$\$j)ƉSFQWPР ^_[SWVD$8XjƉ8WFQSP苠 ^_[ËD$tpWVt$|$ 77^_ËD$@ËD$SWVT$t$1; u'1@rvR1>::uG9u1^_[USWVP\$|$j$ 9wȋ4$Pj<FL$ T$9rуr\|$O\$S2 9rȃr61@ $It$V|$o\2@9rу9r͋$^_[]SWV|$\$SW0WS^_[USWV|$_S5SP7g t ˍ 9v:PShd hU7hFV 1AjljSGQUPq V^_[]WV|$ W<W^_USWVPD$18G$PHÍ,?U7T$ ɉ KWrQ UWt$S|t?jƉhEUvWP譝 NSW WS^_[]WV|$ W.W^_SWV|$\$jxƉSeFWjQPMt V1^_[WVh 2t$tt$PV& 1^_ËD$|$FtzPQWV|$ t$\Wjp0評 V^_fUSWVPL$9A1@T$0D$D$1VVPRSQv tD$0D$|$D$t$ t$D$HVVPD$PSD$,Pv tND$0Pj h T$t$ T$t6|$0L$49׉‰ˁ uΉ|$D$uD$(} WjD$4P W\$(S{ jhVt$a Ƹ9whĻ+jj"hA D$Pj$jj1PPut$2: G9uIs1^_[jt$t$t$jt$t$t$jt$t$t$jt$ejt$Vjt$Gjt$ t$ 4 jt$ t$ ! jt$ t$  ËD$H##w!ø"USWV|$(l$$\$ t$D$04!r D$VS$UWt$,jt$4$^_[]fffffD$hPt$ ht$ t$ 角 WV1L$T$ 4|141|@=u^_VD$d$t$ ¹t0u,L$I+3CHD$Lك3CTD$kA3CPD$H[3C\D$8y!~$3CXD$xыD$DBD$dR$q A D$TAD$hA,D$A(D$@AD$4AD$lA4D$A0D$XAD$tAD$pA؃ ^_[]USWVP$׀1 v^_[]111w4rي\9G߀Ѐ rڀ0uu$0USWVT$L$ D$|$$1$7FҽZ)!¸!!Սкz)҉!Ǹ!! ꍾ׸9)Ѝn!!!?G׃>?EՃ? ʼnЁF!! 9tJAދ$$%D$T$;sM $ $BT$L$ AL$ 1 $w1J҅u D$L$^_[]1USWV$jt$Ht$@t$<l$8fE$NWpU )E@PWU v E$v=|$D$@p8hXWF W"U )|ǃ@PD$ PSu \$m=l$@u,hX|$WF WT )'ǃ@PD$ PS`u  ,t=u(hX|$WGF W~T )ǃ@PD$ PSu ,p=u0hX|$WE W/T )ǃ@PD$ PSt rof$${Nuu_1Ƀt)΃t $|t6\$@r-f$GNs3 t 1$^_[]USWVՉ΋\$(< R)ȃtu9sutl\$<$L$$11L$  L$ ωÍK?FwL$ ACL$uƒ<$t(ًD$?hF1O^_[]ËL$R)уtuWVt$ 1A r̉Acw^_USWV!؍qA!1؍QG!!!!!߉5?@Ѓ+ ?Aу/ ^_[]ÐUSWV ]Lu C t41Ƀ>F<rF1҉$1ɋ]F$1ҍ$RPy|$1PWi1ɉOډFGO $OG]C OGCO$1ɉG C O,G(б1ɍu F$1ҋC9|ljL$Kvt$$D$ $1$֍A ƋD$ Ɖt$|$ D$ |$1u7HD$D$4$tLu=D$HT$L$T$1P$ WY$1PWD D$ L$@1s} ?ŋGƄu֋ $O 11Rt$WS%s  T$ 4{u T$ T$ у?tjjV$B;SsD$KD$ |$e^_[]ÊF1҄҉$Z4PT$B0R4$ȍ$D$1PW-$$1PWL$USWV΍$RWVW$WV$t$V1Ax$l0l$ t,t$ $D Ƌ<$\<!!͋L$ ډT$$tp1֋$\l1\$$DL‰T$$TPډщ!t$(1@!\$΋T$ 1D$ 1؉‰D$ L$ l$ɸ!1@!L$ L$hT$T$D|$1׋D$(1ȉT$Hlj߉|$։۸!ÉL$(1@!\$\$xT$T1ՋD$ 1؉L$XD$ $D $| 4Ƌ $T 8T$ $\ Ӊ!1A!ډT$$tx1֋$\t1ˉ\$$DT‰T$$TXډT$!t$1@!\$T$D$ 1Љ։1ډЉT$ ȉD$l$ɸ!1@!L$L$pT$T$t|$1׋D$1ȉT$Llj߉|$։۸!ÉL$1@!\$\$|$1ՋD$ 1؉L$0D$ $D $t <Nj $T @T$$ $\ Ӊ!1A!͉t$ډT$$1֋$\|1ˉ\$$D\‰T$$T`ډT$<!t$lj1@!|$\$1ry h1 1^_[hj*WVt$$hx10@ t6hx1hPWVb hx10h=P0hp1n0@ t6hp1h\WV~b lhp1@0h=Pn0h1%0@ t@|1h|1hSW V+b  h1/h=P0h1/@ t@1h1hSW Va h1/h=P/h1/@ t@1h1hSW Va h1G/h=Pu/h 1,/@ t6h 1h]WVXr]!,!1s L;31A)T;3C6$!`3f L;3 fH4;3yy14;3uF(x3t |319tF F$t G=u1HP; 1Ʌ1ɉN;Y ^_[WVt$ \x3t3 |39t\t,3=3z3P1x3|333p3t3d3h31.USWV0$Dh3t @ th3h W@W= ,h3F @ uPh33 @ u=h3 @ u*h3 @ uh3 @ D$0Ph%WAW= h3 @ t D$03h3 @ t D$43h3 @ t D$83h3t @ t D$<3h3X @ 53vD$@@Pv\$P1rt3sssPh j0Wv WVEE;l$@|‰53$D]h3 h3 h3 h3 h3 hr 3Fh3Y @ u=h3F @ u*h33 @ uh3 @ D$0Ph'W@W,; h3@ t D$03h3@ t D$43h3@ t D$83h3@ t D$<3h3~@ u*h3k@ uh3X@ D$D$0$h321@ tD$D$01Fh3 @ t D0Ft$h3@ tFD$D0Ph*WW9 x'D$t1ɋT0w !t42A9u`h3@ t h3h3l@ t h3h3L@ t h3d0^_[]h  hw h jUSWV$(h3@ t=3L$Qh!WW8 ch3h=Ph3@ t=3L$Qh#WW8 h3qh=Ph3V@ uPh3C@ u=h30@ u*h3@ uh3 @ ~t$Vh%WAW8 ^h3@ t 3D$h3@ t 3D$h3@ t 3D$h3@ t 3D$ h3h@ 3;t$41҉t$T$ jUSl F<$?,u|GjUWT L$A4$>,u^FjUV6 L$A$8,u@@jUP L$$C<:tuT$ B tg D$ ɋ$(t$t53h j1D$$Vh$WW6 h3[@ th3Hh=Pvh3-@ th3h=PHh3@ th3h=Ph3@ th3h=Ph3@ th3h=Ph3u@ u=h3b@ u*h3O@ uh3<@ Zt$Vh'W@WH5 h3 @ t 3D$h3@ t 3D$h3@ t 3D$h3@ t 3D$ Vh(WW4 h3@ th3ph=Ph3U@ th3Bh=Pph3'@ th3h=PBh3@ th3h=Ph3@ u*h3@ uh3@  D$D$$h31@ tD$3D$D$1Fh3N@ tD3DFt$h3%@ tD3NL$DPh+WW3 y`h3@ t h3h3@ t h3h3@ t h3^_[]h !h h h6  h h jfD$L$ 33SWV|$3~53W6; tKuWhj^_[Ë 3~T$39PtIuhJ jot$H USWV $ $ tP6h5T4m F====%r1Vˉ!us9!t!uQh jh3Uk3!PWh5Tl / sH$!Fh9l!uF9!tluPh jh3j3QFVptLh&  uThkEH $!F0h  !Phkj jV j jĔ ^_[]ËF9!u>F9!uF@9!uPh jh3i3v>c1nD=u4D=u(D=uD=uD=j iWh  jD=tPUPhjDP9PhojLDf9uf;Luf;LtdPPh;jDf9Du Lf;Lt5PPP jDPPPiG ;>0F0h4F011C؅ttrWQhC i 1G uF0hrp!!!!PhFiF#011G!tB9EPth *EPth EPth EPth EPt>h ړ/hk ^EPt ht ^j ]ES kd(PQh ^ EQMRQPh n^ ETPh \^ETyh HET@th 4ET th  ET$4!ETthp ETth^ ޒETt hG ʒh- 轒ExPh ]EzPh ]E|Ph ]E~Ph u]Ph `]Ph K]Ph! 6]Ph1 !]}Xh E`MbQPhA \ E\M^QPh[ \ EdPhr \}htZElPh \EnPh \EpPh \EtPh |\ErPh j\h: ]1iOwG$oșOЙPVt$h \wwwwwwwh [ rrtM@ rt rtM@ t QVUPh [C,l$;6t>iqyYЙI ЙPVWh 6[EUPh! $[ ^_[]USWVTt$hVt1H|$lVF @@O$ @GGF fGD) 98} TءU68B؋D$8Z,#(5 (5U6X*|$W5U6N-X5} 8yeU6D$#(5 7 )5#(5 D$#(5 (5D$j P5U6 U6K9BT$:505I1L$xA AAL$hAAA :h45QP5U6=*=45wwh85 GT5W} ) )5@T (51Whl+8=+=+} 6U6D$ )5 Ck *5_ (5U6t +xDQGu\$$$$R$R$R$R$R$R$R$R$R$R$R$R$R$R$RQhPvHH=w$)11Ҋ83B9u9~(5u7hI~183Ph_IC9uj H\$$} # *5  *5 (5@ (5%*5D$P5U6 *U68L$9v\$$D$$ 9|$D$ fD$ l$ |$Pl$D$PL$T ++L$LD$Hl$H |$ T$ fT$l$\$4l$ T$46 uh $Y6 (5@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f ,5@xEh( jQh  Rh h Qh Qh P +)΃\$$(5j.S u S )1?$QSP Ƅ<t- +CҀ|Qy +LQH +@u܍$1RjD$#jPWk VSWk D$8WPs|$XWh) j蕁 D$8D$dh$VWj輆Vi" 1Ah TQh( Z5U6hN H5U6hM6P$Ph "" 1Ah Q5U6h~ 5U6h? hh' 1FVUlPhZ Vf1uS á(5t=+ hl  V1t$hFFFFFFF :h45VPS#u&=45GtÉh5Guh -P"PhwPhl5 w ww 5y he j)5@t5T5h85P L$)5tG$jVj'j)55jVj(j)55PP(5ШhQ )$PVjQ"ud$xt)5th eT$ppj0j)55uc$!h P{!PVh  u2=+5r-0*h }h s5+0 WBD$u hp Bu r03@9ug 5155g 5g 5DŽ$(5@t$jPjh55D$8@=t5u2D$8jPj j)55uh h4 |$u.D$8jPj+j)55au>h P1|$L$8jQj*j)55-u h (5rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:55a y h Q)5t+DŽ$j$Pj&j)55# uK1ۃ|$$+D$,tD$t3S?5uh h ƣ33|$$tF1FFFFF  F)F.N,339rF t$ƃ|$t.t$uL$Aut$h) ++D$,|$,tF)F/+F )5@;DŽ$jjj y hD 95t5@5x5D5|5H55L5f:5'u5P5|$tjt$ j.j)V =+ujh85Vũ yPh UPh+Pj)V@ uY=+tjh+j j)V th $Ph85Vo yh hO hl VPD$ + | h  O$jPhh55 t$8jVj$j)55b y h!! 衿jVj%j)55< y h>! {(5H H r8r +0 s~|9~ h  Nt$jVhh55 y h jVhh55x h ! d8+PQh\! < (5Ѓ1۹5PSSQVRh85 5tzQhw! <(5ЃPSSPVPhl5 tzVMqt$0tWNuڇVj Vj 155L$?V1FhĻ+Vhh)) O V63USWVX 055t91ɉ ,3 (31GH 5 55f (5 r+rm ]1sq)3,3Y)3,3t583x5<3|5@35D3 )3,3 t1(3 5503 43f03+Uf(3 5ff ,3f.3=5u"t$@jVȣ03Fȣ43+3l531L$@A A(3Y 3 3Ph355e ƅx9t&y h( 躻VS5h5h( 9(5uWh+W虢 55555555 u2ء555555 P؉+555D$8t$&h$  h% h% !&|$ FPhM%  &6Phn$ %|$ "hO* h**  hhCZL$$ 'j.$Pt$ j!fF$Q4 "hY& Tht& t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"P蕺 $@D$@|$ Phrh5T$ t$ 9|$oh' h& $D$$$T$ $@WjWh3 Pk$Ft hN$ X$t+H t+~l+H l+ hl+j *)L$|$$t1 q΃j.PL$QjKduj.hz$P $Ph#|$u"tVhe$ # hY$ r#t+H t+~l+H l+ hl+j .)t$GNjL$+{h) Xih`#)5t$Nh"Ntu#  P"1L$1΄u j,!D$H# x# # sVQw"D$9D$t$uKj,!h# R"D$4L$:D$tHj,V!D$4WPh#  " $D$4D$ uj,'!h# !t+H t+;+hl+j)'nl+H l+)h& h`!(5؋ t+Qt+~ l+Ql+ hl+j Q'(5z|$h ot$dc~)/F1#ty1h' n2td3h'  ^ F N t$~WRQPh[(  \$Sƅx*Vh(  'h'  N h(  D$@Ph( n ~`1St$t:j.$WPj`uj.hzW~ WSh(   Sh(  C9u\$,t$ |$d|$h19wƉ΅hl+ (M5T$p1Ʌu9QV&jV {VPĉj 5h5h! W55h! D55h! 15tPh! 5tI 59~hF0D$D$L$d$  \$$i t+H t+~l+H l+ hl+j $55tz5$$5|-5+5$\$\$\$ \$$" $hl+ hl+ USWV $$919gՉ $t$ $;8t$hh$,袴 =&GШu+$ ؃?9?)9K9si +LA sPQhV=hV$, =GC~ 9r9$$ul&hh$,V迳 =wDG$8:$ t-؍L$VSthV$,q 1 ^_[]USWVP։1|$4$u9|.HPhJ$ 4%wS$ "W )1@1sC9uÅu.Ph t$߉E1 `^_[]USWV4)ȃ'h& :։ϋ ˉ h* bPˉ $Wf_oUSRQt$PhZ' #Gl$j.UPj[uj.hzUJ Uh|' Gj.UPj[[uj.hzU _UO()|c؉<+<'ueh& 0<9#<,uth& '<+ugh&  <(  D$PD$PUWSVǃk^_[]fUSWVt$VN  6@P66t` +V^:uF^t=FDi@u\uDy@t~Fu:u VuN@քu1.6t P'16 6V 1H^_[]USWVT$t$L$~1tQA:u>8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"56t$PV;hD$$HL$L$ 1x1PPPWn jh@P躀 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$# ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$ 6D$PVP L$@D$D$ 1 G|$<$D$=+$TD$j=h |$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPٕ SVUΕ |$|$t$ "+Hj=h P Ņt$,] 04$Q" 0D$$"߈FHGNm&Þw$$":܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4 "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f= 6u t11jNt$6186 6t P1@h 2h* K  61USWV1=86MT$ l$(L$DžD$5 6hh96  |$t$j h96M D$96hV$6tUP uTWV(6WVt7j L$QP+ x#L$9u,6;D$ D$uL$us 68 6APQ~ PQ 6 tuQhh96  |$u861^_[]06<6<61Ҋ+~,u"1t$L$t' t" t΅tAL$=X 6uX 6 t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=46u#86 6tP 6t $61^86 6tPK 6VtJT$1Aj<ƃ=46u#86 6tP 6t $61^t 46t D$461@1USWV D$,L$(l$$~ )$1H$`t 461A\$9|ωL$ tgp9tX tt$ P t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$86 6tP 6D$,L$$ ^_[]f11f11Ã=\ 6u /t(` 611hh 6PjNt` 61 6\ 6t P91@h 2h* \ 61USWVT$1= 6+\$0L$ D$D$|$(D$5\ 6t$8SY l$,D$ D$D$t$j S蒳 \$1 hV E|$tt$(P6 u~WVEWVt^j L$QPb xJL$9uAE;D$ D$<u/hVtj L$QP! x L$9t[ \ 68 \ 6APQ~ PQ$ \ 6 tuQt$8S& E hVEthV whV ahV EHhV E /hV E$j:t$ ܱ 1@|$ u 61^_[]WV=\ 6u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh 6h` 6t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ= 6u+ 6\ 6tPL$L$\ 6D$$tˉ01C؃^_[ 6\ 6tP\ 6PPhh 6h` 6t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ= 6u+ 6\ 6tPL$AL$\ 6D$$tˉ01C؃^_[t  6t D$ 61@1fUSWV\$l$t$VΖ PVWi U赖 PUWi S衖 PSWi t$ V艖 PVWi ^_[]WV t$uRt>DžtA= 6t ^_Épxj PhMl ؀= 6u1F1= 6t 1맋5+? rQQh* Pփ( USWV1ۀ= 6t ؁^_[]q D$ |$GSSPh 6jW u  6[{ 6 6r1H 6r1ۃt2u3hWh+ Ci D5 6~ȍQ2w$8" 6PAu  6?$D$-+ h?L$Qh+ PՃ 6+@ 6ħ+ 6I9@ȧ+ 6I9@ 6 6 6 6 6y 6p 6g+ 6A9~WH+O 6Fħ+|t%ƍC!t2)É$)t*$6L$ $6$)PD$p xPh 6= 6= 6WjD$hpj PhMc 5+n rQQh* 5+U rQQh2+ Pփ> 111{PZDWhV ESWV 1L$ |$ ru\95 6s(>tGǀ= 6u.;=6rN;=6rD 6 DžtVjW& = 6t^ 1ހ= 6t& ^_[À= 6u1Ffu]pxj PhMa 뺋5+ rQQhg+ Pփ NUSWV|$4t$0Ë 69s& 69 8Ս1ʅ/ 699;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu956956H_ŋ 6!9r؅ 69s9s_ 6 8!9t.M9wI9rE 68! ħ+!9u!= 6= 6 6Rf ʼn9rPVUb  8!!ōD$p 6PVL$荛D$PVt$8蛟 6Pt$jUV^thŋ$L$Ai Qh 6蠜= 6= 6u= 6 1= 6tM^_[]t$h 6DO= 61GDu3t몍D$0xhj PhMf^ 5+ rQQh+ Pփ 9U7)SjZP)MPjS+ :9/ $)QjZP)PjS tƉ111USWVˡ 6!9ta)‹ 6h t u9=,$)<l u= 6OE$)ÍFu\wl"xD$X 6PWUPWi= 6N V$65$6w((" w"1É;GsG1B TGHO;Mu9}tAtDEWP˜5u%E9tt9sMxt MPQ}-E $ut= 6tGV^_[]ÃWU蜙 VjZS vjZv VjZS V t$= 6tt ^É01ɉHHj PhM[ ҋL$SWVȋ 6!9t+)֋ 6| u 9t%)D @A Qh 6m@D^_[USWV= 6t^_[]þrVVVh, +Vh2hNh9, +B= 6uBp = 6u 7= 6u RQPhE, +u = 6u^, = 6u3 = 6uLa, = 6uVRQP++$ 6|$gfff̉ҍ4މ劄1wuGO wһr2SUWhd, T$t$|$f4SUWhk, ++$ 6Ggfff̉ҍ<߉劄9wuFN whrh2Vhz, T$+$ 6|$gfff̉ҍ4މ劄1wuGO whrh2Wh, T$+$ 6|$gfff̉ҍ4މ劄1wuGO wҸrPPWh, T$+$ +|$gfff̉ҍ4މ劄1wuGO wҾrVh Wh, T$VVVh, +USWV΃= 6tPt  63!1Pǡ 6 6!)ȉ9r1U 69tEuótP- 6!1PPjhjUPI t((6t,6=(6=,6-061ۉ^_[]V΃?,6 ; 06v$1u,6Ɖ ,6^USWVP 6 6 6 0trƃh"PF,= 6= 64$t|n011FEEh$"P迒ـEEC 6(9r:5+ rQQh, Pփ= 6 611 69s[ $,0EEh$"P1s+ 6C 6]ǡ 6 6(9r 69$sj,Ѓ0EEh$"Pȑ 6 6s 6)ÉE;ǡ 6 6 6(9r$^_[] L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ 6D$ 6D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9 6s$5 6!։Ņ9 6v6J Љ  ȉ  F1r{@p9 6sBJ Љ  ȉ  F 6 6 ȧ+u%1I#5 6!֡ 6 ħ+HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t= 6t= 6uVj1^_[]VhU3 USWV5 61!-$6t E$61-,6E@;06v@uW-,6E@,6tE3t,ÉE uUh 6#= 6t"= 6t!$6E-$6^_[]VhVjSt USWVΊ 6T$ T$FD$t$V$D$9Btr$u$… 6ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S֏~VS SD$x,t @,KZ 6tjNjD$G G 6 6)ʉWOT1Nt TtWt$蓌- 6T$ 6^_[]1USWVȋ5 6!) 6L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ 694$1PPh6耑 Åk jS6Wb SWv$6$6;-6r ;-61WWjhj\$SUZ? t\tV9tRSP> uE覾 j@\$S08z -+ h2Sh, PՃ= 61lj1 64$9v( 6 1QQjPjVQ> @wg1= 6j)ŋ5 6!Ɖ)tP 69tut݉<$/6u1]4$D$x Ph6UtA<$6C 9r09$v+jSVϏ SV$6$6uɉD^_[]޹ V 6 6r!1F<u. 6 6F9r^USWVP $1N= 61!׉) 6D$)ot +t= 6; 6v|u+HL)͉ll+; 6s| ullD +lD;G,$vuWVDGWV;_s_u.G WP賋= 6u.M,t  6-},^_[]jPR!y 5 6^_[]USWV@׉9 6956j;6u >9uP;6FjWVx *1ۡ$6t  $68,6H@; 06v@j,6H@ ,6 3H 6HPh6؇ 69rWV; u= j@S0v -+x h2Sh, PՃ= 69= 6u]$6t  $66,6H@; 06v@u,,6H@ ,6t= 6p xPh6@^_[]9 6u) 66Ҷ f̧+ø̧+ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á<+}D$t$PTWVL$T$ ‹q~y ;q~ t 1~9 QP ^_D$ +DAD$ +DAD$ +DA%D$ +DAD$ +DAD$ +DAD$ +DAD$ +DA%D$ +DA D$ +DA@D$ +DA%D$ +DA%D$ +DA@WV1F|$ 4("W2 tF u1^_ËD$t w$,"1ËL$1t9t1ҍB|uËL$1t# t|$t+LH1H rËD$t +DA$H1ËL$tT$At9ut1VD$t$tPt$VU ^D$ +DAD$ +DAWVD$ rrtƀ>tP 0PWVh hĻ+^_Ð1|$w L$t9tø+f|$3HtrfSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$D- 9 t#v+fL$Y- 9 "v+føÃD$L$L$ L$D$Vt$ t$VhĻ+ h8iV^t" 0kPh2hĻ+ Ļ+Vj hV ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP% t 0  1$^ÐWV|$ W4h"ؤ tFu1 ^_D$ftL$Q"1USWV$п$$ u Vk  X)jL) ŁTUUrP$@@D$0jPD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#[*4$(111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$46L$L$ tU{|$$1Ĥ^_[]USWVt$~X>3܃ V$" j F H @(N]_?[\;^r~uFF4646C><% ^q{t|~F~F ;^r~uF46FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF46F^9րրw t$rI{i9s <$=+]D_\,<$t~uF F4646Au~uF 46F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A+IDJt"m9~~uF 46NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF 46F"{u@9s +DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup +DAu f'tf`uW~F=@9t8}@u~uF ~uF 46FЉL<$USWV t$ ^h.\u/;nr~uFF4646EMŁ'$~]$"|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF46FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF46FωωD$$xt~uF 46.n~EFx +DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2+ DJt"r 9~~uF 46N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF 46FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF46F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj+TXL$21@u"+TXL$1t$1ɅtT$T$1=<+E9Efl$0|$L$=щE pX D$ t8(;|$w,7"1T$39u!E HD$8u46F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 +LAtx +u+f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ; F^_[USWV1y19sC11-+D]t#=k)CB9u1Bt=|yuA 46Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$<")@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F46FUSWV\$1=<+9v1@(ϋF,@jPv(} t|F(N,QV,fH~<t}+Dh <+1҃9v1B <++Dh1҃9v)1BuG 46G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF464656^_Ã~uF46NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF46F1^_[]É؉D$}- p"t$t$U> u UI t/uՃt~uFG롋$USWV 1=<+9v413A8 $A,tI +L$ +L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS"uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQi o^_[]SWV1G9Qs7ӉjRqz tF^~uF 46F1^_[USWVP1N׉$1+t{`tswsK$"@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=<+|$ r3GtD$WT$ou]t$SF |$Qo ]GtD$wt$wt$wSyF |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4V L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ ] ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf +>|$u l$`\$\z +D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" +T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA +D$¿!DQf_֋D$ !DAf|$$_8tV|$u+L$ DHuf|$$_u3|$u+T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$#"$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$41 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ :| ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf +>|$u l$`\$\z +D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" +T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA +D$¿!DQf_֋D$ !DAf|$$_8tV|$u+L$ DHuf|$$_u3|$u+T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V}@wj/V= 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh/ jPh@6f@6ø' Vt$1Ʌ1t э^fUSWV$[8D$1dD$V׃1diՉƃut" $4,rƃu$UVjj|$09NjL$4sD$D$8T$<UVt$Dt$DL$D|$ t$ 1Ҹ$|$(RPQt$Y|$@tjjdUVD$>ƉRPUt$ +D$ T$D$L$ |$֋$)URt$T$2WQPt$HD$HPeb$eRPQt$8WMb^_[]SWV[$$u^Jw $hPV u=uk+ WhPV hPQ thPQ| hPQe ehPQD shPQ- 5hPQ  hPQ hPQ hPQ hPQ hPQ| t.hPQ\ hPQE PĄ^_[USWV[XD$$L$ ttD$D$D$UPjlǾUD$PjDžID$8t۱|$;D$ T$$75PW- EPW- PW- PWv- tPWb- |$D$ tHPW)- PW- PW, i PW, tPW, |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [Å$ @$ $ ,19r 胼$ t+$ $$ FhPW) $D$ D$jD$$ xfD$4D$dz7 /$$ AfAfInqQPRhWY Bt$ VPj $D$ $PY1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ V)7hPW j:W D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVP(t Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃKD$ $t1L$ L9s ዄ$ @<CLL$|It$tjhQPR*D$4  BqPh$PV$$9s|$$$9s$$[1 $L9s D$HL$H P 'RQt$ Ph$PU$$9sD$4 BqPh$P}U${$_9sD$hI$/9s狄$ @ BPQh$PT$$9s獃t$Ph$PT$$ o9sD$ tW BQPh$P2T$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ "$$$9sD$dL$HL$PL$pRt$t$t$$h$PRD$L$HL$HL$HL$,HL$(HL$$H @ 2T$0PQt$,t$4t$ 9u8jjLx5$ t Po1 4* 0ǃ LxWǃLxƃ t* 01^_[ÐUSWV[U$01 uut!j/VXuS tƅu( ƍ|$VPQhWZL=r) ?h@V裷ǍD$ jPWC ) D$$WJtLD, L$Pjhjjj QD$(P Ƌ<$t'Vu D$8 t_) 8 Q) L$^_[]ÐSWV[ uDPH6ƃ $tj/VuAb' Ɖ獃VPQhWK=r( ?Lxt" VPr tEFLxu7hh%@V Lx hVP9  jjLx\! t=jjjLxc !ƒt"!a PLxA 1u' 0' 0^_[' 8#uVt׉' ƐS[^>[ÐS[>t$[ÐUSWV[u }' D$<$ ' t$u$$D$Put=k<T$JL$|D$x$L$x$PQ$$$Pt$lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$p1DPu@4 $PxPx9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$x$ D$@j PW [$ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $c \$ 8u$$>$0։- D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ<|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRCѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv63W8G4jjdv6jjdRP{3WPGLjh'v6eW`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,%L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$<;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJ<$9tR9PUWk >&t1<$W +^_[]fffffffUSWV[{t$ll$19w3D$hPVG >WEVu܁WEVufv ^_[]V1ffffVt$9vT1f3f3Ff3Ff3Ff3Ff3F f3F f3Fu1ɐf3DJu^1^ffffffUSWV[kt$D$hEt'1PV@t'D=u狋19u VPjۥD$@ 8^_[]ÐUSWV[|$ D$hEt$1PW@t'D5u狋9^_[]ËD$@ ,0tMD$jPUқ $D$18t4f $r!"u%%9uq C"tt$:] UWPjу$E WPj虤SV[ýt$ v(v (V'^[ÐUSWV[xD$,8tD$,1퐐8@uj(JƋ|$(W臣F$$jU F D$ D$,F>D$Pt$/1}nu1ɀ}ouL$D$j=Utǃ|$D$,t1PU=tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jgŅ8!8t 4$b&VY&1^_[]Í UPj螢fffffffUSWV[õ$4$,0 jPU uj:U jPUݮ tKt$}/3t$UhV( jVPӀUbPt$UD$P|$ jjWjjV萦mt$ jjWPjV`t$/D$PV迍ǍD$t$j蕍Džjt$W< uj$4$4jWtƍD$Phzd@VS VD$(Pt$u P$0>$0VPW轪 FD$ GL$ jjQPjRHtqVUW5 Rx0$0Xb0 kS8uj/UŃt$ $0UW' 0 QPW 1110$0P$4٩ 11,$j$4V$4WjU0P>~ PWt$t8HPQf &l0 $0P$4P 1,$D$P"U"-0^_[]Í ,$UPVW\1(lWP$8$8.Vs}fffffffS[ÛD$D$ $L$T$jjPQjR1yD$[fffffS[;D$D$ >$L$T$jjPQjRѢyD$[ÐS[ہD$D$ ?$L$T$jjPQjRqyD$[ÐS[{$L$ jjPQR葈yD$[fffffY/T$@u~@ÐS[t$ SWV[܀|$Wt$t$ߦ 9r?WVPj@^_[ÐSWV[Ì|$Wt$t$? 9r?BWVPj@^_[ÐSV[=t$ 艛ƅuyPj@^[ÐSV[t$t$赚ƅuyPj@^[ÐSWV[ü|$WƅtuWPj@ ^_[ÐUSWV[{l$|$UWƅttuUWPj@^_[]ÐSWV[,|$Wt$ƅtuWPj@ ^_[ÐUSWV[~l$|$UWt$-| t0UWPj@^_[]ÐSWV[Ì~|$t$W#ƅu WPj@ ^_[ÐSVP[L~D$L$T$$RQPJB ƃuPj@^[ÐSV[}t$t$t$B ƃuPj@^[USWVP[ú}Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1(3t$,t$,t$,t$,t$,t$,Pj@ ^_[]ÐUSWVP[:}Pt$0t$0t$0t$0t$0jt$4蝐 Ɖ׋,$t1(t$,t$,t$,t$,t$,t$,Pj@ ^_[]fX|L$"wLÍBffffffUSWVDX|D$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjj ~D$$<$|$ D$81$|$ <,PL$4 GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjj2 $~D$$|$ $1\$4WRD$$Pjj $ˋ\$4VRD$$Pjj1Ʌl$<릋\$4WRD$$Pjj~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjxD$$u|$0L$$tB;L$s5T$ >#\$4L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[Îojt$t$t$t$t$[fS[^oL$T$ Pt$t$t$[ÐUSWV[o|$$t$|$0t$(aD$ j/U,$t|UPt$ WVt$8IuU8uFx t$ t$Pt$t$@t$PL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K Й~ ƃQWT$H ^_[]ÐSWV[Le|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[dtjt$t$t$P1[ÐSV[ÍdtjVjt$PF1^[fffffffSWVP[;d|$$t t9t QlQ $PjW t$F u @t t  @x^_[ÐUSWV[ÈcT$$ L$1tJ1ɈL$D$$>D$P袈L$QjPW=L$N|$kK)l$kK) p;pi) PUt;y t0q$t~fuUvu1 q  ^_[]ÐUSWV[hbD$$L$t@1D$D$$>D$PL$QjPW~<L$kL|$kC)l$kC) ;i? )PU辿t7q tAy$t+nuUw艿u Ay^_[]USWV[HaD$(L$1҄t@1D$D$$8>D$D$P^L$QjPV];l$-?L|$ ) i)ʼn) i)k{lj*SiŠ)Ǎ PD$P脾t1D$H$<tzp t:h$D$t}suPu)D$uދ} مt3l$,t+Et$WPuVAEЃ^_[]ÐS[þ_t$ t$t$ [ÐUSWVH[È_t$\ԄlD$PLND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P 6ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UڃL$QjPU8L$ȿNt$kK)kK) p3pi) PU$D$$ ED$j=UtƉH$$D$<$|$W܂L$QjPW7L$Ƚ-?Lt$) i)) i)KsƉ*SiŠ)ƍ PWD$5tcL$f <$|$WL$QjPW7L$ȽkLt$kC)kC) 3i? )PWbtD$E$E!D$D| $$D$PUնPUxPU͹PU赹PU蝹tmPU艹trqPUutewPUatXPUMu^O1<5.' D$U2Nj$tP  1L$;D$v==wL$L$Qt$SL$uD$ 9D$ tf, UQS,$t'UW@|$BU4+1t$ 1 t]|$uf, FM $QP4$  $LD=uVQV~ $4D$ H^_[]1|$t4$1USWV[VYh+WT$L$ $L$p1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$ 1Pʋ$H $$$H $<<$Rt$W+ /$//$H $>$D$^_[]ÐUSWV](T2~:^^t@\|,$n*^ÍxЃs.ÉD$$pD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%pTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[ËR1l$E<%uEpuEπ r?^уstlu~;|$~,|$t3릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[QL$ T$D$$Pj [ÐUSWVXQ$1h ։ͅu4$ u'$hE 5 @0t$E4}0u"$h E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$|σstlu7D$ ~ ~$RDŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $("ȉىӉl$ |$uGD$1l$뀋$pDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $#$t"A$|t+H$D+$|1$uՋ$a1ڃV$%!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,JRE,}0M4T$$V$0PRQ1$E4$?1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PoP=D$π$O6\`D$TDl$H$th$Vko9r‹E0M4ʃ9‰\$WE,y$H$|T$pt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$Ĵ1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$*1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,jrE,u0M4tڍqu4 $耳1$P$`$M1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,FtRE,}0M4$V$0Pt$QE4E,M4},$=1^_[]ÐSP[ET$ D$$1Pj= [ÐS[Et$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ÍET$ D$$1Pj [ffffX_EL$DÐUSWV[8E|$(t$ l$u)Ptƅ>l$$ujkhjxL$tfjVP NjD$uj(PC/D$@ x |$(u2VqE\1F49P1D$tGuP|$(x |$(tF|$(mV|$($Phht@U t$t$tL$t RB(JDtRP)stjjPU IA(PstjjPU IA1t^_[]ÍPj^GVSVP[BT$L$D$tRQPVƋ$t P/^[fUSWV[ÛBt$|$t$jt0ʼnV:U|$T$V Ÿ]Pt$'t=Pt$ tsbPt$tghPt$ޟt[nPt$ǟtOuPt$谟uW21* @TWta^_[]ÐUSWV T$L$[A|PpŅt'}/u~L$$ t$  4$P{p/P[PVu4$U[DžjW_WtsL$v u_D$ VP,tLT$ L$$ Pt$ ^Vh'u! ${1VB'Pso$|$ $~:s1퐐Nt:t됐tÍMwUPWI D, L$$ t$ [tuPntGT$ PQhRP~)T$ L$$ t$ $t$ $:uw1퐐Ot:t됐tÍMwUPVI D, L$$ t$ [tu$ $ȁ ^_[]Í䐐USWV[=l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%\$L$ A ZAthhP耥+jj!G(hhPW|$ Gt\$h(jP8|$ "\$jhf|$ G9ouG)o\$UD$pb|$ Go\$UVPx W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PF$ދ\$P~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V-tt.)9uUt$V t6u0,1(V"[9ſuUt$V ^_[]fffUSWV [È5D$48H L$@ 1퐐/t <,tEP0UWPA{ .,v3l$4uWEED$\$cD$D$|$j|WstD$4@ T$L$ tB17t<,t\$RT$YD$P:tDl$VWQFz Ut$P4z +1<$WZYNjt$D$Pl$8uEW|$WVy W D$D$D$ Džt$\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$U\$8C k$K($fC K(K(|$T$ t$4PC>p1\$91\$-4$K\$PCD$PPD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$D ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q* ^_[]USWV[è0D$t uyB|$ 1퐐/t <,tQL$U$P.t2ƃ$UWP?v 4$t$P+v 11^_[]ÐUSWV[/|$ t$FN,9vtU6uCu;U菾t.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[J/|$ l$|PW:uLt}D$x@ȃǃtVot$ U)Lstƃntfuă뿐1ɋT$z H趚D$8l$|$ u)1|$WuPt$D/WSprWuPt$D1TL$4xT$$s$tntfuσ1} t WPV/p l$ E|$f>t WPV p }t0EfEfF}WuVo f},t&E(fE,fF}(Wu Vo f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[(|$ t$FN,9vtU6u]uUU迶tHnNT$l$f,Ninf|FFWRPm ~F 1^_[]ÐSWV[l't$FNy9vtW6uCu;Wt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[&l$DpEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|UɂD$tL$j|UQdt L$UhK=rfUPt$P 10^_[]ËD$tP2KL$ =r4"D$t+PKL$=rQQUPt$T^jjP'tt$ $@ 1D5t <,tFP/D$4 VUP8k D5$(L$tSD$HtJ11t <,tFPг Vt$Pj D5$h|$t+D$Ht"t$@ $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0$$@,t'<$O 1҃ ҃f91wуu0<$O G$1҉L$‹O(Q9T$0RD$p 衶$D$t$HjjjPjfWjQVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[Ú|$$ $8ftGt t1tWG(fdhwUE9 =wad,|)ƋtVPU9 9vD|ŃƋGtVPU8 9s D|ŃE$^_[]ÐSV[Ýt$ t_vvvٱv αv$ñv,踱V诱$191u ^[ÐX$@ÐY$@uBfffffffUSWV[$(E$$4D$$0j:WOtjQP+ t0V$0W;  NjE;$^_[]Ãhu 1LtMpuTt6xu\txdf$O:t @t@uS4$l$w$D$j@UP6 <:t$EF<:uEl$4$D$D$OtuHPPBhP1BǃH l D$O$$,PQhW  t" ǃt{ (j H6 H L j l h l i<PC=k<P !Pv>t*j/Vkt|$u$jPRQV 'T$^$jPRWUQV7VPj5*SV[-t$ j:VFLtjQP ( tt$V茣1^[ÐVY T$փ1uL|t^1h|^USWVH[Ø t$dl$`L$\D$Dȃ=L|uh|<$yFL$VPj@Q裛T$tLT 9 $ƅtID$\WUh| ~*)NjD$\u $dVUQb ;L$Dt[a1Kt$\h|aL|RDŽh|DŽL|x $;D$Du ЃH^_[]%USWVT[8 |$pL$ll$hD$P=L|uh| $t$ uLL$WPj@Q?t$t$ T$Ijj tD$Wt$L|/ $t$j t9<$u-;D$PuyL$T^_[]WQU ;L$PtNTh|L|DŽh|DŽL|0w;D$Pu T^_[]#USWVD[ L$`T$dt$X}|$@uML|u h|t9ƀRRQt$dPj@W tRQt$dV^ M;L$@uD^_[]"SWV[, |$=ujL|u h|tVw}tL!h|L|DŽh|DŽL|Wa^_[ÐUSWVP[È D$hT$dML$LL$pL$t$lуucL|u h|tOz=m8@tW=mT$ vPQj@Rzx. VPRD] bl<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$lh| 4()uT$ff׺r$σߺfDfu,$tу$$1sE;D$Lu^P^_[]Ët$dh|L|DŽh|DŽL|Hs,$1,$S[D$u&L|u h|tr-[P[ÐS[îD$u&L|u h|tr-[t$ P2U[ÐSV[Mt$ j:VfDtjQP-  tt$V"r-^[ÐSWV[|$t$j:VDtjQP tWhV WhV ^_[SP[ÍD$ L$ $L$ƒu&L|u h|tmq-Qt$P [ÐS[D$uL|u h|t1[PdS[ÐSV[t$ j:VBtjQP tt$Vp-^[ÐUSWV׉[dR)jj mD$UWt$L t$j lm19tG4$hLDŽhDŽLo^_[]ÐUSWVL[öD$D$H1,<jUh u} t @u D<@u^h LDŽhDŽL@oD$;D$HL^_[]Íl$ E< us{Un8|$jWhQ u|$ u}FuhKL<DŽhDŽLIu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:L D$t$DRL$DL A @`? e19<$P D$D@ @`ƒ?e91O D$D@ @`Ń?+e9N D$D@ D$@|$`D$?e;|$  ՋL$M  <$‹D$DpQ D$L$ D1 <@4$T$<`Ń?|$_u+e19QL$ T$D $L @`ʃ?|$_ue19 l$ D$L(D$<_D$$D @`Ń?+e19 ՋL$ T$D |$_$D @`ƒ?e9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t_\;D$(Q,^_[]É<$t$D$d VRPQT$T$L$ t$ ?3e|$D/? eD/ ?eD/D$e/T$T$L$ t$ ?3eD/? eD/ ?eD/D$eD/D$L$ < eL/ ?eL/ eD/D/ L <$<$USWV[$D$$  ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ| ǃx ǃt ǃp ǃl @l ]3^4t2tkƷ< sԃ1@ttl tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃl ǃp ǃt ǃx ǃ| ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ]|$| t!qtAD>1tBD>׹@l ]D,|t.tkŷ< s݃1@ttl tр‍ L 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ| ǃx ǃt ǃp ǃl ]|$| t!qtAD>1tBD>׸@l ]D|$t=2t$Fi%I<<fw1@ttl tlj瀍 ;L 1ttD~ts ^  fABO^ w~4ABO^ w~4ABO^ w~4ABO^ w~4ABO^ w~4AO^ wʼn41 @ttl tlj瀍 ;L 1ttD~t^$QO^$Al O^$Bl $u1 @ttl tlj瀍 ;L 1ttD~t⍃^o 0pQPQPQu D$p D$l D$h D$d D$`~ D$\} D$X| D$T{ D$Pz D$Ly D$Hx D$Dw D$@v D$<u D$8t D$4s D$0r D$,q D$(p D$$o D$ n D$m D$l D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف_р3ʉрUɀʈǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ΀ D$ D$x D$t D$p D$l  ʋD$h ыD$d D$` D$\  D$X D$T D$P D$L  D$H D$D D$@ ʋD$< D$8 D$4  D$0 D$, D$( ΋D$$ D$  D$  ω D$ ɋD$ ? ? ։? T$ځL $T$ 1 u E Qu ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  L P J΃  L P J΃  L P J΃  L P J΃  L P J΃  L P J΃  L P J΃  L P 9 4$l$T$ L$ Ń4L x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]cUSWV(]ŘD$<X%UUUUʁUUUՍ4P᪪L P x   x L P x   x L P x   x L P UUUU   $؃L P x   x L P x   x L P x   x L P T$H  l$  ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yD $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3L 3L 3L 3L 3<$t$3~3L 3L 3L 3L 3L 3L 3L 3L 3L 3L 3L 3L 1#t$t$D$|$811t$3=L $3=L $3=L $3=L $3=L t$$3=L $$1L$t$|$l$3l>l$|$l$ 3L 3L D$35L 35L 35L 35L 3L 3L 3L 3L D$t$D$D$$7֋T$ Bl$l$l$$xl$ L P $x   x L P $x   x L P $x   x =L =P $x   x L P ȃx   x L P x   x L P x   x 5L 5P x   D$@P1(^_[]ÐS[D$1ɐȊt tT Tt t t4 uP1[ÐSV[jD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[`MD$$D$DD$@D$9\$6D$L$T$@jjPQjRqD$HPj -ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWfD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPD$0PjuM\$|$ juh$PhD$lPj$Pj$PjWV)4D$ PjMt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[5$|D$<$` hjD$@P DŽ$@D$V=$@8$u H$@D$$@UV|xljD$Pt;uH`WP<PWP{<uD$$WP]<D$UV xljD$BjPW1 D$,u:|$$@PW#x$@L$,UVwD$l$0t$\$UVwD$ D$D$ D$$$@&D$ \$UV@wtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWbvD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$VMz1$xU&$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-PQRl_h$DUt$@VZ  j jW- hjU hj$P D$@hjP D$<;$`u`d^_[]D$RWsD$tT$@PQhRhl$ $KfffffSV[}D$ h`rƉP臕)Ɖ^[ÐUSWV[8l$0jD$PU& th5h`) $)D$j PUVs $l$1}$K1D=t<$t h`tt$,ō 4$t$L$QWPjbVf L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(Vvf     jQPR ;     jQP ;     jQP ;     jQP ;     jQP ;     jQPS ;     jQP  Ƅ; jjt$x ^_[]fffffUSWVD[h|$\w qB2t$`tD$@jPVp NjD$@9t8t=BD^_[]%B8"u trD$D$ ۊD$D$ˊD$<D$8wD$X$2a$WQjPc0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$AD$ tKWV(tD(1t$Qt$ QUQT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[xt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Þjt$t$t$@[ÐS[njt$t$t$[ÐS[>jt$t$t$[ÐS[jt$ [ÐS[jt$ h[ÐS[ίjt$ H[ÐUSWV[èt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Ȯt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wÍ.ÐUSWV [ج|$(l$$t$ D$4D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[>D$ hPt$ [ÐS[ht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[}D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[ØD$pML$LjPt$lv D$h|$df$D$V萤L$)L$D$PVWD$ |$$v=D$dt$.D$lp8L$ QjjVV!|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V>V赣|$)Ƌ $PD$2PL$Q;  $ $,t=D$D$lp(t$ jjt$>VVF|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>VdVۢ|$)v#Ƌ $PD$2PL$Qe sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7:L$R)уtuÐWVt$  r!̐cw^_fffffSWV[xt$|$G@hjP$ qj@PW¾ g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[v$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$V;*hVU< hV1;$u Ą^_[]USWV [(ul$(16t$ %T$$NP NT  ()`N`L$$WRPú ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_Ǿs$hRP讹 RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$`rL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$PL g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQu $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]\|fffffffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[a|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[`D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[;_D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]]$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$f4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$A$FQ? T$‰ً$|$D$G<uD$ $ $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4xL$ |$ )t$)t$$t$,)wD$ L$?? n T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EuBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj &t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B bYt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?uፅuGPGX }GTG\GG?$L$u aD?FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  FL$Q? FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $='$FL$Q?P$y$NL$Q?D$T$ ߋ t$'$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $eQUSWV[Ö8iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP6~ )t]D$)WPu8~ }43M(U,E4E09w)RVP} E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[Ì7t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[7L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU| F4n0)Pv8U| 1tN0^_[]ÐUSWV[Ë6t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[h5L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RwT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXu/D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$~L$@~D$?? u)D$(L$(É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+T$D$tq01t ^_Átփ*tUSWV _hL$ y y$q9NQǃ8|$܄|$$N9l$(4$Jى\$!4$f ؉\$V_?L$1)t,)9멁f*] ^_[]ÐUSWV[Hl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@ $D$ @$; L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPv )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$I G|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[ |$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw 3Q o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoUo9,$Eo9wŅt0UD$pw O o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw L o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQ!L F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw K o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQaKL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU|4,$Eo9wŅt0UD$pw J o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUc3,$Eo9wŅt0UD$pw I o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw H o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU1,$Eo9wŅt0UD$pw H o $ho)o)hu $AA~l$(u ~tvet!@UV Xxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVU2 $FlF\iU~0l$E$ыj9wŅUD$pq F $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV?0 $FlF\iUh.l$E$ыj9wŅ(UD$pq D $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD f f F`)FtFl;FlF`l$(sUVuFuaV[-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $ f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPU_uElE\~WGn9wŅ$Uwv 2 n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv 2 n on)n)ouGGD$8xw1)Ћ$jPQU5uElE\~W`Gn9wŅt)$Uwv 1 n on)n)ouGGD$8xt1$^_[]ÐUSWVX8$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$ f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV'F}9wDžt)$Wvu U- } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu , } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUcmAlA\uVF}9wDžt)$Wvu + } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu B+ } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XÐUSWV^ƘL$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[Nt$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX8$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXZ$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐUSWVPX$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Ît$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX*ÐUÐXT$J r )ыS[~D$D$ PNc[ÐS[Nt$ s[ffX/L$ $ , | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ǛT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PiL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXxD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كS\$T)4f f9Hxl$ $zvt$|$ +Ȩ|)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~]H $hMH $) $XhMH $ +(f l$|$xt$ +<)9D fHxoh9xXkhl$ (f t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>tB4fr   f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[\t$VGR=yaratV=tcidu3VuVStt$PpF 81^_[ÐSWV[t$VQ=yaratV=tcidu3V;uVtt$PF1 8^_[ÐSWV[lt$VWQ=yaratV=tcidu3VtVctt$PF )81^_[ÐSWV[t$VP=yaratV=tcidu3VKtVtt$PF1 8^_[ÐUSWV[xt$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$VD$PWUq 1u(VbOu (^_[]ÐUSWV[ȯt$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VD$PWU 1um(VNu R(^_[]ÐUSWV[|$Gt,/D(UwUt D$0 1^_[]ÐUSWV[û|$Gt,/D(U蘚wU躚t D$01^_[]ÐUSWV[[|$Gt,/D(UHtwUZt D$0 41^_[]ÐUSWV[|$Gt,/D(UswUt D$01^_[]ÐSWV[ÙPt$ t$  t6D$t7<$D8W`t$W聙tD$ 01[R^_[SWV[Pt$ t$ ^ t6D$t7<$D8Wrt$WtD$ 01^_[USWV[Øt$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$VD$PWU t_VKD$t<<$D8Wrt$W'tD$(014 8&8V&Kt^_[]ffffSV[Ýt$t$ePzK=tciduL$1=tcid^[ÐUSWV[Kt$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[Üt$t$Vt$t$f D$V^DD$1^[ÐSV[Mt$t$t$1dVPP^[ÐSV[t$t$t$dVPQ^[ÐSV[t$t$t$cVPwQ^[ÐSV[ýt$t$t$cVPQ^[ÐSV[Ít$t$t$qcVP7R^[ÐSV[]t$t$t$AcVPGR^[ÐSV[-t$t$t$cVPR^[ÐSV[t$t$t$bVPS^[ÐSV[ͨt$t$t$bVPgS^[ÐSV[Ýt$t$t$bVPS^[ÐSV[mt$t$t$QbVPS^[ÐSV[=t$t$t$!bVP'T^[ÐSV[ t$t$t$aVPT^[ÐSV[ݧt$t$t$aVPT^[ÐSV[ít$t$t$aVPT^[ÐSV[}t$t$t$aaVPT^[ÐSV[Mt$t$t$1aVP'U^[ÐSV[t$t$t$aVPwU^[ÐSV[t$t$t$`VPU^[ÐSV[ýt$t$t$`VPV^[ÐSVP[ÌD$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[,D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP[̥D$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[lD$QPGt&Pt$t$za D$V?D$1^[ÐSVP[ t$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[ìD$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[LD$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[D$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[ÌD$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[,t$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[̢D$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[lD$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[ jt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[üjt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[lt$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[ jt$Et&Pt$t$] D$V:D$1^[ÐSVP[üD$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[\D$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[jt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[ìt$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[Mt$t$5YP*?=gntsuV!t L$1^[ÐSVP[t$t&Pt$t$[ D$V8D$1^[ÐSVP[ìt$t&Pt$t$Z D$Vd8D$1^[ÐSWV[\t$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[t$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[Ìt$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV[+t$t$WP==gntsu?VŃU+t$UPV t D$8 W/<1^_[]ÐSV[ít$t$VP<=gntsuVzt L$1^[ÐSVP[\t$Xt&Pt$t$qX D$V6D$1^[ÐSVP[ t$(t&Pt$t$!X D$V5D$1^[fUSWV[ût$t$SP;=loobul$VzEloob^_[]ÐSVP[\D$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[ t$t$Vt$t$ D$V4D$1^[ÐSVP[üD$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[lt$t Vt$?D$V24D$1^[ÐSV[-t$t$t$VP@^[ÐSV[t$t$t$VP@^[ÐSV[͙t$t$t$aVPWA^[ÐSV[Ýt$t$t$1VPA^[ÐSV[mt$t$t$VPB^[ÐSV[=t$t$t$~VP'B^[ÐSV[ t$t$t$~VPB^[ÐSV[ݘt$t$t$q~VPB^[ÐSV[ít$t$t$A~VPGC^[ÐSV[}t$t$t$~VPC^[ÐSV[Mt$t$t$}VPC^[ÐSV[t$t$t$}VPD^[ÐSV[t$t$t$}VPgD^[ÐSV[ýt$t$t$Q}VPD^[ÐSV[Ít$t$t$!}VPD^[ÐSV[]t$t$t$|VPD^[ÐSV[-t$t$t$|VPE^[ÐSV[t$t$t$|VPWE^[ÐSV[͖t$t$t$a|VPE^[ÐSV[Ýt$t$t$1|VPE^[ÐSVP[lD$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[ D$QP`8t"Pt$}D$V/D$1^[ÐSVP[ìD$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[LD$QP7t"Pt$ }D$V/D$1^[ÐSVP[D$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[ÌD$QP6t"Pt$N|D$VA.D$1^[SVP[<D$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[ܓD$QP16t"Pt${D$V-D$1^[SVP[Ìt$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[,t$t$5t"Pt$zD$V,D$1^[ÐSVP[ܒD$QP15t&Pt$t$x D$V,D$1^[ÐSVP[|D$QP4t"Pt$>zD$V1,D$1^[SVP[,D$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[̑D$QP 4t"Pt$yD$V+D$1^[ÐSVP[lD$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[ D$QP`3t"Pt$xD$V*D$1^[ÐSVP[ìD$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[LD$QP2t"Pt$xD$V*D$1^[SVP[t$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[Üt$t$1t"Pt$awD$VT)D$1^[ÐSVP[LD$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[D$jP2t"Pt$vD$V(D$1^[ÐSVP[ÜD$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[<D$jPD2t"Pt$vD$V'D$1^[ÐSVP[jt$1t&Pt$t$s D$V'D$1^[ÐSVP[Üjt$1t"Pt$cuD$VV'D$1^[ÐSVP[Ljt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[jt$1t"Pt$tD$V&D$1^[ÐSVP[ìt$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[Lt$t$T0t"Pt$tD$V&D$1^[ÐSVP[jt$0t&Pt$t$q D$V%D$1^[ÐSVP[ìjt$/t"Pt$ssD$Vf%D$1^[ÐSVP[\D$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[D$jP/t"Pt$rD$V$D$1^[ÐSVP[ìD$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[LD$jPT.t"Pt$rD$V$D$1^[ÐSVP[jt$.t&Pt$t$o D$V#D$1^[ÐSVP[ìjt$-t"Pt$sqD$Vf#D$1^[ÐSVP[\t$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[t$t$-t"Pt$pD$V"D$1^[ÐSV[ít$t$EnP(=gntsuVz t L$1^[ÐSVP[\t$Xt&Pt$t$an D$V"D$1^[ÐSVP[ t$t"Pt$oD$V!D$1^[ÐSVP[üt$t&Pt$t$m D$Vt!D$1^[ÐSVP[lt$t"Pt$5oD$V(!D$1^[ÐSWV[t$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[ìt$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[Lt$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[t$t$TYt"Pt$mD$VD$1^[ÐSVP[Üt$t$Xt"Pt$amD$VTD$1^[ÐUSWV[Kt$t$jP(%=gntsu?VŃUt$UPV9 t D$8 WO$1^_[]ÐSV[̈́t$t$ejP$=gntsuVt L$1^[ÐSVP[|t$xt&Pt$t$j D$V4D$1^[ÐSVP[,t$(t"Pt$kD$VD$1^[ÐSVP[܃t$t&Pt$t$i D$VD$1^[ÐSVP[Ìt$t"Pt$UkD$VHD$1^[fffSV[=j ƅt%PV FF F^[ÐUSWV[|$tzj 1tcPV FF FWŃPwtQP~n VX1^_[]Í{PQhRSV[-t$ tVtP4^[Í{PQhmRSV[́t$ tVP^[Í{PQhmRUSWV[hD$tfL$ L$QPjj1x@ƃ$Pt+ǍD$ D$Pt$ t$WK1ɉV.ʼn^_[]Í{PQhERpUSWVP׉[ƀPQxj t}ƍPV n~L$N uq$\! USx! VP#9tBPU+$u vV1uWyU^_[]ÐS[t$Pc[ÐUSWVP[út$t 9.t 1^_[]Fu V5F $P[t͉NjFuBPWdPQj t!UP$ F~$F qWsaUSWV[~l$1t 9}t ^_[]ËE D$P tߋMuBQPD$PQIj Y t'WP_E$ED$E y4$iZ/~L$1t 9tËA ÐVY}T$1t 92t^BBtuB^ÐS[þ}T$t 19 uL$ tB ;D$v1[ËBuBPQ[ÐY_}D$t 9t1Ê@$ÐUSWV[+}l$1t99Eu.E P tNjEuBPW^_[]ÐVY|T$1t 92t^ËBuB^ÐUSWV [È||$ 19t$$9Gt{o F D$D$P t[$WBȅtЋT$ՋVtэA$QPRt$t$V[ Owo tQ@1 ^_[]ÐUSWV[ø{l$9ED$ Etp} Pנ$PN tM}D$uBT$ $A$RWQP|$W M}u tQ1^_[]ÍJ/{PQh+RS[zD$t9u L$ t9t1[QP[ÐS[ÞzL$t 9t1[ËD$ IuBPQu[ÐS[NzL$t 9t1[ËD$ IuBPQ%[ÐSV[yD$ t9u L$t9tf^[ËpBЅtItRPאS[ÞyL$t 9tf[ËD$ IuBPQr[ÐUSWV[Hyl$$|$ }$tV 1^_[ÐSWV[Vt j V~1^_[ÐSWV[ìst$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[rt$|$ʃ>tXVt j V1^_[ÐSV[ot$ jV)tj Vt jV 1^[ÐSV[=ojƅt5htFFF V_1^[ÐS[nt$7[ÐUSWV[ønD$ t$tPD$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋L$qD$ tL$9QWP> 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋH vHN15t$F FFFFU=tP w싔4Nx"u+1Ҁ8t$FHt"tV x>t1^_[]ÍcPQhRUSWV_kl$D$P1 D<&t0<<t;\$rJ1ɋB닀ztuTz;uN<szuuuwXtEuW1^_[]Éw񐐐USWV[fD$PZ>L$QPjjj$0PD$PZ$$_HtыxnUՑtUt띐$$QL$ QPƅtׅkU蕑tT$$4$tz1Uj$ƅt`L$HtыxnU/utUPjQt t뫃tX^_[]Ís?PQhR]?PQhR?PQh RsPQh;RPQhERi?PQh RS[ct$7[ÐUSWV[õc$x4$tT}tNUt H|/t鐐9/ 9sf$.V蒈H r??fD XDXXXXDistX/.plV W$Pt[ 9ucV]tUjȐP軐WV[`t)VM]Ut$V^u-88V]Vbj81^_[]É9tE9t qy/t)rVUP 4USWV[ajCcj1 Ɖ|$hj$[ tLǍD$PW\t.L$Al$h($#$V9s&W\VW\V4$D$ l$t1jjWjjQjM,$EW[tFjVW7` D$D$ u;jjjhj|$WP|Mt",$u U!1Č^_[]VUL4$ڐSV[Í`t$ jv6_ v6LV^[ÐS[N`D$P覌t[ÍPQhRD$t1S[_jt$t$ [ÐUSWV[õ_$4$0$,D$PStED$$;t 1^_[]Él$L$QL$QRUWVPu=VU$8P$8PD$ PT$,$0릅4$t$$8$8D$ PRt?t$ $,|$$0D$$1;<$4t $4jj$8W$8Ut$ VJS$,$0PQjjWUЍPQhRS[]D$P[ÐS[]D$PP[ÐSV[ý]t$ vV ^[fffUS[Å]EM L$$D$e[]ÐUSWV [F]PQ_! W ]! l$UVutPW\ ^_[]Ét$W\j thʼnpPU|$GEOM,$EV\W|$Wt(P&V]\4$p1l,$UW9uVMpPQh@RUS[\EM L$$D$e[]ÐUS[[EM L$$D$^e[]ÐUS[Õ[EM L$$D$e[]ÐSV[][t$ 1tp9u V^[ËD$@$ÐWVY[T$ 1t p9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZnZL$1tp91t^1^ËAQ^ÐVZ.ZL$1tp91t^1^ËAQ^ÐVZYL$1tp91t^1^ËAQ^ÐVZ®YL$1tp91t^1^ËAQ^ÐSVPYlYD$t p9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYXD$t p9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYLXD$t p9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYWD$t p9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y/WD$tp9u@H@ty1ËT$ BÐSVPYVD$t p9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY\VD$t p9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYUD$t p9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYzD$PiUB|$$o4;o0w,Pj2ǍMUVWv D$$x,ljh0V,$tD$,PD$,DV|$UBVlgǃ,wj,<j<t$$D$$x,ljH0l$,Ujw,4t2$ƅPt$,蠟y&$'L$n@4@<C$ōƃM)WRPS L$$A,T$TT$,T A4A<$D$PB$mhQPFt$(Pt$ ~U@t$(|$WxtmPFU}@D$ x|$$t$P$<WVVR L$$A,T$h t$ VWx9Ƌ|$$U@D$ D$X;PQhzR肥$&PQhRc;$&PQhRDPQhR%PQhTRS[^?D$t9uL$ t 9t1[Ãt$QP] [ÐUSWV[?t$$t 9tFD$ PF@F8D$$P4D$$@,D$$׉T$)ω,$D$4FPt$,zt1Ʌ~,$벉t$9vwL$T$ )VQPP D$$@4@<W4$t$ h?^_[]Í;PQhzRqPQhIRRS[î=D$t9uL$ t 9t[ÃQPc[ÐS[^=D$t9u L$ t9t1[QP:[ÐY=D$t 9t1ÃÐY<D$t 9t1ÃÐS[þ<D$t9u L$ t9t1[QP[ÐSWV[|<,tIPt#D$PVQ tVQt> 61VD1^_[ÐUSWV[ <l$}t^_[]j@tƋ|$PVjP<F,F0F4F8F<}$t7hntL$7PUrVPbUSWV ։L$[B;|$ *jjWg :jPww Ht(ut$$_DjD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t#VtW0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(mWPQhbR觝QnGPe9WY1^_[]É.WPQh`RXg!WPQhqR9WPQhRS[n7L$A4tPQ4I,Dt*P1[ÍPQhR轜PQhR螜USWV$[6l$<|$8uV<8}4tM:D$ PWtj WctD$<9t6$V7$$V7:PW,^_[]ÉL$jjt Hl$!PQhRYPQhR:USWVP[Ê3|$l$9L$$T$ 2;1u29r $P4$P4L$$T$ E4;G4uT$9tPFD$(M,LD$,O,LE,t9uO, t9t3$U+4W44$^_[]þQP$tڍPQhR+PQh RޗSV[-2t$D$ P3Vu3^[ÐS[1l̀PQ4! P1[ÐS[î1! P1[ÐS[Î1! jP51! PQh1[ÐS[N1D$L$ PQ>[ÐS[1D$ t$P[ÐUSWV[0l$}tQ97uGW22EtS90uOH<1;M uM;H4w\t @,4ȃMW1^_[]ÍAPQh{RSPQhcRSPQhhRǕSWV[0|$wVq1Gt$9uG@WUPPr jDžt!PWGwo 1^_[]ÐUSWV[+l$19}EuBM1tDm $t: $U芺t^Ut$D$Pq U-;1$D$jNt"WPT$ED$E E^_[]ÐZ/+L$1t 9tËA ÐZ*L$1t 9tËAÐSV[*T$ t19 uL$t r ;t$v1^[ËR1ttVRQp ᐐUSWVP[j*D$1t 9t ^_[]ËHh t( $tDUt؉Ut$P&p ątgXPQhR茏XPQhRmZ¿)L$1t 9tËAÐS[Î)D$t9u L$ t9t1[QPj[ÐSV[M)L$ t 9t1^[ËT$19Q ut$tRVq ֐USWV [(t$(~$t  ^_[]ËFdjQvPt҃~ tʔD$jPv ʼn$u 裔8"tD$NN 9u8"t=PQhR1jPj N,$U7ǍFPD$PU tcD$;$uZjPV& tD|$u W?1,$j譶ƅt-PV譱F~n Wt WD$$0USWV$[e'y11T$G=w ⍋jAPQhm u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5!D$t9u L$ t9t1[QP[ÐSWV[ t$~uo~$tijPvv t! !"jPvv t1! |$PQV#V-7^_[Í w : PQhRSV[M ! VP/ƃ! ! VPƃ! 1^[Ð1ÐS[D$L$ yt"QP[ÐVZ®L$1t91u T$ t92t^19^ffffSWV[lj@DƅtE0WVD>jPr F,F0F4F8F<^_[ÐUSWVP[t3Pj職trj@购DžuU(Wj@虭1tE,$0UW蔨/GjP$G,w0G4G8G<1^_[]ÐL$GUSWV[8|$1tv09uloUO4ƅtIl$44$t*1G, 61V蔦1^_[ÐUSWV[[l$}t^_[]Ët$j@tdǍ0VP7t$jPHG,G0G4G8G<>}$uL$UxUSWVP $[ç*ts֋|$jjWƥ tCżjPww 諩t(t1V袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%!! PQjfRwQ覱GPW葱1^_[]É.!! PQjdRwg!! PQjuRwwS[D$H4tH4[ÍF"+" PQhR1wUSWV[Èt$(l$$~W~4tHż$PU胛tj Ut 09t6$W$WżPUU^_[]ÉD$jj藩tHVD$~T$rL$9FX" PQhR%uUSWVP[z|$l$9tqL$$D$ ;u.$9rPV$L$$E41;G4u 9u!UsWg1*vQBt$ D$(M, G,L$,^_[]Í# PQhR8t## PQhRtSV[mt$D$ PV^[ÐUSWV[+l$}tQ097uGWrEtS90uOH<1;M uM;H4w\t @,4MW>^_[]Í"+# PQhZREs"p" PQhBR&s"p" PQhGRsUSWV[[ |$wt<09.u2VGt>9(u:G@$$PQjARpm$>$$PQjBRpUSWV[ T$t]D$ |$L$tKutUtMtM L$$tEUL1Ht t L t L |$$t L2 ^_[]Í$$$PQjZRoffffUSWV[ D$8t|$4D$0uHHL$HL$HL$H L$H L$H $x p PHzl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffSV[t$jt$t 1ɃI^[ffffff$̀ffff'̀ffffỳrS[t[̀rS[T[&̀rS[4[%̀rS[[ḅ̀rS[[̀rS[[̀rS[ô[̀rS[Ô[:̀rS[t[̀rS[T[̀rS[4[̀rS[[Ḯ̀rS[[%̀rS[[_̀rS[ô[\̀rS[Ô[;̀rS[t[b̀rS[T[̀rS[4[̀rS[[ḛ̀rS[[c̀rS[[2̀rS[ô[̀rS[Ô[̀rS[t[9̀rS[T[Ḇ̀rS[4[ḵ̀rS[[8̀rS[[Ḁ̀rS[[̀rS[ô[̀rS[Ô[Ḅ̀rS[t[̀rS[T[ ̀rS[4[̀rS[[̀rS[[0̀rS[[Q̀rS[ô[̀rS[Ô[)̀rS[t[{̀rS[T[|̀rS[4[#̀rS[[)̀rS[[=̀rS[[̀rS[ô[̀rS[Ô["̀rS[t[S[^t$t$jt$`.[fffffS[.t$t$jt$t$t$H.[fS[t$t$jt$t$t$8.[fYXZQ̀QQrlS[þt$t$t$) [ffffffS[Î1;D$[ÐS[^1;D$I[S[>,8t jj1[ÐS[,8t jqj1[ÐS[,8t jAj1[ÐS[î,8t jj1[ÐS[~,8t ji1[ÐS[N,8t ji1[ÐS[,8t ji1[ÐS[,8t jQi1[ÐS[þ,8t j!i1[ÐS[Î,8t jh1[ÐWVX]! ?+ R4ѐ>t1 @u~1ɐ>t 9u#:T$4IDT 4N)! D$ 1^_ÐXL$T$R 1ÐXL$ IÐX_L$ ID1ÐSV[-t$ ~u T$F1^[ÐUSWV[l$|$t$,8t jRgUWV t h1^_[]øÐS[Þ>*[ÐS[~jf-[ÐS[^jlS[>,8t jf1[ÐL$1;L$Ð1ÐffffffSWVP[|$t$uV %$PQj;Rb<$PhvtVP^_[ffffffSVP[Ìt$uVP%%PQj;RaPhwt@VO $tЅy^[ffffSWVP[|$t$tt7t;uP$4V%[%PQj:Rau$$PhtV O f^_[ffffffSV[}t$ uV%%PQj8R`jh^t VN ^[fffSWV[,t$|$u5=&%PQj7RI`w(w$1^_[fffffSWV[t$|$u5=d&'&PQj7R_w(1^_[ffffffSWV[Ìt$|$u5=&q&PQj7R_w$1^_[ffffffSV[=t$ u5=&&PQj;R^_&ff g#F F^[fffSV[t$ u5=>''PQj7R^F(^[ffSV[Ýt$ u5='K'PQj7R^F$^[ffSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[î% Pt$t$T [fffffSWV[|t$T$u#7s'׍'PQj9R]с wdxp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[fffffUSWV [t$ uD('PQj>R)\jV&D$C,jt$V' Ƌ4&<$lD$,$ltAL$t$t$$UT u͋D$|=uUl&Ba9,$}d)tuDur;MDMDMD MD9uh+1 ^_[]ffffffUSWV[u$/AL$(!L$,L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPjS[L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[ÆL$u"C)5)(PQhROt$uHT$D$t$ 9Љ,)Wt$Pt$Lt$Lpu11҃^_[]Éȉt$,9ы|$0})t$49Ƌ|$8}!)WVRPt$Qt$Xt$Xu 맋L$<fffffYi mNA90 %ÐX_L$ ffffUSWV0X8$t$Du%$0*&*)PQhRPLL$H|$PL$u)$>*&*)PQhRLL$X1|$L$WtD$ ؉D$ )t$D$HOL$|$ T$/,T$D$H9wԉL$Lt$9s,D$$PVT$XD$x ͉ƋL$L|$$WVT$XD$H\$tt@1ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$) T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$L7D$4D$9ƋT$L߉l$9s.*D$$PUT$XD$x ŋT$L|$tB1ɋt$D 9u)̓|$nЃ|$S1ɐT T TT TT TT TT TT TT T9u|$uO1l$ t$L 9u)\$T$Lt\$|$$Wt$T$Xt31T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$1Ґ  LLLLLLLLLLLLLL9u.$t$ 1$#L0^_[]USWV<[l$X|$T|$\|$T!D$Hu D$4tǃǃT$PT$$9L$$BT$,%T$0\$|$ =$D$(\$ǃ|$ l$XL$1L$u8D$4;L$$fD$T4>-u FD$,t$0VE<+<-nL$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő<**M*PQh_RfCE**M*PQh`R $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VD$\(pD$D$ 1T$ $ $.T$tf\$QURA uU $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$8D$X8:RQPBw \$+L$ \$D$\T$l$ \$D$\t|D0|$8|$Xt?:t!RQPv 1L$\|1uD1 T<-t<+::"t8tD$X8:tkRPavT?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uC8t}:tIRPu1L$\|1T$ uD1 TaL$\D1L1 t1ɋD$`8B8t}:t4$P6uT $E<-t<+u:}:1<: :ffffffUSWVP[Jt$|$ 8H;L$}B:-u:z$RTU--?B$^_[]Í*#+*PQjRR9|$ V++#+*PQjSR92$0$T::u3B$j-t$$BPE--Rl$$Ut_,$x:? $u&1x:tHP;T$| $8B$H?u H?8D$ 8:=8+UPQRzd?4$hHZB$:D$ 8:,+PQjARn6jjjV*^[ffffSWV[|$t$u _,I,PQj6R61hPWV`*^_[ffffS[Þt$j t$t$[fffffSP[mD$ L$T$$RQPK}[ÐSVP[<D$L$T$t$4$VRQPe}^[fffffffSWV[|$u _,,PQj7R5jWGHO~ H0 WP7jW^_[fffffSP[}D$ L$T$$RQPk([ÐSVP[LD$L$T$t$4$VRQPU&^[fffffffSV [ D$,t+8t&$PGD$\D$D$ t$ex9~88-P-PFFNF )PQj,^[ÐX_L$x9 ~8Í8-ÍP-fffffUSWV8[L$Xl$Pt$LD$4u.u*-͍-g-PQhR3l$`t)|$Tu"--g-PQhR2u-VP*.VPn*E.VPV*l.VP>*.VP&*.VP*.VP)w.VP)f/VP)U./VP)DT/VP)3w/VP~)"/VPf)/VPN)/VP6)/VP)+0VP)P t9uuhl$t!j2pU xq-QPs`YRKD= 6 / ( !  l$ BPQj2UuXU\ƋD$XtPUt$\ ;D$4u 8^_[]fffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[|$t$u00n0PQjYR.F)F31uF FF^_[ÐSWV[\|$t$u+40n0PQjwRq.~uP\$wGN Qt00n0PQhR-~uр~|$^[ÐSV[t$ t ~t/F00n0PQhR.-~uN .wu^[ÐSV[ít$ u"01n0PQhR,1~t^[ÊV u.wL$~9|ԐSV[=t$ t~uQ(01n0PQhRS,~u'F u <.wL$9^[Ð|$t1ËD$ÐSWV[Ü|$t$u"021n0PQh.R+1u6T$L$9w"QjV- FfFF^_[ÐSWV[t$u"0B1n0PQhMR:+~u/L$Fy |y|9IL |F1^_[ÐUSWV[Øt$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]Íd1Q1n0PQhhR)o1Q1n0PQhiR)SV[-t$ t~uF(0{1n0PQhRC)~uNuV9r ^[ÐSV[ýt$ u"01n0PQhR(1~u(NuV9rT$x 9v ^[ffSV[Mt$ y111PQjTRg(^[ÐUSWV[t$|$u011PQjbR(l$u211PQjcR'MϸwG)o >1^_[]ÐUSWVP[jt$u"021PQhR'|$ |$u"4221PQhR['cUL$$Hn 9uЉ,$)1!)1։t$uFAPjQ( D$0D$8t p,$VPQ` D$0)p)t[uQNr-/3 $3׍1PQhRI&L$JBQjP?( D$0)r&B22֍1PQhR%U1^_[]ÐUSWV[xl$$|$u"0f21PQhR%1>0L$(#4W 9u$)1*!)1ׅt"uGFNPjQ' D$ NjD$8Ћ $)ȍx)t_uUOr./3L$3Ս1PQhR$L$JBQjP& $D$8)r*B2f2׍1PQhRR$L$Q^_[]ÐSWV[ܽt$|$tt1)tW0z21PQhR#uύ2z21PQhR#)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SWV[üt$|$tu)OσO  9 9tj9tly9y]021PQhWRa"i221PQhXR7"B 9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1VL$t"T$ tփuQ^ÐUSWVP[:|$$"T$(D$,<ȸ9D$ 4t)щʊD$$L$(l$y122$1PQhR T$L$8D$4t9|$tl$0|$ thu[r&22Ս1PQhR GRjP~" D$$L$(l$0O}^_[]ÐSWV[|$L$1uLwt?;t$w6)w*t$uQRjQ! ^_[ÐSWV[lt$|$D$Vt$PX ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [X|$$D$(t9D$ L$,ň̍3L$3L$1 $ut$t$ht$ d$<EtM9w'M )9w 8t9rD$4 ^_[]ÃD$0D$4(+T$ ܐSWV[Lt$|$D$VPt$ 8 ^_[ffffffS[jjt$t$t$t$J[ffS[޶jt$ t$ t$ t$ t$ t$ [ÐUSWV[ÕD$$$$$7$$$u33L3PQjlRifXt$pPQj ViDD$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6A$6P#)PVQV j~33L3PQjiR$33L3PQjjRw$33L3PQjkRJD$@t%% hPV $0$$pUiPQX"e9x\!PHD$$u"35L3PQhzR$$u"35L3PQh{Rtu"35L3PQh|RNt$u5$T$@PhQRW@<$D$Pjjjt"D$PjjjD$Et$t t$ jjW t$&L$U$$$t$9!D$;$uVĔ^_[]Í55WPQvS 뺍56 5 6PQ;\t$Sjt$UxjjEy5)6PQj!t$ujjx*jt$xt$Ԭt$ Ȭ萼y526u^$pQuSzP$0uP$$u6$@$8jW$5B6pQRj/V tDžtU UjPQO ^$t$u53Rj$$2$PQWV2 ^j$$1$PWV 8=Cj/V7 t!j$PQV5R6VPQ  jAUSWVh[cE$dL$u"44L3PQhRq$|u"~34L3PQhRD$u&Ǎ34L3PQhR$u"34L3PQhRt$u"34L3PQhR4D$LD$PD$TD$HL$8D$HQPj l$$D$ 4D$$D$ D$l$5PomjuD$Pa Džx ^[ÐS[Îjt$t$ [ÐUSWV[U$E$$u"33L3PQh RZ $|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQh ǸxVtuTfD$D$PW,$D$f$O/,$$ffD$UD$PW{ yQ80uN$=uW菠#,,$(Wo(,$WV,$M;$u Ĉ^_[]/USWV$[Xl$@t$8|$DD$ D$D$D$D$D$D$D$ L$PQRVu<$t$wl$GQjP0 G1t$ 4$1D$2t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿`t$ w=݋t$|$<$$t$&$$1 $+L$ r#6΍66PQj`RD$,H$$t$,F <$)ʃr#766PQj}RcF)N)!r2r&=76׍6PQhR^_[]ÐUSWV [èt$ ~NƃX+ V҉$t`L$FшT$?r?鍋+ $j@UPQH\$++ ~t0|$>L$:$u + uL$>͍ >T$1ҍX+ -9si$:9U;L$s>t 9sE.9r9s34$9h9s맋 $X+ 9s$+ ^_[]fffffUSWV[Kt$|$hUD$D$?D$D$@D$D$AD$t$ t$ [ÐS[t$ t$ v[ÐSV[8y+ jPV D$ jVPjV^[fD$ȉty!fUSWV[Èt$0l$,D$tu5#i888PQjFRuj)ƅt]UPc1 rF rLFuF(;D$u^_[]1膝USWV[õ$ $$Ph@VY~1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$_} ƅ~.V$P$P |) u84$9~8|$$uj)6ƅ~$$QPj1rF rLFuF(4$W}|$;$u^_[]1舜sS[îjjjjt$t$[ÐUSWVt[x$D$p$u"888PQhRU$$U uj)ƅtZD$\UP-1L\rF rLFuF(;D$put^_[]1UffUSWV\[È|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]Í998PQhR|998PQhR$ffffUSWV[Hnt$0l$,D$tu5#i899PQjFRSuj)ƅt]UP1 rF rLFuF(;D$u^_[]1FUSWV[um$ $$Ph@Vg1$|$$ $ u#D$P|$WһP|$`l$d$$ʃ|&jQPt$ I|=P$Pt$f ƅ~.V$P$PP |) uc84$fQ8|$$uj)ƅ~$$QP1rF rLFuF(4$W`f|$;$u^_[]1H3S[nkjjjjt$t$[ÐUSWVt[8k$D$p$u"899PQhRAU$$U uj)ƅtZD$\UP1L\rF rLFuF(;D$put^_[]1ffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[ jt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP踯 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP\ ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [T|$$D$OGD$ $?17l$ )ȃ8ܯPQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW蒻 ;D$u ^_[]kfffffUSWV[SuD$ $VP$:VPǰVP诰:VP藰:VP:VPgtwVPStk:VP?t_:VP+>(6D.`&|u} 9p D$s5L$$QD$ PVW|$Wt$V W$WVv13Lˀ6\Ёt869sр6 1ұ6\P9r1몋t$E 9FwML$$9L$uE$D$$M9L$t.} WQt$ Vܖ D$@) >PjQt$ |$$WV$$v PWV $uuWV $Wt$V$WV$$v PWV $vuWV $W|$WVE\$9tu t$P& D$@L$ ;$ue^_[]hL$$Yai qyD$A(tQS[ORjjH [1ÐT$D$ Zbj rz $z(t RPS[xOjRjCH [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[NRjjG [1ÐT$D$ Zbj rz $RPS[ÞNjRjiG [Xt@ffffffSP[mND$ L$T$$RQPh[fffS[>Njjt$jt[fffffffS[Njt$t$j{[ÐS[Mht$t$j{[fffffUSWV [èMt$ uDW:$:PQjw ^ffffSWV[Ft$(WjV߱ xqN|$,t?r$IJd$D?r'譲- d$!L$jWVj ^_[fffffffSWVP[+Ft$ǰtBy/ PQhRjx>L$ $/ )QVWR/ PQhR(/ 7 ht@7 ^_[fffUSWV[{Et$u;;:PQjbR蜫D$D$I@t NQwى+tՃ-!ȃƉNtu+u0u;t#>!tu:uCtPtЉ#.!tō,#.!u뼉#> t<#> 0# Ѓ'^_[]ÐUSWVX[HD|$l? D$DD$@D$ D$L$8 $)D$ $T$D$|$D$l$(Pt$0t$ $1҉l$Ht$t$jL$ QōD$P= D$tL$i8  $)D$ $T$D$D$t$ l$$T$ҋD$ t$l$$u|$,=D$0|$,=tt$0T$(;L$sD$D$i|$H|$|$jL$QƍD$P= 謫(襫8_ $)D$ $T$D$|$D$l$$T$,Pt$,t$- $T$;L$D$sT$ i|$B|$|$jD$$PD$Pg< (8 $)D$ $T$D$|$D$l$$u3ō.;΍';:PQhtR٤l$4X|$ tD$ !A $t$0¾"T$ l$0BL$<,@.D$jPWkP NjD$D$ |$ t 8"u$9r6l$4D$4jj P ; 販0諩8uQ$)l$4$u&ƍ.;';:PQhtR裣-@@+x @P0U@01X^_[]-(#l$l$u".;:;:PQhRqpt+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmUSWV׉[<u".;';:PQhtR)L$D$T$W~>Ǩlt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[89t$(l$$T$(1a,D$8tDP8)o$k0oD$(8rl$ Pt$衜ŋ$t$3{;H;PQhRQYT{;H;PQhR藞*Z0oD$8tDP8W4$2t$201UPt$ŋD$G62oD$ G 7 7 D$8tDP7G^_[]ËT$((!/A=CjUPQRVj*USWV׉L$[B72jeV]uj+VPut-1y|$WjPjEeyFu<$|$1jrVQtÒ $UWft1ju%赢07L1wA1虢01^_[]ÐUSWV׉[W67 tu0mu?ru<60FtjPgv0+u4jjg&v0tjPg60^_[]ÐUSWV[ø5t$0l$$T$081R,D$8tDPQ5g&D$08rL$ Pt$+ŋ$t$3;H;PQhRK[YT;H;PQhR!40D$8tDP4W4$Y/t$M/襠01UPt$uŋD$G6"/oD$ G 7 7 D$8tDP 4G^_[]Ët$,|$(T$0VWU. j͞USWV[3t$u";;H;PQhR,$8tDP37 t9ut@mt9uu+$8tDPL3th1V蟚Eu7 $8tDP 3|$jWu  ƃu 8tUXtt$^_[]ffUSWVH[2D$`|$\u#ƍ;;;PQj>Rt$$UVPW"tUVt$aǃu.w8uj3~;$} VPaǍD$9tLVA$jD$Pt&UPt$hW衺{D$$oH^_[]USWV4[1D$\l$Hu#])k;PQj8RD$lt$Xy-<k;PQj9R躗L$`uBtuut덻tǸtD$T$\dL$00G?L$T|$LtD$HT$Pɉ|$ xGD$Gz9иG|{ϹdkdD$T$D$ HSQ|\ϹЉ)kϜD$D$ T$D$OD$ dD$D$0D$ڸD$ dD$D$D$`L$$׃tBL$VU (T$L9v 4^_[]ÉŋD$\0l$,t)1vwL$$L$$rx|$j|$WQRt,jWRP΋tjWRP躋+щ1ɉ4$tD$LσT$(s1d;21g1di։Ńut% 44rŃu΃T$(19L$$}4$j|$WQRщ9} 4$jWQRÊщ9} 4$jWQR蝊щ9}O4$jWRPwуjWQP_уjWQPGjWQR5щ9} 4$%jWQRщ94$D$\|$Љ׋l$ D$D$Nj|$1ʹ9 d$00YRL$,ȃl$L97gfff4$ֺQ׉Ɖljҍ)|$mL$ T$ QC<4$Qt$V0WRUt$hպ$4$jjdQRωڈƉр|$ul$э8<4$t$$t$QPRJ4$l$2jjdQW~ыT$ t$r8<4$Rt$QPVt$dVt$d 9wjWQRщfffffUSWV[e+$,$(D$ D$D$$u)=o |$$t$($PRt$tS1ɐftsfTLLTftWfTLNTftMfTLPTftCfTLRut:N,19tDtP8t$FP&F^_[]ÐUSWVYT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWV։[F,F tvFUP胷l$~D$uNtQjPD$ L$$t$ F1퐐f<=PR&l$ND$YD$ fD$7 ƀ8pjWVS# uD$FDA@utjt$V+# uD$FDA@jt$V" uD$FDA@jt$ V" uD$FDA@jPV" uD$FDA@`XjPVe" uD$FDA@91=jPV2" uD$FDA@ jPV! uD$FDA@w"jPV! u#~=uj=VEt7 2.jPV! u/~=u)j=VEt7 7 7==V7 PQŖ7 7 7 7 @7 7 ||$#u< t< t򉳬7 1>t7 7 j VDt^_[]ÐS[~7 tPm1ǃ7 [ø[ÐUSWV׉[7u"7sGp=PQhRYl1ɉ؃"t!u$\u~"u62֍X0tրr t #t9؉뗈ws9u #^_[]ÐUSWV[0$ǃ7 7 t"P<;$D$ D$D$D$$L$jjPWjQ{%t=\L$WuPhQPW'7 mPu7 1;$u ȍe^_[]fffffUSWV[$$u&>>=PQj_R%j$$tuo1D$$tŋD$3l$ h@PYD$(D$$D$ ^L$L$\QP@RtYD$|$D$0t$\ d$<0fD$PPjuV D$ $D$1j1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tW'PWu uh)D$Rl$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0J D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$5>jPv u|$1D$Wt$辘Ƌ$6yd$t$pD$|Ay DAD$$uD$*pՋD$DJtDHD$D$ $@uP p DAթD$jPD$pl0jPD$p{ D$ |$t$ztG$`L$tZ5>jPq4@jPD$p /1ҋ$tjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1LD$ 1H1D$ D$D$8h< hY1D$ D$l$t)hD$D$\PjuO |$~h8|$ $%|$tjPu |$t&?hD$u|$"h8|$ $tt$Dtu V\fgt$jl$ Ud 1$u U;$u!Č^_[]Ë|$|$[|5S[njhjt$t$t$)[ÐSWV[<7 t-7 jhjVPt$$t87 0jFc7 7 tP7 u^_[ffUSWV[û|$u}>q>9>PQj>>PQjER ^P>>>PQjFR],D$,D$D$ l$_e^_[]ffUSWV [X>P'Bt\ƀ8tUT$D$j PV  tŋT$t|zt)>VP腗1ɿBkP&wA@ʹ&uB@9~ $ ?jP,$&?VPՖT$t$$D$ t C?7 RUPjQqL$ t>7 ^_[]ffSV[8 u*ǃ 8 fPV\8 tt8  VP1^[ÐSV[mǃ 8 8 tP舘9fPVۇ8 u VP1^[ÐUSWV [$ǃ8 ǃ8 ǃ 8 ǃ8 ǃ8 ǃ8 ǃ8 $8 8 hhUٔD$ 1Ʌ$t$SL$< $t$ 8 L$l$<ǃ8 8 hhUpD$  8 t$P?j\WVH t8t剃8 8#tj\WVH t8t뉃8 j\WVH t8t뉃 8 j\WVgH 68t牃8 ǃ8 ǃ8 j\WV'H tD8tP8 j\WVG t8tP8 h8 |$$W |$j\PD$ PG ǀ8tWu͍ nUWPthUW|PtTkUWhPt@tUWTPt,yUW@PtvUW,PQ8 E5xxMf l$<$j\WVF 8t牃8 8#j\t$VF t8t艃8 j\t$VtF tOǀ8t扻8 vPWcO"8 tPWEOtbH`8 D$f? 8 PQ蛑 8 l$tэvQPNuz 8 <$j\WVE t8<$tPB8 j\WVwE X8<$tP8 t$t$1ɋ;$u ȁ ^_[]SWV[t$u"D?P?PQhR:Vǃ 8 8 t P (fPWe8 t,t+V8 Mu䍃8  WP1^_[ÐSWV[\t$u"D?P?PQhRzUǃ 8 8 t PM(fPW襁8 t,t+V8 Lu䍃8  WP?1^_[ÐS[Þ8 tPUǃ8 [ffSV[mt$D$ tu)t! tV@P t1BZ^[ÐSWV[ t$|$PWKt&V@PWKt Y1t 1t^_[ÐUSWV$[Õ$ jj$H$DDžtu!qY1Ƀ8-ىL$m|$dW|D$KWP$H$D5D$&h{|$4$l$t$ D$1t$ D$,8hUPVVl$D, jjV$L$H;D$$~UP*l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11P4U+;$ u,D$$^_[]D$ʋ4$t$ l$1?USWV$[e$ jj$H$DDDžtu!AW1Ƀ8-ىL$m|$dWyD$KWP$H$DD$&hy|$4$l$t$ D$1t$ D$,8hUPV&l$D, jjV$L$H;D$$~UPl$|$UPV$LV$HfPt$VW$L$L~9u`|$D$ǃ;|$.$D$?11PU;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[5$ jj$H$DDžtu!U1Ƀ8-ىL$m|$dWwD$KWP$H$DD$&huw|$4$l$t$ D$1t$ D$,8hUPVl$D, jjV$L$Hb;D$$~UPʁl$|$UPV$LV$HPt$VW$L$L.9u`|$D$ǃ;|$.$D$?11PԆUˆ;$ u,D$$^_[]D$ʋ4$t$ l$1USWV[ |$l$t+PWUD uu^uڸ^_[]ÐUSWV[ë|$l$t+PWU uuuڸ^_[]ÐUSWV[K|$l$t+PWU uuuڸ^_[]ffffffS[0t$t$N [ffffUSWV [ñ} F FEFUVzRu)ʃԉF:FJFx9uRu赊N ;Nue^_[]USWV [} F FEFUVzRu)ʃԉF:FJFx9uFpRu N ;Nue^_[]%ffSVP[\D$L$T$t$4$VRQPuffSP[-D$ L$T$$RQPGfffffSP[D$ L$T$$RQP+HfffffYT$t :t|1ÐUSWV<[Øt$PD$D$8uD??PQjhRI|VPQl $< hjD$PK ,< D$ $;< D$ t:t|tD$ 9r<< `6d.h&lptx|)f(< t$ S}UPt$b~ tD$ T< P< \< UPt$0~ tD$ X< \< `< lUPt$} ftL$fl< UPt$} ftL$fn< qUPt$} 1tL$fp< UPt$} tL$fr< aUPt$V} tL$t< UPt$.} tt$x< ֵUPt$ } tL$< ~UPt$| tt$< fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&< aD$ `|$4&L$ qL$%L$)L$-L$1L$ L$5D$ PWt$0| tD$ UD$,Pt$| tD$FUD$0Pt${ 1ɃtL$Nt+D$PD$4Pt${ t D$1vF UD$(Pt${ tD$ 1L$ F L$ D$ PD$(Pt$uL$ L$ t$L$ u&5=΍@?PQhR@1PQ`t0Euዃp 1DJtVt$F t$ yL$ L$ l$|$4=D$ f< fD$4dxD$6D$50UWt$xz 1tL$< D$51UWt$Oz tL$< D$52UWt$(z tL$< D$53UWt$z tL$< D$54UWt$y tt$< ǃ$< WEVǃ< WEV4$xL$D$;D$8u ȃ<^_[]fffffUSWVP[|$!L$Wك</@t)9v"9vH8/u)t\9v N8/@tvlj= 9thUWVՌƄ+= ^_[]À|$/t!ÍffffUSWV[l$U#tNL(p1DJuK4$CD$j PUVt }t֋L$9tJ9tEC^_[]ËLJ wӍ<(P@눉BC8"u rL$ <$։q1늾=3ffS[j t$ [fUSWVP[êt$!tttnL$VtH|/t|$/u29r9vzz/u)ρwA hUPVÊƄ+A ^_[]fffffffUS8[ED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[\ƃtk|$|$uP1uPjjP t8jPjWjW|W^_[j?fS[îD$t=u@[t$ P[SWV[l|$t$uY=U@@PQj1R:WhV ^_[fT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[[Ḯ̀rS[ô[ḭ̀rS[Ô[̀ffff̀ffff/̀ffff^̀rS[D[̀rS[$[Ḥ̀rS[[<̀rS[[̀rS[[ḇ̀rS[ä[̀rS[Ä[ḓ̀rS[d[̀rS[D[`̀rS[$[R̀rS[[2̀rS[[ḩ̀rS[[P̀rS[ä[ḷ̀rS[Ä[Ḷ̀rS[d[ḉ̀rS[D[̀rS[$[Ḛ̀rS[[̀rS[[Ḩ̀rS[[1̀rS[ä[Ḍ̀rS[Ä[òrS[d[ìrS[D[l̀rS[$[t̀rS[[s̀rS[[r̀rS[[p̀rS[ä[j̀rS[Ä[m̀rS[d[̀rS[D[Z̀rS[$[ ̀rS[[S[[ᐐ*̀r׋L$Q1fffffỲrJ!Q9fffffS[Î.6SV[mE tFE PjetsE 4+E 4E E R+ ^[ËE HE jjjhjPj薹1tȉE uj$Pj^ j7S[îD$E );E t Pk[à QP誸[ÐS[n,6jPFE uPv[ffffS[.Pt$t$t$ [ÐUSWV8[uD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$ypDP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ PPt$t$ ZD$x$WrPt$W @D$x$WGPt$WW )D$x $WPt$W, D$x$WPt$W uD$x$WPt$W zD$x$WPt$W `D$x$WpPt$W <D$x $WEPt$WU D$x$$WPt$W* D$x($WPt$W D$x,$WPt$W 1D$D$$T$EHL$D$D$D$ P`Pt$t$m D$@D$ P/Pt$t$<  D$@D$ PPt$t$  D$@ D$ PPt$t$  D$@D$ PPt$t$ D$@D$ PkPt$t$x D$@D$P:Pt$t$G 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ : |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ [@D$ d@|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$m@|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VRD$Pt$V` ID$ V#D$Pt$V1 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP8 =L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$QuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$A(|$€´|EFt P@F tX~tI1퐐t(0@F t((@F t( v@;~s F @ƋF PZ@F,t PJ@F4tP5@F8t P%@V@^_[]fffSWV[Üt$hWqV"ffUSWV[ët$|$l$UW0VnffS[~tF hjP xH tjjhP$r[ÐS[.tF hjPp xH tP]ǃxH ƃ|H [ÐSV|[ښxH tMtF PjhV*DH HH HH LH rCPV-xH u?CPV,xH u%PV,xH ƃ|H PQPD$X D$\tgtF xH jhP*utmp3tF xF x fG uyzF ЉxH |F hjP tF fǃG ǃtF utmpǃxF x-2.ǃ{F .00xH jhPdtxH tF hjPk 1|^[ÐUSWV[|$u"2D)DCPQhR 1fFt_tF tLG tFQfrQfw(f9uwF ;G u^_[]ÐUSWV[;|$u"2D>DCPQhRY$F tF  t"G fuj WUޱ u1^_[]ÐUSWV$[å$8$ t$tBTDjPQg( tMxH D$ hUPZ 2DIDCPQhRk#xH t*|H D$ hUP zx|H ktF hjP W ǃxH ƃ|H D$ hUP xH 1|H $RfD$,$n~ [t?G tfrfw(f9uwȋ$9F uxH tF hjP? u fu2tF hjP jjhWlftwD$,$n~ t]G tfrfwFf9uwȋ$9F ujjhxH luKxH jjjPPjjjxH k1ɾth̓u$$|$ xH jhW1u(xH /ttF hWV u$xH jjjPu1D$;$ um$^_[]Í|$ h@hUWu1譞tt=L$jQPg tD$utF hUV 藬DDjWPQq9jUSWV[ë|$l$tKtmh@UeƃthWV V1lDcDCPQhWRzu2DcDCPQhXRTlhh!@Ǔ ttƍ|F hjP/ tF fǃG ǃtF utmpǃxF x-2.ǃ{F .00hPV3  8V:8^_[]ÐSWV[\|$u"DyDCPQhxRzW職1=w[|8xuThWP tF hjPF xH tP.ǃxH ƃ|H ^_[ÐSWV[ìt$|$tHtjON FG$O(NGDOHFNGLFGPFN$F ^_[ÍDDCPQhR~uDDCPQhRXoSWV[t$|$GO NON(F$GOFDNHGFLGFPG O$džPhjP džHdžDdžL^_[ÍDDCPQhRTDDCPQhR^-USWV[t$,|$$jjjh@WǍD$(D$D$ L$jPQWW 1|$uhZƅtvht$Vh `DDCPQhRRDDCPQhRX+1OWW^_[]SWV[َ|$(t$ tbjjhh"@VƍD$$D$D$ <$D$L$jPQVVVVRDDCPQhRuDDCPQhRkY^_[ffUSWV [|$(|$ u"C&EDPQhRT$,u&,E&E֍DPQhRuJ<֋L$$ЋD$ \t < AnZЋD$ c-t^-?D$ )?tȋL$  %0T$ Јʁ0T$ 7pLBupLByppTHILH t   pDPutʋL$  Ј  = D$ #rѸ;apDP0t$  QЈ0T$ T$=suD$T$ DA`%WD$1T$D$T$ӁTT$D$;u1T$ʀcw=ށƐ|$uT9T$*9tdu|$duq ЋL$  pDButʋD$  ʈL$tPL$ T$%ЋT$  Ȉ|t!&u g˗L$ Mt=u >1(pDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsUSWV [l$(t$ D$D$ |$$El$ߐt$,D$PUD$P|u$D$͐|׊D$l$EjD$ w"`sD$tmD$t]+t$ GE;EDPQhRSE;EDPQhR-;EDPQhRr ^_[]ÐS[.t$t$jt$ [ÐS[jt$jt$[ÐS[΅jt$t$t$[fffffUSWV[ÛH |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉH uj( ƉDl$UЅtwn$Nj 0Q 1H utjh=lʼnH 0ƃH L̅tMjуH @1t*n$FdUQj P|$z^_[]ËH )USWV[+H |$i)Njtt+~%L$9N$ut1Ƀ|$tΉH uj(ƉDl$U؅twn$Nj 0Q蜩 1H utjhʼnH 0ƃH LԅtMjуH @1t*n$FdUQj Pq|$z^_[]ËH )USWVP[úl$UNjH $tOs;1҉vH ljh=H $uƃH D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0H tuR:̅t!jуH tiE$SH uj(*ŋ$,tIEj |$WPA W܅tE@E$L$1E^_[]t$܅t@ϐUSWVP[ʀl$UNjH $tOs;1҉vH ljh H $uƃH D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0H tuR:ԅt!jуH tiE$SH uj(:ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWV[~t$|$ tЋH t61=tDtPǃH D$L$ƃH H t?1=tDtPǃH D$L$ƃH ǃH ̅܅D$ Ѕ1^_[]ÐUSWV[}t$|$ tЋH t61tDtPǃH D$L$ƃH H t?1tDtPǃH D$L$ƃH ǃH ԅD$ ؅1^_[]ffffffUSWV [ó|u EMD$$L$ D$fD$w6Ef ffT$RQPv Ha6fD$QjPv t1f|$t |$җ9u e^_[]#fffUSWV[{$tA$1uh ƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/xh>X?USWV[yt$tD$tdPV$xaa1ɐ΍,?UQt&UP#y.w8"tV 1^_[]ffffUSWV[{xt$V辝H P6H ƃH p tj~V:u^tVtDi@u\uRDQ@u말:u~u'H t PǃH ǃH 1 ^_[]ÐUSWV[[w|$t$L$W91:u?8u(t$Ր}^8uuu@tp:ute:u^])JJPQhR_KJJPQhR81~@t^_[]ÐUSWVP[Jv|$t$u"])KJPQhRdl$ tt=jUjWV^_[]ÍKKJPQhRuÍDKJPQhR럐USWVP[Óu$LL$8u"KKJPQhR$du"KKJPQhRu$lu)KKJPQh RH$|$pu)DKJPQh R$ t$ l$4$h\$H $lu)D)KJPQhR$|t$tx8t$tD:;|29v&t:t|u싌$lh$ $L$1xjjjU t$eKPQh|$XWjjjh@WSjh@u'm D$jl$|$(1ɍl$L1$D$D$L$$AD$ ЉL$L9rT19r=|$T$\$hQl$ Uil ƅ,4LT$|$< u|$$tT$ $1s$#gT$$lu-\$D)KJPQhR$|$tX8t(a:X|O;$v<t:t|u싌$l듋$$$L$$t1<9< t+< t'#<:t <\ut111D$9;|$L$$T$ $)\$PL$Q T$+$‰$L$$|$|$t UkD$$t$t|$(G 4$T$\$t$ |$(l$$ppD$L$,4$|$(D$$l$T$<:u>tuk{D$_؊6U8u Xuuu@}=uUt @fƀ:t FuFT$L\$t$$Ut$ t$4 \$,L$Lt&u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:D$\$L$ щD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVPJ Wt$DU< t$ t$, 4/L$,\$t$ l$T$|$t Ui<$ЋL$49T$v)RW uW L$81Ƀ|$D$|$u04$W 0H Pt$ t:H PD$H $D$D$ V4$ $lu)DKJPQhR$|D$,P腒l$,t$ \$D$0jD$HPUWW t$t&t$D<u/t$,D$Ht$ Ľ\$WW<D$\$V D$hUt_UVP* WWxz1ɊD$D$4T$D$8(D\$4$  |$\t$fKWWI t$ ;$Lu|ȁP^_[]0Uǃ|$\$t t$f4$A t$ 믋\$U, |$t\$t$hf\$t$, bNXkL$ÐSWV[\kt$|$tatY8t1t0:t+|t&9vt:t |u^_[Í]))KJPQhR}D)KJPQhRVSWV[Ìj|$t$tGtiH tPǃH ǃH ƃH ƃH WV^_[Í])4KJPQhR_uK4KJPQhR9pS[iH tP#ǃH ǃH ƃH ƃH 1[ÐUSWV[Åi$,E$$$(H uH ȋH u!Q0H 7H t%1H H PQ1t $D$uz1H V7VǃH H HH @QPH u8/>9v$uP FN8D} .~ wF F P[BuWv V tŃ~?:}|@uH)ƒVԍ=CF F BBQWP uvv qU ?~?:uF=~t  8u F,;8u e^_[]NsS[~Z0t$t$ [ffUSWV [AZ} F FEFUVzRu)ʃԉF:FJFx9u0Ru=T N ;Nue^_[]crfUSWV0[ÓYD$(}̨PQ6\H t$M L$ML$f|$ L$T$|$QRj WP1uOt$ rF|$j WP u0O L$FD$D$ PjL$Q2 79_t$} urL tgM9uWM % L4 QPR}Wu19r"y";L$(H 8jjP@ PJD$t$ܼL$ WIt^fxHuHPQ$3U q 3u uًI3Muˋpjt$Vq uEPVu} ;EsD$t$W+HL$%D$"T$ ;UwRPuf 1ɋt$;D$(u ȍe^_[]oS[.WKjP*H ^/h P;>L [SV[VH hVt$t$t$%t1^[fffSV0[êVt$DD$@t2D$D$ D$HL$ $@D$1L$Tjt$t$d [ÐS[Tjt$t$t$V[fffffUSWV[S$$$5$$DŽ$DŽ$$jP)S$8jPSDŽ$PDŽ$TDŽ$XfDŽ$l$`$pVuxƅyRKHLLPQjNR@$d$t$$$`U$$PO;$u\ļ^_[]ÍxHLLPQjGRʸ$SLHLLPQjHR蝸k1ÐS[.Rt$t$Pt$+[fffUSWV[Qt$|$l$jU輝WVPUjjU譟^_[]ÐUSWV[ëQt$l$ |$jWlUVt$ WjW`^_[]ÐUSWV[UQ$$D$D$tF0u ǀ$D$D$,D$8D$ D$(|$ yOL$ $P٫tRF$&D$ FF V腹uWP蒫u뉐%$1틼$% $Bz ,HЃԃ $˃ $‹$tU% @뛁 $룋$z| $넁 $u $ fJT$ F%D$ FF VUuWPbu˺%~V(9FD$ T$ D$~;%T$ $T$ $7T$ $'D$0<^ZBD$0T$ NT$ $ $D$~T$ T$ D$D$(~D$8 $0@D$T$ T$ $D$D$(~T$ $D$D$(~T$ D$~T$ $D$D$( ~T$ 1ɉl$ύ$hPQ_ D$004D$T$0‹L$L$ T$"L$$D$D$$A-D$ D$0-<]tL$$D$L L D$L L $WU[P h1qD$L L $WUP yLjL D$L $WUO D$ 뒄tT$0]tD$ L$ $ D$l$~ V誴9$ ui$WP覦WP菦D$ t:FHN}VO$$D$T$  оt $ȃVRjD$0jL$D$ b1 D$ $D$b8|$teFAOL$D$tF~VZ! t L$FPQT$D$uD$)ϋL$ȃD$,[ 1 ŋ $D$c8|$Q $PԤu3FHL$QT$t~V聲tL$D$ȋL$ )L$L$ D$,E$L$=r $ ՀMs ɋ|$( Z $$? L$(KL$($$? $@  $T$(S $$?L$(l$,$ $9L$ ,$D$(l$W$с|$(tѺuu?tT$(t? $T$(L$QT$FHNV諰 E=r$D$ ,L$$$uD$D$$D$ D$D$0D$~D$HD$WP֚$ND$D$,:|$L$9s&ȐVPd9rG$) $u0u8L$$QPA D$D$T$ `L$$QP? D$8|$d|$0i$D$D$,D$W9D$l$T$jFT$L1 󫋼$$WRl$,UPt$((tl$t%D$ D$$D$l$~UBD$1WP6$uD$D$$D$ D$~V辦JWPǘ)y+LLՍ_LPQhR蚣F)׉FL$$QP D$8T$ t 9l$D$D$,u|$gD$T$ ub|$L$,D$|$$L$ VPr=D$T$ |$ GL$(D$<$EHʀ߀X$uD$VQ] $uD$fxWt$,jU)D$eWt$,jUC $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$|$<VPrL$׋T$ f|$Q||$|$ D$T$ D$D$8E׋T$ fD$9׋T$ L$ ׋T$ @݉T$ @L$ _L׍_LPQhRܠfLL׍_LPQhR讠;D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VP褢RfffffffUSWV [9l$$T$ 8u}jU|}0u LJE T$ uGmt-U~WE EE}0T$ fE ʉ $7tFO9M}f} _M֍LPQj`RB0%fE EMt\9vX8PuSEElE@9tj< WVL$sƉ|$NjD$PVW~ E00L$H_MMt .$ tEt@u%ON-MPQjJRKE@NT$RQjjjuЃ>T$u-OONPQj[RT$,$ t|$ tEtHHu0KO2O׍-MPQhR譔|$0EHHPVt$0t$0WRUуt O0$^_[]ÐS[.Pt$t$t$t$t$c[ÐUSWVP[-l$t$D$ $ t t@8u'OO-MPQhRד@8QUVwЃt 臙0$^_[]ÐUSWVP[J-l$t$$ t t@8u'OO-MPQhRE@8QUVwЃt 0$^_[]ffffUSWV[û,t$l$SyPQWʾ t"t$ VW( \WjjPkU PQW芾 t$^fffffffS[.,jt$t$t$`[fffffUSWV[+l$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]NDUSWV8$[p+$L$4u"6P*POPQhR|$PD$u,$Pt"EP*POPQhRAt$$Xu"dP*POPQhR$Pt$Pr軖 9FjP'D$tk|$jWD$(D$ tND$1ɅujWt3L$$\$T@u%t11|$l$r1҉D$L$ |$41 tw|$tE9sP r L$4QPUWx9!xt19)u|$T$$l$);$Pw|$$Xt$,VND$jPtT$1 T$|$$T@uW$L$,Pt$ QWvt4W$t 8D$1D$(vt$,L$ɸttQȃ1Ƀr8T$1ɐ44t tt tt t 9uӅt!1ɐ449uD$l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@|$T$L$Bl$L$T$ jWPjU1xL$ȋ;L$u^_[])8USWV[[|$t$t VD1BL$1jUWPV^_[]ÐUSWV[ |$ t$t VND1BL$T$jUWPVN^_[]ÐUSWV[û|$t$t WC1B1jUt$$PW^_[]ÐS[nBL$1jPt$t$t$[ÐS[.BL$T$ jPt$ t$ t$ [ÐS[BL$T$ t$Pt$ t$ t$ ?[ÐSWV[ì|$t$WOuGكs^_[!t_t$t%<FF ^_[ÐUSWV[+|$ u ^_[]l$ t$Wtt t- t(W]tWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[x|$0t$,Wt$@{D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv <$|$Dփ 6D$4)D$4@u \҉L$x MVt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/pDPg%0W$\P$D$4@uWu#pDxuGws>4$$^_[]ËD$4  !rfUS [5E$D$D$D$PQD$e[]fffffS[t$ t$ [ÐUSWV[õ$$%= uRl$ 4$bƅt<9w㍃*QPPQjR}GÂ=r6D$,h1uDžtV;9w ‰ щ ȉ  σWl$uƉE}M(tXPޤZ$t1ƒYL$,PP@T@,p@ @J@@ @@D)D$QD$ 112fOH|$4D$,$t$Wl*t$$U:ƋD$H(L$tXPǍHTD$t17YGPPUQZ w,L$AGG GJG GGGDD$GoD$PfGt L$ y|$ 1l$9Dl$[|$4l$trVP$$M(tXPt tU1YE<$twWut$uVU1^_[]ÉYT$HP@T@,MH@ @J@@ @E $Hf@H u&!jh@P T$ EuM(pRR`USWV։[G(u2nPFJt3fD$9j|jUz El$FJu̓N $UQYY~8UvuwB~f zZsVQPPQhRGxF7sVQPPQhRxUQNt(}8~ j|jUz f Ą^_[]E%===@EM $N1~(Pw,to‰4$D$4D$t$@(ueO@4u\D$0D$(D$D$$31fGHsG D$4l$L$ $Љj0 t9D$"D$ <u SsG OJEsD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDRb)l$ǃt$<)l$ D$8D$D$14$D$Lt$)DžN( u" .uGt<.utʐL$tXw PōG UTD$t1 .YMPNQPT$ RK u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HR4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$m1Zs>QPPQh1RgD$u‹.l1F)EHftf },$FtpPu|$t$u N)$xDuW@8/tOF(uI!jh@P tFFU $U<$u~ljF^_[]FUSWV[t$uQQQPQjBRe,}t v$u>VD }t!v$Sv$Hv$躞V豞W^_[]fS [+PQt$ t$ ,$ [ÐS [t$Pt$ t$ l ,$ [ÐS[þL$T$ P[ÐUSWV ׉[ÄT$4tbq=t= T$4t=uD T$41 L$L$L$L$ D$l$ L$RPQUWV=uj"كܬTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[nL$T$ t$[ffffff̀rS[4[̀rS[[ ̀rS[[SWV[|$t$u7sRQPQj*Rb9tt F9u1^_[ffffSWV[||$t$tt1WVjZ^_[ÍAFRRPQjBRbuύAFRRPQjCRdb뮐SWV[|$t$tt1WVY^_[ÍAFRRPQjBRbuύAFRRPQjCRafffffffS[~L$T$ Pt$ [ÐUSWV(T$[Bɉ\$u'v(QR(\$PQj?R_a\$t$@|$ |$<t9D$<|$ "v)g1t$\$VPU\$ u+t-t D$ 1D$t$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[[USWVXX$l$x|$lu"$"vdS.SPQjwRUL$ttwF$[$tdS.SPQjxRU$vl$p1 D$͉L$4A$P~D$(u'$t,.SPQh"RDUT$tЃD$|u,$t}S.SPQhoRT$؃D$ JL$l$ |$lT$tL$l$ щˉL$9D$ ;\$lL$xvߍ4$WVуD$ ~L$tt>1ҋt$D L9u׍*t$t)փ|$r؉΃|$r1Ґ ,, LllLLllLLllL9u4 t$4l$(.Mu$oS,.SPQh#VSjP}SPQhnV$iS$3ȉƅu4$tL$}S.SPQhoRSL$ $D$,l$ /؃L$JL$݉D$ \$$!D$T$tl$  *ωL$9w"ސD$ ŋ|$9ߋt$xvD$$WP֋T$\$,D$ ~L$ttE1ҋt$D L9u׍*t$t)փ|$rЉ΃|$q1Ґ ,, LllLLllLLllL9uD$4|$( l$ /L$<|$l$PWփ8t$,ىL$0D$T$tRD$8L$(L$\$|$$D)L$(D$L$T$tD$4L$(t$,t$|$$9.9D$ NjD$84(L$$VW$L$8(L$D$,;|$$rÃ|$ T$tL$(\$t$,D$4;l$ XD$<.+|$lσ|$8D$tt71ҐEL5MD59u.)֋L$(|$re *փ|$rW1ҐL,l LllLLllLLllL9uՋL$(l$ T$tD$4t$, L$t$ 9D$ |$t$ D$|$l\$t>D$ L$ ȃL$t U0uuD$0L$t9rދl$ ;l$$D$ $UP$\$L$<D$D$ |$t$,9W<$VW$L$0Ȩuˉ+D$lD$(T$\$0tL$tU7uuߋL$t9rk|$l T$tD$4L$(4ȃ90rt$<T$HD$ ‰$D$4|$L9|$lΉx9։|$LtՉЉ|$D͉L$(t$@D$P&D$DBD$DD$PՋT$T9tl$$ŋ)4t$9t0t$T+t$@1D$09l$$;l$Y9Qt$$VU$\$t$~ \$0l$1҈ډT$|$ T$t\$ 9؉t$8L$l$$$Pt$ D$4$T$|;D$~9L$,i\$ 9L$$Pt$ D$4$T$|;D$9D$t$w>t$,T$tt$9v(t$$Vt$ $;D$~ЋT$t9w؋L$,l$$96$Qt$ L$ $;D$*T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ sj$Qt$ L$ $;D$~bT$tL$;L$ s>$L$Qt$ $;D$~6T$tL$\$ D$ D$9l$^D$T$tL$9l$B|$tY9r1ɉl$H9u)ω9r1L 9u:D$ l$$49v$L$$Vt$ $;D$~ T$t\$ D$T$tбL$9v\l$$T$tl$$9v?\$ )1$Ut$ $;D$~T$tl$$\$ 뺉ًt$89l$|$tIE9rl$Ht`1ɐ9u)DE9r1  9uNjT$0Ѓ|$<T$0NONONONONONONOu]Ѓ|$<T$0rPMMOMOMOMOMOMOMOuD$L$L$ 99s9t$T$0d$Dt_|$L$(t$@t.9r9rL$(t$@|$\$t%E9rE9r|9u$t$4VWh $Q'1X^_[]ffffffUSWVP[Ú|$,8tqw$hG$t,GO4$6tV1‹n1 uV ;Wuj"oƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW" u$^*jU!t@ PVWV" 1ZH8t uLHCH $tD$ 81^_[]fff̀rS[[ḃ̀rS[[SWV [ùt$ |$uD TSPQj񐐐9t uD$))t8t)Pt u+D$ P^_[]fffffSV[=L$D$T$ y9TRVQPYC6Q4P 1^[ÐS[D$y%9TL PQj@RB L j@4R L [fUSWV[{t$|$uA-UTPQj?R=l$tt41 |t$t$ t$ Wg uD$ <=u.|$$ M 9ttD$0M M9u;M s|9v9tfP;lǃM ǃM $jWP 8088uyPD$0t$ )$jWP v80o88u4)  $PjQ4 $M L$M ^_[]ÐUSWV[M tM 1t0̆DtPVtM Hى|$̆jjD$P tE t5jVt$ F:M tVt$VjŋD$M 9tPjǃM ǃM M UjPL3 ^_[]ÐUSWV[81tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[Z|$1|#PWtfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[í܆Pƅt50^[ÐSV[m܆Pƅth50^[ÐSV[-܆Pƅt(50^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[ÊD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[(D$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[èD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[(L$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[hT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t'GQjjWPVnu1^_[ÍW{W@WPQjGRf7s{W@WPQjHRgBfffffffUSWVP[t$ D$8Vt$K1;L$$wD$(q D$8 $t*twWt$T$4;4$sc|$(uVD$tcutZD$(PjHNjD$8uW\VPQ1"D$8ut$6O^_[]ÐUSWV[|$t2t$l$VUT$,tt$ u1^_[]ffffffS[Þt$ t$ [ÐUSWV[u$$$t$Mtd$)VD$D$l$PUV p D$$ht$jUI@L$u$1ҸD$D$MEf}T$ twPUV* f}D$9 $D$PU$jo z $k.|$D$D$L$PQ|$WRVy x4D$jPWt$V@ xD$$|$33Ƌ|$+͍D$jPt$t$$ y(;$u Ġ^_[]Nfffffffh̀rS[t[WV^]D$L$|$T$ :tPtrJJ B^_ÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ A ÐSWV[Üt$|$O1)rD$OVw P w ^_[SWV[\t$|$O1)rD$OVPw Ͼ w ^_[ËL$A +AÐVL$Q qt$ Q1)| q Q^Ð1ÐÐ1|$uD$ L$IHÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ Q ÐVL$ T$r1)r rB J ^ÐSWV[|$t$t*tIWVzt\GhWPV FWWWPQjWRuKWWPQjXR1^_[ÐSWV[l|$t$tt3jWV訖 ^_[ÍWWWPQjgRuu͍WWWPQjhRR묐USWV[|$l$WUQ1GOhQPUo UPED$wPWWWWPQjwRzWB*WWPQjxRS8WWWPQjWR,KWWPQjXRGPl$UύtWU辍^_[]ÐSWV[||$t$t>t`WVt(truGPVnt WV][1ZWXWPQhRXu%XXWPQhR2yWVp^_[ÐUSWV[û|$t$tnu">X0XWPQhR WV觌t3oUVt"}uG jQWPVb1^_[]ÍW0XWPQhRg ukSWV[|$t$tt?GG>tP1^_[ÍWKXWPQhR u0KXWPQhR WV觋tGPVtGPV腋tG PVtkWV_[USWV[t$|$tmGou"fXtXWPQhR Eh0XXWPQh$R qfXXXWPQh%R Jo t6tXudGFGFfX}XWPQh R: uGFG3Fn<Fn* GFG F   ^_[]fS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffffìrS[ô[v̀rS[Ô[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[|$l$uAXXPQj:R t$tu9#XXXPQj;Ru7tiFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1USWV4[$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋ|l$1 r$Xt$\t $X1$Pf$TWՃiriQVP8 ,$$XtY$\tOFXl$0PQjUQ/U8$\9ȋ$QU$` FfNnqQPR$`U$`.1Ʌ9$Fx$P$T)XPURQ.*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LnqQPR$`$`-l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`hC~$PEDL$BMYPQ|$W$`U,t;$Tg$P$T)D$D P|$Wt$L$QRR,L$)D$D Pt$t$t$R,L$)D$D Pt$t$t$R+L$)D$D Pt$t$t$R+L$r)D$hD Pt$t$t$Rn+L$9)D$/DPt$t$t$R5+L$)D$DPt$t$t$W+19D$F$PED$1$1BD$ D$MYD$׋D$ tD$ $ 1QPt$t$Uy*H)D$>Ń19t$un 1f$PL$$T)fv fD$ XVQURt$*L$ ;$T$pUT$0L$RQPW#t(8W$\9vpD$0Pd;fǍX$0PQhWs)WZ$\9v QW$` %1QW$` D$0PhdFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P[$1111 Ӊڋ6teN tFtI@r8ߋ\$:]/]YPQhcRF H1 t1덉\$$\$$\$D$1\$P`l$D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj6D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$#D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$N$l$$L$ L$덄$Pj?L$1;Bu>T$L$T$Btۋ$NF\$$T$jT$ ߋ\$IjjP5 x P^8L$$Pj`D$1uyxj%$PD$8($'L$8$)L$D$D$P$t$W7$(t$D(D$uD$uL$rL$$L$r93|lj$$Pj$$W7(tGo\$tP(؋\$$$!L$$$PRt$W6T$vu4D$ 8\$$ЋD$ D$87\$t$8MDž}l$$D$ @xuD$ @Džu$]]YPQhuRD$88tqGPZfD$>PZfD$>PZ f|$fD$L$f"D$<|$h$!VWt$@9rt$ 1)ƋD$ȃWVP裐^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [B|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWn ;D$uY ^_[]Í9/^]PQhR,|9/^]PQhReZffSP[ÝAPt$1Ƀ $ȃ[ÐUSWV$YhAt$8D$D$ L$p1DKNl$\$1Ҁ0u.N [USWV$[>D$<L$ |$8PD$D$D$D$D$ D$D$$̓+r4 ʊ0̓+r ut+ɉ r t Hu)1Tt8t;L$ u$^_[]{VfffffUSWV[å=$$$=\$DŽ$DŽ$$jP<$8jP=DŽ$PDŽ$TDŽ$XDŽ$lBh$`$ptx$$DŽ$hDŽ$t$`PVQRt(Ƌ$`FP$t]tE+$pt PE{ ;$uXļ^_[]Íxr^9^PQjt 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RWjP  |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W=u Pt$l$ Uu t l$ /D$D$<F\$hPWt |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURsT$ \$WjRT$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rxs E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$sT$ L$E E$\$l$TUK/4$U8$L$$9sD$DQ1ɉȃ0^_[]D$D\$4SV[},t$ u" _^^PQh/R蛒V^[ffffffUSWV|[(,j$%1tGljPWzt)l$XD$\|+W& W&1|^_[]jjWjjUjSWX&t҃|D$ l$<$D$ƅuUW뚐USWV [H+|$$(rl$ NBCD3EB 3M t91 ^_[]Ë|$,j<Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rV-s@sщʉѺ u׋ $)jQWjK5F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj4F4~F:F:t1F;pS[~(t$t$[ÐD$@ ÐSWV[L(T$|$9W v#wG,ʃt$<u0 Ћ0,L  )r;GvD$Ot$1^_[ÐUSWV[Ø't$,~$ED$\$Pv(t$Q 9quJ $D$O_D$4$ et$ BD$<$7L$HL$D$ l$d_D$$$軲$`$ttl$$;%`t %)l$ _$D$D$@_t$L D$06vt"l$ _$D$D$_t$L D$0ut"l$ _$D$D$^t$L D$0ut"l$ _$D$D$^t$L D$0vut"l$ _$D$D$@^t$L D$06ut"l$ _$D$D$^t$L D$0tt"l$ _$D$D$]t$L D$0tt"l$ _$D$D$]t$L D$0vt$t"l$ _$D$D$9]`tL|$4t\ifL$DL$ D$_D$,$t Ɓ Ot yI u BD$4$D$4L$@L$ D$_l$$$~虅Ɓ Ot yI u BD$4$D$4L$7g6]g.gg&|gj>gLgwg^_[ÐSWV[ü |$uƁYjVWu yXWPV# ^_[ÐUSWV4[h $D$0D$IuD$HL$j.QPjzgT$PQj.jRx$tEL$PQVJ D.0;D$0u 4^_[]$USWV([ t$L$-uAD$QD$ +tD$ +u AD$Qpx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$p8D_L$u D$(1ˍA^D_ukD$t P-X^_[]ÐUSWVP[êt$V#tHŃ$s 11N1ǃ11ې1ɀ<.1Ҁ|.1ɀ|.1Ҁ|.ʃ9uʅt11ɀ<;.ʃ9u>*҉ ʉ)ʅt 1ɀ|0.ʋ$y&WhEh֍ hPQhRdЃ^_[]ÐUSWV[ã}eD$|$D$ D$P JlHHPPnh0ppp RQWjV譋$r D$ƀe^_[]USWVP[l$PU~ PUfL_PUH{PU0_PU_PU/PUfjPU$ 1uRpMDHt?Ehj PU脖 *h8u$8 D$/L $ 0<HD$6t8^_[]ÐUSWVP[Úl$@PUtxF u6jjPU# 1u[pMDHtHCgj PU肕 (g8u $8 6D$t8^_[]fffffffSWV[ü|$t$jWFGHO~;G~ t H WR)jWLH^_[ÐSWV[LT$L$Bpr~ ;B~ t 2~: RQȏ^_[ÐSWV[|$(D$$u^$P3D$D$D$D$ jWEG0u ǀD$PW9jWqG^_[ffSWV[lLaHt XJtX @t XAX?t/t5GtPWu02 E49s%kjjQjhRE4M01U0)E41u gE jPQjdj$+W4Y9E47>PWu0L2 E49s)\$kjjQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$kjjQjhRE4M0QU0E4AD$i`/}$D\$u M QU Qqu It$i\$QRPVjdj$ +PW\$ 9E4<P$ +Pu00 E49s%kjjQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-kj\$jQjhR\$E4M0QU0E4AiD$#M }4E0T$WP=;jE }4;E0 E4u)\$kjjQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E jPL$ Qjdj$+WU9E4:PWu0. E49s%kjjQjhRE4M01U0)E41E HM @Pt$ jdj$+WcU9E4f:PWu0{. E49s%kjjQjhRE4M01U0)E41E E P E Pt$ jdj$+WT9E49PWu0- E49s)\$kjjQjhRE4M01U0)E41M AE  L$<%\$ jL$ L$kL$jL$*M01U0)E41E E |$\$7%Pt$jdj$+WS9E48ƃD$PWu0- E49s\$jt$jht$,D$(E4pE ;D$8}0L$jT$kT$ jL$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-kj\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru CE jPQjdj$+WR9E47PWu0(+ E49s)\$kjjQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$jVPjdj$+WEQ9E4H6PWu0]* E49s)\$kjjQjhRE4M01U0)E41|$\$E jL$ L$kL$jL$*M01U0)E41E E D$\$O\$Pt$jdj$+WeP\$9E4d5PWu0y) E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E jPQjdj$+WO9E44PWu0( E49s)\$kjjQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0Q! E49s)\$kjjQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-kj\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$kjjQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$dPQjdj$+P;F9E4:+Ƌ\$P$ +Pu0H E49s)\$kjjQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$kL$ j\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$tDD$Q|$XWu u$E? E4u0} PVu,WI**E L$))|$1ҋ\$%L$L$ kL$jL$$+р਀tsRPt$ jdjVdD9E4g)PQu0z E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$i|$X\$PVQj2jWC\$9E4(PWu0 E49s%kjjQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$kjjQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$kjjQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$kjjQjhRE4M0QU0E4AE MU \$VWu,P}$E jPL$ Qjdj$+W}A9E4&PWu0 E49s%kjjQjhRE4M01U0)E41E HM @Pt$ jdj$+WA9E4&PWu0 E49s)\$kjjQjhRE4M01U0)E41E E ;D$%L$ jT$T$ kT$jL$%M01U0)E41E E ;D$@%\$Pt$ jdj$+W!@9E4$%PWu09 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-kj\$jQjhR\$E4M0QU0E4Au wE P})PL$ Qjdj$+W*?9E4-$PWu0B E49s%kjjQjhRE4M01U0)E41u E P,Pt$ jdj$+W>9E4#PWu0 E49s%kjjQjhRE4M01U0)E41u RE E P=E E P(E iPWVQjdj$ +P=}$u E E PE E PE iT$XPWVQj2jR=9E4"PWu0 E49s%kjjQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu Wr9E4!PWu0  E49s)\$kjjQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0  E49d\$kjjQjhRE46z3D$E4D$W\$L$D$L$kL$jL$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$'\$9E4Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0O  E491\$jt$ jht$(D$(E4  L$D$L$kL$jL$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$\$9E4mPt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E49-\$jt$ jht$(D$(E4\$0}4E0)E4u)\$kjjQjhRE4M0QU0E4AC}$n }$bjPL$ Qjdj$+W 19E4PWu0#  E49s%kjjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0  E49s%kjjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0+  E49s)\$kjjQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$kjjQjhRE4M0QU0E4A gjg}4+E0-E4u)\$kjjQjhRE4M0QU0E4A}3}4E0 E4u)\$kjjQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7%j$+t$%j$ +f@======2|$7%j$+2z4|$7%j$ +r|$7%j$ +rz t$>%j$ +rz4w|$7%j$ +r|$7%j$ +rz4|$7%j$+Rt$%j$+2|$7%j$+2z4|$7%j$ +r|$7%j$ +Rt$%j$ +DŽ$ +====2|$7%j$+2z4|$7%j$ +r|$7%j$ +rz t$>%j$ +Rt$V%j$ +Ƅ$+=fDŽ$ +==2|$7%j$+2z4|$7%j$ +r|$7%j$ +rz t$>%j$ +rz4w|$7%j$ +r|$7%j$ +Rt$%j$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L$kL$jD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$\$9E4(Pt$u0: E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$i\$jPjdj$+P(\$9E4 P$ +P|$ \$ D$D$D$D$L$kL$jD$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$9E4M Pt$u0_ E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$kjjQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u E M4 U0B  ru0M4B\$QVPb"  ƋM49s)\$kjjQjhRE4M0L$M0)D$E4z|$)D$L$kL$ j\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P袨%PQjdj$+W6%9E49 PWu0N E49s)\$kjjQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj}0WƋE49s,\$kjjQjhRE4}0}0)E4E \$u4u0Pj薇}0WƋE49s,\$kjjQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$kjjQjhRE4M0QU0E4AD$iw|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L$kL$jD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$~9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$kjjQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u uE M4MU0B  ru0M4B\$QVP (ƋM49s)\$kjjQjhRE4M0L$M0)D$E4|$t)D$L$kL$ j\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$kjjQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u ȮE M4U0B  ru0M4B\$QVP  {ƋM49s)\$kjjQjhRE4M0L$M0)D$E4|$)D$L$kL$ j\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$kjjQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u E M4U0B  ru0M4B\$QVP[ ƋE49s)\$kjjQjhRE4M0M0)E4sf )E4w)\$kjjQjhRE4M0QU0E4AE4D$E0D$|$)D$L$kL$ j\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$kjjQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$,D$,;$p+u ȍe^_[]Ë\$USWV [ȭt$,|$(D$ .ʋ7l$Ut$Vt$40RQ‹L$$7>tVt2$QW)$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sD$D$s@(D$ 9s$kjjQjhR)))y"kjjPQhR ^_[]1))lj$USWV Չ $[T$8D$4 D$L$D$"u$kjjQjhR|$4QA$93<$779$xjD$D$kD$ jD$0t$4QEAt$jPt$ E tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$kjjQjhRMQUA+<$-D$4L$D$ ^_[]ffffYT$4D$\#ъLÐUSWV[Ë|$ l$t$~Jt$~2UVAx(ƃ|$tލF9wȉ9v=(+t$^_[]ÐUSWVP[|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }(^_[]E ffGftC,$RW'xǃ9w,$)xD$ hHGftf,$RWՠf 8 9Xσ95,$)5|$ oGwtc,$RWc 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [x|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$U蟞x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0QuuÝ]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.q^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu۩U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0 (LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XH\$1ɐ\ \\ \\ \\ 9u΅t1Ґ9uT$r;t$@L$\$Љ\$0 $ L$L$L$|$ |$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄S|$ t;|$$sF* $D$  8t(y"kk,kPQhZR,^_[]ÍGEk,kPQhR|$ Lkkk,kPQhR%ED$Urt$mu-T$ҋt$ tT$Di@tRjuYt$ tDi@D* ;|$$L$ <9=jfffffffUSWV[˛D$$L$1w|$ u B\06RkPUWVt$(t$(QR- XOL$u,dÐXL$w1USWV[|$0t$,1>0N xN|$|$4~D$ pD$lj<wsGuL1Fщ$T$T$$l$TUT$t& $LQщ$T$,$TjT$$D$1պ r $?TWT$T$Dz$ʍF$и rL$ʋD$T$ <$tpD$ЉT$ ;T$4O+.lkPQj>R[>l.lkPQj?Rd7D$ ^_[]ÉUSWVP[t$ 6ǃ|$u>lMlkPQjgRD$u f0x=|V4$~b1 9tJ|$,00r7 $ r7zB؃u9}B.벉$^_[]fXÐS[ht$ P [ffffÐ1ÐXp ffffffUSWVX[xl$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMngL$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ gT$"jDPQj2jRCǃ9WD$"Pt$ t$VPt$t$)T$ D$@L$)L$tOT$ g|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$pp txҋ9|Wy>TWPڋD$+D$py(ffffUSWV[[l$U覹ƃ;D$vS(`|$UW+1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[õ$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]ffSVP[L$t$D$T$ $xRQVP1!x9r豬RQP艩 ^[USWV[˒|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[K|$t$l$tt$$PW%t/^_[]VW t W LJWVUF ͐SWV[̑t$|$jW1Ƀ PVW ^_[ÐUSWV[Ë|$tt$O#PW$tw0l$VW/ t WRLJWVUM ^_[]ÐSWV[ t$t5|$r#u#jV#tjV$F1^_[S[îD$tL$ ttu H1[[ÐSWV[\t$t_|$G?wSH>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[̏t$tAjVq"t2|$jV"wsf~ 1^_[ffS[^L$T$ P[ÐUSWVT$0L$@[uD$\V@D$ PMǃ\$D$t6^=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$T$L$H$D$D$D$D$\$$|$,Vt$8PQRWYǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\j$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$zt$,PVD D$,\$PVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$P! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[^o|$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[|nD$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[mt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[mD$ L$t9u[ÍmmmmPQjpRiS[þlD$ #L$t9u[ÍmmmmPQjpRD$t&L$tu1u 1tÐS[.lL$ D$Qss)ǀ[Ãuu ǀ[ÍmmmmPQjpReS[þkD$tL$ t 1[[ffUSWV[{kj S1tQ@@jjPh V(O8tE(W 5(^_[]ÐSWVP[j|$unnmPQjZROGQ9u0$jQPh 08t  G $GT$pw1^_[ÐSWV[\jt$tRtC|$t3~t-0 ~r4 ;~rPp Vg ^_[ÐUSWVP[it$u"n"nmPQhRF$t(.1tt$Vt 9<$u1^_[]ÐUSWVP[jiT$J $Ћ*1|t$WBt94$u|$ l$tWuE$F;$} $)Qtu<|uprP $كU|vt ut Pxt&D$j.PWV$"tl$t8p+p$t D$PvL$QRPD$PWUx $t!Ql$|$TG )|$TW4$l$tNjM;L$ l$D$9r\$VpDfD$BFP_DǍFPQD΃ 931fT$Bf"D$+<|$l$H\$h$+Pt$Wt$uYt$DXe=9ƋD$L$0)9%\$Qt$HPe D$$LΉD$ꋄ$H@ tՍT$\$t$0D$D$l$ )ՃL$0)9sыt$FF\$URPV Vl$l$$T$<)ƒ\$0)19s>Qv!1$X;$(uH,^_[]Ë$LiRPUτ 1ɋ$L뽉&F|$;\$OW:USWVT[u>$h>L$u&\pՍ^oPQh^R舤Wt1T$ T$G j(¸RD$D$ D$$D$S$1ɉ|$ D$ L$Pt$ V^cǃt$Vt$  t5ꐐ< t쐐D$D$ t$h < t< t/PWbt1ɀ8 L$ D$1ɉL$L$ t WPtT$$9s9ȉ86(Pt$T$$ D$ + $$ȍQ8D$H|$|$ D$Ɛ w`L$ $l$9r4T$(PL$Qs l$T$+$‰$2t$ VaAƃL$sD$!D$$D$#D$ #$hL$$h|$ ?$nL$<)N)‹D$ L$HJL$)T$L$ωx|$t$tjD$B 19wz $PQW L$ A<0A )Ń9t$uыT$ B#PObL$$h|$ :ȋL$D$P`ƃ)s4$h$PF 衦1T^_[]ËD$D$Vt$ Wh D$ 8|$tsD$D$wD$1ɐ$L$D$Pl_ƃ)ZVt$W D$ @L$<9L$ut$ FL$4$(8$h$hL$USWV [È9t$(|$ u"oGp^oPQh R裟.vt ut P_t t$t\\$U`^L$QRPUVW_ $tQI|$ G .T$|$ W74$uǸ ^_[]ÐUSWV[{8t$|$l$4t t Ph@QRUWV#^_[]ÐSV[-8t$ 4t t Ph@QRV^[ÐUSWV[7{4dt6ƋT$L$t t Wh@PUVLVq1^_[]ÐSWV[|77uW7tXǃt ǃt ǃt ǃt ǃt t 3t Ph@QWV^_[31퐐USWV։[6tt<|$0t^p|p^oPQh`Rܜučp|p^oPQhaR趜|$0u|p^oPQhbR荜! GG ?.GED$ pD$^o$SED$t$JD$FFD$F t$..L$0))9|h)ƃ1t u/t$ t$hMt$ D$ 薛D$ gt$t$hNt$ oE^_[]fffUSWV4[4l$PD$0|$LuGEppPQjIR t$Ht*tIL$L;L$0SEppPQjJR蹚ut$Lu"GEqpPQhR芚|$u"SEqpPQhR`D$,D$(D$$D$ 1ɄE<:u~:7t$LL$ $t$ ~D$L$$L$1D$jD$Pt$$Vy ujt$t$ Vy t*Yt$) Ɖt$u1ɀ|$:/tA?z$L$09ȹcT$f $f1$|$ D$1|$ |$$D$t$۞/t$$p1ɍD$09L$f$f4$|$D$09tu+D$T$ҹt:lj1ҐD/DD.D9u߹)щtR)ȋt$NJT$ )ʈB>81X|$.uQ$rD$09wCL$ V1ɅL.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0u ȃ4^_[]AJUSWV։[t1_~pLZu 1^_[]É4$t$0t$u'_ t E<)׋$$x`<$1L$D$ D$}T$uUPo$T$E ulD$;DtM RE=t܉t$L$0QPut$ T$ u#D$8=u$ELM D$|$uIt$MtȍL$0QPuL$t$6$D$$ʉD$|$ T$,t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$$D$ u?tUPuTE)΋M0E0D$D$ L$$tCE<)‰T$Ή4$MuT$$M8t$ ))ʉT$M< $+4$T$uED$ ))t$$M $D$ E L$,T$+T$T$($2T$9T$}oD$ L$(ȉE)΋L$$T$ y*qqqPQhRvD$uE@9tRpD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQD$e ߋD$)D$U融u E;D$UitjUErĬ^_[]Wt$t$$uT$ !ƒtˋE0tU@9t QE0EEEe jUq1뙋t$u)y'qqqPQhR E)EfffffffUSWV [Ø#t$@|$4\$u5>FD$FD$jt$84o1D$ D$t$<\$tj D$Pt$< ŅD$\$1Ʌtr|$~l\$ +tX9\$8utAp9r:1Ґ8uʃ9s뾐u.1%)D$ L$ÊD$t$t@uHFWVP=WrrPQhR裂u뙸FWV1^_[ÐSWV[,|$t$tCu"srrPQhRBt>t@uHFWVP=WrrPQhRu뙸FWV1^_[ÐUSWVP[Ê|$l$tRu"1ssrPQhR蠁Et`tBuU$EQUPAWsrPQhRRu늋EQUt$1^_[]ÐUSWVP[|$l$tRu"/s srPQh&REt`tBuU$EQUPAW srPQh%R蒀u늋EQUt$1^_[]ÐUSWVP[ |$l$tSu"ZsAsrPQhFR EtctCuX$EQUPCWAsrPQhERu뉋EQUt $f1^_[]ÐUSWVP[J|$l$tSu"YsLsrPQheR`EtctCuX$EQUPCWLsrPQhdRu뉋EQUt $f1^_[]ÐUSWVP[Ê|$l$tSu"sesrPQhR~EtctCuX$EQUPCWesrPQhRQ~u뉋EQUt $f1^_[]ÐUSWVP[|$l$tSu"srsrPQhR}EtctCuX$EQUPCWrsrPQhR}u뉋EQUt $f1^_[]ÐUSWVP[ t$|$txu"CsrPQhR }u&W͍rrPQhR|tJt]uaGQWtQ $CWsrPQhR|ua $G͉QWPt 1^_[]ÐUSWVP[t$|$txu"CsrPQhR0|u&W͍rrPQhR|tJt]uaGQWtQ $CWsrPQhR{ua $G͉QWPt 1^_[]ÐUSWVP[*|$l$tXu"0srPQhR@{EtltHua1?$EQUPGWsrPQhRzu넋EQUt 1<$1^_[]ÐUSWVP[Z|$l$tRu"srPQh RpzEt`tBuU$EQUPAWsrPQhR"zu늋EQUt$1^_[]ÐUSWV[Û|$T$u&Ws֍rPQh*RyL$u*CsՍrPQh0RxyL$(t )ŋt1tXuQBWQRP t?t=G UQWP%BWQRP ttG8UQWP 1^_[]ÐUSWV [Øt$$l$ u"WsrPQh^Rx|$(tTtv6EEEL$QU/D$ssrPQh_R4xussrPQh`RxcWrrPQhRwKrrrPQhRw$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$Uj ǀ|$tB}u.u^[ÐS[>t$t$t$t$t$J[ÐSV[ t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[D$t$ P[ÐS[Þt$[ÐS[~t$Z[ffY_XÐX?L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$kPQV ƍGэ}L$,|$ U(!Ћ$tW|$ƀހ:w7$<w;t$b\Gn߃^rxo;l$1\,, $*(wkdT$Ɖ*t$i $*(wi (Ћ4$(Wm;|$Yȃ|$ U(!Ћ$kPQV xuD$ ƋL$$tQPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$k(^_[]Ë$~kᐐS[Njt$t$t$[ÐUSWV([|$@t$ րt9@A1!tfY;L$,sf?1 ֋|$ 9}PT$yL$ʋL$(,$9}4,$T$Ήe,8;l$s 49;t$,$c(^_[]D$D$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ `0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[ÎL$T$ Pt$ [ÐUSWVT$[Rɉ$u&v(tn$PQj?RqS\$t$4|$ |$0t;D$0|$ "v+Y1T$$VPGu+t-u#D$D$t$0tDD$t$0u20u- vvSuPQhbRC@ H u(!D$D$ D$ WZD$PD$xD$<&L$iFs5D$hFdNt$ t3;-00tB׋L$!Ɖȅt<$~81퍻v 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[Nt$W[ÐS[.t$jt$t$[ÐUSWV8[M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$*)L$ *11uj+KH(;\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}q4`1ɋU+dF GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$!1kD$ \$uuPV_tML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[t$`WA PX4 QjV0W^_[ÐUSWV[{l$t$`W̵d u PUjV0)W莵^_[]ÐUSWV[ |$t$`U\h uƃh UC1Wj(t H(^_[]ÐSV[Ýt$L$t$j'ttH(^[ÐSWV[Lt$`W衴h uƃh W舴4 1PjC't H(^_[ÐUSWV[۲t$|$`U,h uƃh U4 Pj&ttH(^_[]ÐUSWV[[t$|$`U謳h uƃh U蓳t$jQ&ttH(^_[]USWV[t$`U@ PWt GjP.Uh uƃh U\LjjƉUβ^_[]ÐSWV[Lt$D$t GjP4`W茲h uƃh Ws\Ljj/^_[ÐSWV[ܰt$D$tF t GjP4`Wh uƃh W\Ljj^_[ÐS[^D$t@ PN[ÐUSWV[+t$tF |$`Uqh uƃh UX\LWj^_[]ÐUSWV,[õD$$$(=ΉT$y |F D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ* G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽^8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ USWV4[ȬL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(`Vݭh uƃh VĭlD$|$\LL$jWjj'|$uL$jWjj~'|$t1ՉNjt$0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[Z`$P谬d u Pl$|$t?BR lP~;yQq|1)͋$P2^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[ۨ`U4d u PlB|$t$tWVP ƉU^_[]ÐUSWV[SD$D$fBt π?:t v?:u$,?/4$\$u(\$jW=\$ W3?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pt59tx/ux.uHt/uэ|$H4$$," 4$\$h@WǍD$HhPW舠 +&y \$0\$W股D$(WpgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$ƋD$ƃ1H4$D$ L$T$kT$ D$ L$N19FD$ D$F n|..>:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$USWV։[tK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR7 $Ec\$vjt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$v8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$i@QL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$ 1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $XD$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$G)jhUt$ 1T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9@l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$L$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPY)jhUt$CU\$sT1ڽT$\$jjdUR)jhUt$t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4X|D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jj*wpwPQjHRx1uN)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffUSWV[ûvl$t$|$u"xxwPQhRU^_[]ÐUSWVP$[Uvt$u">x(xwPQhRsUvt,jtRx $Hp  19" xuxt)txu8u뮾Uu^_[]ÃUSWV[ÈuD$ P]u   $ L$ȸ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ Nt u#t7Wu^_[]ÐSWV[tt$u">x(xwPQhR:Ws"  xuxt&t xu8uju $p@@  1WNs^_[ffUSWV[Es$$$t#uxxKxPQjPRI$D$$DŽ$DŽ$$ jPpr$<jPsDŽ$TDŽ$XDŽ$\DŽ$ps1|$$d$t$l$x$d$$$P& $d7SLxKxPQjQRK T;$u ^_[]腊S[þqt$t$Pt$t$G[ÐSWVP[ËqD$L$T$t$ 4$VRWQP ^_[ÐSWVP[KqD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[ qt$}XjW˼E`HM`~;Ep~ t EXHMX WRqjW蔾^_[]ÐSWV[ÌpL$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[-pD$ L$ $XQPR[ÐSVP[oD$L$T$$XRQPV0D^[fffffUSWV[øo|$$t$ |$(u _LxPQj=Rt$t qzTD$(H @1r<$tQt$u])LxPQjQRgj|$,WG uy$‰Ņl1<$1qyQuE)ljuދl$$$)1t$ ōACAAAjQ{Ջ)v1WPV胴 L$(9l$Q|uh}T$RPVP L$(A)y-xLxPQhRaL$8A)AjQl$$jUջ$+D$1t$ ʼn^_[]ffffSP[ýmD$ L$T$$RQPK[ÐSVP[ÌmD$L$T$t$4$VRQPA^[fffffffUSWVP[Jmt$|$ulD1yxPQj>RhPV|1訮ht$t$ f x=|PgfF FfFfn vF$ F,DF(|F $tjjjV葿^_[]fSWV[\l|$u _my7yPQj;R}jWw jW^_[ffSWV[k|$WG;D$w+t$9w 9w9w 9wPWVɱ ^_[{fffffSV[ÝkD$;D$wt$ Pt$V~ ^[<VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[Tj[USWV[;jt$u _ytyPQjL$0ȁ1ҍ$X1 D$xT$|$t$8$u $\QwP ƒ.D$ƒ;T$0v$^D$8MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$0D$$xD$0|$\uƄ$/D$(t$P\$WrD$(L+D$L PD$L$W n|$ptD$'-D$D$\=\$4u#D$(8NT$ L$Lu]|$`o$BmD$@T$ L$߃GD$DufЉڋL$dtL$0\$@|B9\$0|<)y1ɉL$0i|$`$$z$yD$8D$' L$0ӋT$L$Lt $0|$@Љڃ\$@م D$0tD$0ȉD$|$X|$@2|$XC9D$@9D$T1ҐT$H11ҀD$D$t\$@)D$‹D$HЉD$L$T\$@9$zD$8D$%D$D$@D$HD$TD$D1)+$1 \$Ѻgfff)À0D$,L$ I<ϋD$, L$ IϋD$,L$ ID$,L$ IEHMPwEHMPEHMP1D$,L$ IEHMvEHM1D$ y1۸D$'-‰D$D$t$X1 D$t$u RjPjz1Ƀ,EHMT$|$PH8T$T$ ϋD$,L$ IϋD$,L$ I D$,L$ I8EHMEHMEHM8EHMT$L$PT$T$ JEHM1qEHM1wEHM1:EHMD$D$H$QtO‹D$D$t1 $X׍D$tu $\Qt$ PRt W1ɉL$8L$(ɋU$|$0x<$|$0Wjt$@– |$\$4T$ tW+D$8L$0L$9GD$A$t$8uD$y" zyyPQh&Rc\$4T$ D$D$'1D$@D$HD$T1EHM1D$EHM1D$ 1GEHM8EHM1D$EHM1D$ D$EHM1aEHMD$ ɉyD$'-11D$sEHM0EHM7EHM811ҋL$t! t L$t D$$/D$ȉD$'|$0x% D$tRD$@ uT|$0uM$|$$|$@|$D$@D$?% T$0t9\$UρD$? ٍ$$t$XPWt$ t$PQ$|$\$uM$t=\$|$T$?T$D$$t$Xt$HWt$ Pt$0(.Ǎ$|$8)D$e!D$1D$@D$HD$TD$D$D|$0\$4T$ |$ ;|$D$|$'$/L$Lt)L$\$PD$D%D$\$4|$L$ \$׋$(GÉ\$L$ [Uu/$ _,zy$PQhRϲU\$ۋ|$.$D$PR[D$D$ $0|$'sG >$(B\$L$ rʋUu/$ _,zy$PQhRU\$1ۅt<$D$PR螋1ۃD$D$ $Xg1ɍ$E|$|$'u5|$|$'u D$ $|$'txD$'BL$ D$D$L$ rHUi$D$PR׊D$D$ $t $/Ƅ$.0$.BL$ D$D$L$ rLU6e$D$PRKD$D$ $t|$OGL$ \$׋$8GÉ\$L$ <Eu/$ _,zy$PQhRE\$ۋ|$$L$QP~D$D$ $2G K$8B\$L$ rʋUu/$ _,zy$PQhR>U\$1ۅt<$D$PRΈ1ۃD$D$ $X1ɍ$E|$$ _,zy$PQhR诮UD$hD$ $$/$ _,zy$PQhRVUD$D$ $|$D$ $D$ +D$L$ |$|$ljЋ]D$G $8BD$D$L$ r‰څu/$ _,zy$PQhRwUD$D$t=$D$PR]D$D$ $P1ɍ$;T$ $8\$ T$ B|$lj|$L$ E$L$QPgD$D$ $L$4D$0|$D$DD$8D$BD$ÉD$D$ D$ EL$4D$0D$Dus뚐F$ _,zy$PQhR֫EL$D$ $L$4D$0|$D$D)|$L׃UD$DD$8GT$ D$ÉD$T$ Uu3$ _,zy$PQhRL$DU\$D$ۋ|$ $D$PR蛄D$D$ $L$4D$`B|$\I׋D$(L$dȉD$L+D$8L$@9ɋ]D$8OD$ȉD$L$ L$ څu/$ _,zy$PQhR+UD$$D$PR軃]D$D$ $vD$8$XD$x$Y$XG\$ L$L$\$ +u/$ _,zy$PQhRmUL$1ۅ~$D$PR1ۃD$D$ $P$ _,zy$PQhRL$DE\$IL$M $؃L$GÉsT$D$`|$[D$0$8D$BЋT$ L$L$L$T$ Eu3$ _,zy$PQhREL$L$|$C$L$QP聁D$D$ 1D$$L$ "'1ND$щЉډÐT$$ 0\$T$T$|$D1ҿ;|$|$DڋT$rÃ|$@B<0:|$D0.D$LD$҉|$8^ $ 1ۍ$D$`1ɍ$D$8T$dBGLL$CD$ Eu/$ _,zy$PQhR{EL$D$ɋ|$tT$L$QPD$D$ D$ $L$4t/D$L$ L$4|$D$ $L$4D$0+D$dуNj]ʋL$ D$G $8BL$D$D$ r‰څu/$ _,zy$PQhRgUL$1ɅtB$D$PR~]D$D$ D$$1ɅOD$$4D$`\$ ]ʋL$ ϋ $8 B|$L$GD$ څu/$ _,zy$PQhR萤UL$D$ɋ|$tU$D$PR~D$D$ $D$`L$4t-D$D$`ˋL$4|$1ۍ$D$`L$4É\$ \$\$CD$ $0D$`BEu7$ _,zy$PQhR趣L$DET$T$ |$ U $L$QP;}D$D$ $L$45 ( D$ $|$@)L$ D$D$׋$8G|$lj|$L$ REu/$ _,zy$PQhRƢEL$$L$QPV|D$D$ $ D$G 9$8BD$D$L$ r‰څu/$ _,zy$PQhRUD$D$t=$D$PR{]D$D$ $PK1ɍ$;D$ 1D$$D$ D$D D$0u ыT$ D$x|$ GD$D$JL$ rEu/$ _,zy$PQhREL$$L$QPzD$D$ 1D$$kKD$XD$ $D$@D$8|$XT$ t0D$Tƒ|$H|$8D$L9wD$8D$X]D$D D$0T$ u1D$x$X$XBL$ D$D$L$ Zڅu/$ _,zy$PQhR֟UD$7$D$PRfy]D$D$ $|$0 L$ |$|$|$8|$8T$D$TuD$XUD$?|$ GD$D$L$ ruu/$ _,zy$PQhRUD$tG$D$PRxD$D$ D$$t'i D$D$ D$1ɍ$D$L+D$8T$X9ÅۉD$8ZD$\$ ؉D$D$AD$ UҋD$u/$ _,zy$PQhR&UD$tM$D$PRwD$D$ D$$\$ t-} 1$D$ D$1ɍ$\$ D$X8)׋$8G|$lj|$L$ NEu/$ _,zy$PQhR8EL$$L$QPvD$D$ 1D$$r D$G 7$8BD$D$L$ r‹Uu/$ _,zy$PQhRvUD$D$t:$D$PRvD$D$ $R1ɍ$?D$D$ 1D$$T$ T$҃\$H)ӃT$T)‹D$X|$8ljЅ‰\$H<47|$0ߋ$jj RWA )ˀ0$D$$ËD$XD$H(|$@ ߉ىËT$DML$ߋ$jj T$HRW`T$D )ـ0|$OL$Y|$|$8|$tL$H t9ϋ|$@uу rL$L\$KL$HytL$H\$D$AD$ $|$0D$ 1D$$D$\x Ћ]T$ ߃]T$ D$G D$BD$D$L$ rljڅu/$ _,zy$PQhRʙUD$D$t=$D$PRVs]D$D$ $U1ɍ$@]T$ |$:B|$lj|$|$AD$ ryڅۋ|$0D$u/$ _,zy$PQhRUD$$D$PRr]D$D$ $t Y|$0|$\D$(L$d+D$8|$09DžD$8zD$D$L$ L$ rqڅu/$ _,zy$PQhRGUD$t=$D$PRq]D$D$ $t1D$ $D$0)L$ |$|$D$G $8BD$D$L$ r‰څu/$ _,zy$PQhRWUD$D$t=$D$PRp]D$D$ $P1ɍ$;׋$8G|$lj|$L$ rwE|$u/$ _,zy$PQhR蘖EL$tB$L$QP,pD$D$ $L$4t*L$4|$L$4D$ $D$DT$ L$ |$T$ \$C D$$(B|$L$ rċUu/$ _,zy$PQhR蘕U|$1t:$D$PR(oD$D$ $T1ɍ$A|$UuS0T$ Ӌ$(Clj|$L$ UrҋL$4L$4u:$ _,zy$PQhR詔L$DU|$$D$PR6nL$L$DU|$t<$D$PRmL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P8E|$8E|$8|1 uT t$ 9wS$w닔8wl$Pmt t$T l$PU\ / U| 룋$L$19u $P<^_[]þUSWVP[hD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$҆USWV [D$ 069rljT$D$uj$jWPH (9$T$JHJHJHJHJ H JH RPE$jWP 舉(聉8t!w0t$蹼d0*)4$PjV腅 $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }5zj>zjD$܋tT$\$8t$<EΉ7tƉP1t?D$|=WjPp )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]USWV׉[7l$YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[#m|$hE t$p |$<$ MM$U5zj>zjl$l$܋t|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjP蔀 )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]I~ffffUSWV[ÀE\$t*\$4g=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$5zjuL$tyD$0D$lD$ $D$T$D$\$]uNjD$L$ttW% ?L$@\$D$4\$>zj؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋|܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxPvRt Pq t.Pvt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋Ь|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$dM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋Ь|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bكЬ|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋Ь|1t$H|$)3jadwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PeWD$P#dW`VD$P؋|$ |$(|$ |wD$0ufsD$\$t$WOe\$ Džjwc|$|$l\$WPe`؋L$1ҋD$DD$4D$RC_D$t/L$4t9t\$Q"_D$\$P_\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$+^T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$^eD$T$|$Z D$1e^_[]ÉL$D$4|$ \$D$0L$T$tWjt$`L$¸tQT$Rbu d$|$ \$T$~0vt@L$(t$$D$4|$0thjt$`¸ҋL$"QT$RaD$ |$9t$D$ 1|$ \$T$N|$9u@F9L$|$ \$T$@<9uF9uL$1nFd|$,D$|$ 0|$0t!|$9tD$ 1F|$ \$T$)|$ \$T$L$NfffffUSWV[È|$ t$nD$.t>L$$t6 ruLQU$t?$L$U荡$1)nL$^_[]þT n0ffffUSWV[t$|$l$t?xzzBzPQj5Rgu1 1 ^_[]fffVL$T$ tu1 ^Á1 ^fffffUSWV[M1ЃωT$(ЃM$U (E81!|1 Ƀ9|$$PKT\$^‹ED$}D$,1 7L2 79vސ|u; uB1F5zj<>zj)B$tW\$R&SD$PVD$ ,RL$ )M ~D$$Pt$ VL$ P_T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋|܃$ۄ$܋҉t$$~@CM ~O$VSM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$Lwm<D$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋ЬكT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋Ь|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9كЬ|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋Ь|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtK+D$HD$T$,‹|$LD$~$RQOt,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$Q2QT$|$t$$$Y|$D~RD$T$ L$$jjt$H D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PRNDž~#T$?؋L$؃T$$jj QG |$@c΋$jj t$G ‹D$8 |$Dt$$$/L$|$D$D$t$QfFD$ t.L$t9t$QFFD$$P6FT$%T$$1|$D$Ȁy0ItL$RFL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wDO L$O ‰D$ t$QR6 jt$MM|$D$ D$$t$|$ W_D$,t$WnNt$ t$Nt$t$,k$jj PE ljD$ D$L$L$D$D$QPƉ|$Wt$ Mt$ t$GNt$,N0L$ x $tPrDL$(T$D:Pt$ MVIDT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QD D$jj t$D NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VD D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$KL$ |$$F|$$t$t$ Z0D$ t$(Vt$bKt$t$z|$D$ jj QB D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPI\$ht$D$ PJugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ HD$I$t$t$ ID$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[,D$1r 1 9vW=t8Ɖ^_[ÐSWV[D$1r 1 9vWK=t:L$T$8ƃXt𐐐Xut^_[ÐSV[=D$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU5F|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[>zSVH[D$0hjPYO D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQjD$$D$ D$D$D$D$D$jPjmQ jPj QS[.zS[fffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffUSWV[+t$|$uxS{{PQj?RHK1tt (h1^_[]ÐUSWV[`}uu-\$D$4PD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$PA 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$PD$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ\zt$(PV'T$4D$(PV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQj D$p '3 |$4t$N  D$0P QVR, t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP/ 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}"P"L$D$ffffUSWVt$F98[} |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[Óu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ët$D$T$<n~,D$9r9s#L$9w)QjP ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXϭ@0@4f@8@af@e@Af@EfffffffUSWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ÜD$H~( 1u 9r1$PƉ^[fUSWV[;L$,?t,P w t{ ?u1>P:ƅD$t/Fn?t,P裫FF ^_[]1?t,PxPt )ʉʁ oΉPoUSWV[;t$tbF!r VJO,}t3,W}F  tW˪  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[(l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UYHE!r\UCH1,},$P蝨}T$,B ti4$u\,}th,$PS1}F  t14$-$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[~j,tL$H@[ÐUSWV$[HD$9| 9}T$P7P|$, $r0wD$PjRe  $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rUA<,?t:,V-?E M $t#VD$ M $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[ÈD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [ӞE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[$t|11 V|{PQjERP$1jjUݕ ʼn$tƒ9tut)D$P$ts#D$ =uXtZfx $tu f~ $fFvF$ F,DF(|F OĀ^_[]fffffS[Þt$t$jt$[fffffSWV[l|$u _,|PQj=RjWGHO~ H0 WjW^_[ÐSV[t$ u _S||PQjIRFHN~ H VL^[fffUSWV[Ët$u||a|PQj>Ratrt!w 11ҊNt\tGɍywl@ؐ+u˽뿁뷁 ՋL$) 1^_[]fSWV[Ü|$f jWRG0ǀǀ 1G t WƋO twуy y w7G0tW@9t Qs7G0\7G0ǀǀjWG GG: _||PQj8Rf  ^_[f̀rS[d[SV[Mt$ u _}|PQj;RnF0u ǀVuFH^[SWV[ܖ|$u _[}%}PQjJR8uGG Ⱦ uuL O @G0taW@9t Q5G0GG81t&WG GGfG u WG t'dVEjPV-GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐSV[]t$ u _e}%}PQj;R~F Ш u V1^[fSWV[ t$t1mT$ |$L$D$t#t8uӉ6@VRQWP@26@VRQWP։6@VRQWPL^_[ÐXoL$kAA A AAAÐfffffUSWV[%$u$hj,1$džt.%u%D$PQ1t+8$u!8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP2$ t;$PQ~|$=|F P/$FEt$P$FV EtF4Et UMtЅBt N&tEu hV~ VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFl}j P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCUJ(1V.8(1^_[]14dž$j$tJpsH0(,rPt+ot u8~)1 9}8tQ+݋t PV+t781^_[]ÐSWV[|$tOWF+^_[ÐSV[ýD$ p|$s t.jt$ 1dž,dž,^[S[NL$tAt[A[ÐSV[ D$ p|$tdž,1t$t$ ^[ÐSV[ýD$L$ qtdž,&t 1҃ƒt$t$^[vdž,빐USWV[8L$(D$x)$xuLJ$LJ(LJ 11t f} t2nD$(tE9(G($19wJjjWQ}Ɖ鉅 hf}u A(9vA($9(LJ(u$>}x}PQhR31(f|Eu;DEjVPWQ ƋhLJ(f}tf}LJ $0}x}PQhR1jAf|E@u(9LJ $LJ( LJ,^_[]Ë(L}w*jt$(t$(VRu‰w$ trT}t$t$ r|})ǁ$w<$_ t)׋t$ ~t$΋|$$7)ʉW $(15SWV[|$t^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[È|$(o(o(OG0!D$;G9} $wD$D$ P$L$L$D$QPt$蝘 $L$QjPH t$I%$D$ Gjwf $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[Mt$ t$t$ #F,;F(~#F0^[ÐSWV[4aAl}j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrUSWV[sD$ t$$|$ B~rZ~P~~PQjbRF 7f.ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]fffffffUSWV[ q|$oEtjPu׭ EjWṷEtPE EtPDžDžtPDžDžUWVj^_[]ÐUSWV[p|$0D$,pFtjP6Ѭ Ft^_[]Ë 1uʃtttjj6藪 t$b1D$L$T$ |$# l$hxP H@b1jP6! 6藬Y 1KfffffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fSV[ÝnD$;D$wt$ Pt$V ^[ D$$PUVOI …t3 B$D$$|$pu-tEjQ6 l$ Dl$ 6T$t  ȋ $ T$ȋ $ $UOу PD$@D$)AD$$D$;T$s)t$Qt$WUt$V'l$ L$(L$D$r+Z~L$P~~PQjbRL$(D$t$f9 $t$s&p)ɋT$rQPRtD$ f@H+L$(fHfLpыM OLL$L| v6WVt ~uuWDtT$ t$F($ < $uF;uFf9rfFl$ uwztzukfuf1ɸHzr#Z~P~~PQjbRtT$σ;L$ $ufjR6؝ |$p uL$IQ0V+D 1M;L$Lu%P^_[]1f1ɅL$$_1LyffffffUSWV([x`D$s E9sލU,$D$)$hPT$ RQ$ $t#9<$v,$}/(9w$) $L$L$  D$D$$t%ht$WhF $t* $hW8h1Ƀ89t$1퐋D$(j?Pt$l tWH0tȋL$):,T$D$19u^D$PW`8uk9t$u?ٷ/ED$PW7E/1Ʌ#D$$=@蕷1y1Ƀ8dfffSV[=KD$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVT[JED$PD$LD$HD$DD$@T$@P D$FD$FD$FD$FD$ F D$F$L$N|$ j@jD$PB7 H 9tE;D$PuT^_[]PJbUSWVx[JED$tDtDw\Lƅ1~ 9E;D$tx^_[]WIDD$pD$lD$hD$dD$`D$\D$XD$TD$PD$LD$HD$DD$DL$T$dP 1ɍ+T 08u q?u8 lLPQRvQ OPQ[JGDWHjJ#$jI1$1$jI$jjjhjD$Pj4t$jt$P4 u4$VX41VwjJHWG 51ja2`菰USWV[G$E$ D$|D$xD$tD$pL$0T$pPe D$LFD$HFD$DFD$@FD$V> j$jV+ ^[S[î>P>[ÐS[Î>Pg>[ÐUSWV[k>l$j?ƃ#j?1j?j$jU+ WUF*^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$tD$ 9tUD$L$$D$(0jVD$0j UX1^_[]ÐUSWV [-t$ T$r&%PQhRӓT$fzfz~F l$$uBrZ~P~~PQjbR艓ftB׍Bs811brZ~P~~PQjbRG[1W)11lN.lN.lN.lN.9uمt# N1Ґ,Q.9uL$$DAfAfAl$$}E 4$uErZ~P~~PQjbR舒ftH׍BsA11rZ~P~~PQjbRC1)11l$$lMt$$.t$$lNt$$.t$$lNt$$.t$$lNt$$.l$$9ut' M1Ґ,Qt$$.l$$9uL$$EDfAA A jQD$0h^_[]ÐUSWVP׉ $[+l$D$fJfJ D D B uD5OP )fOfOɉEDDD5 L t5PQ#= D5tcju t$6ge twH jP6Bg 7E (D W)fWfW7PQR< ED7fGG G jWD$0f 1^_[]ø荒USWV4T$X)D$ D$PL$(f\$r+\$ }%PQh|R\$D$xr(\$ Z~P~~PQjbR膏\$D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$D$f;D$f9u(D$t$Tf9L$I T$ T$LB4 t$4 L )\$LC T$ t փ L \$L$f9v>NL$TAʉT$T$LB4 t$4 D$f9w;L$,9D$$f9t7ŋT$HJ)fJfLBЃD$\$ Vt$P8:\$ r+\$ }%PQhR貍\$9D$0g|$t(D$ tD$ Kf1D$A4-=r+\$ }%PQhR2\$D$HfpT$(B(t>BL$;u3Bf9rfBt$f9s D$HBL$L J)fBff9|$vD$Pf)8D$LD$ދD$f91i\$\$L{ \$ Ńt$LF)fFfD^\$ QRP8 f9|$t$19t΋L$I T$ ,щt$\$\$L{ 4 L \$ VL$Tyʹ9\$\$L{ \$ 1/fy&\$ }%PQhRdD$L$Lfif9uD$LfhD$4^_[]Ë\$ 莍fffffffUSWV[$|$8D$,hEtjPua E l$wJrr GE(uI1GlT$0:zD$PVtHUD$PV|$a$ML$fMjPu` juu^ t1BQ A8E,jjuc^ ?fpjWu#` jt$u"^ DžwrZ~P~~PQjbR:G or&Z~P~~PQjbRwD/DD$ l$Z~P~~PQjbR衈E,jju.] ǍZ~D$ l$wrP~~t$ PjbQ8G GtfAjWu^ jVu\ Džxl$:蕍E(Err/D$Z~P~T$ ~PQjbRYD$$T$f9B$fD$},|$ f9{l$9aFjRu] jvu[ E‹nprZ~P~׍~PQjbR襆|$qbjWjWl$u] <$wrZ~P~~PQjbR3ft$><$fD$l$.E(uEft,$fD$$E($EfD$1OH$fD$u,9 GjRu=\ jwu=Z ftB :$f|$wrjRu[ jVuY 1rjRu[ tYjVuY `@=r'ǍZ~P~֍~PQjbRjR*|$B uSfiDBtjR7 [ jV7 Y 1ul$$fl$1l$Z~D$P~D$ B fyDBtjRu}Z jVuX t3xr~t$t$jbP蟃{$8t$EtP莼E EE($}fu E(jQt$  OfL$$Ɖl$;tjVuX 7GfD$Gft$fD$t $A4 ;tjt$unX $@jPujV :ʼnprZ~P~~PQjbR老fw,$l$fwWt$U) t$l$whrZ~P~~PQjbRf9u>pjPl$uW tljVuU fGOT$,‹OJ3t$ $;tjQu:W D$,0L$fHL$fH1^_[]Ë$;ujVD$0V ҸffffUSWV0[u~,jj6T &|$ NL$eL$A }HʋfqDBtjR7PV jV7ST L$D$xrZ~P~~PQjbRc1fu(77)(QjP(v F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPu <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVt^_[]ÐYo D$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[~ t$t$t$ [ÐS[N t$ t$ F[ÐS[. L$T$ j[ÐSV[ t$ tAj@PVP FPhjP(s F@FDFHFL^[ÐUSWVX $T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPAi FP3nPtPWjPi UVj~jUi FPNHVLN@VDPV^_[]ÐSV[]t$ tAj@PVKF FPhjPh F@FDFHFL^[ÐS[t$t$t$ [ÐS[t$ t$ [ÐSWV[ìt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVkg ^_[fffffffT$D$fSVP[D$L$t$$hjjjRQP  $^[ffffffUSWV[ÀMD$$&ydḰ ~? gL$Q \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ < 1D$D$ D$D$L$8T$jjPQjRatD$8 D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$πvL$L$€L$ހFL$L$L$L$dhjjjPQRD$L$8T$jjPQt$RL$81 ujP) _UiK1D:0D$D$D$ D$L$8T$jjPQjR`t$8|$<QPWVID$D$D$ D$L$8T$jjPQjRD$XL$. L$>hjjjPQRM uMD$D$ D$L$8T$jjPQt$RtD$8ce^_[]fffffS[~ [ÐUSWV$[Xl$8D$D$D$D$ L$D$QPj ܐ$P1t3 t!j҅Džu t$<$* ol$NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [èT$0|$,D$(L$$)q092sVPO$D$00$D$ jU0J+ Ÿtr|$9rL$EQPt$V jUD$(0,D$ )t+Ɖ4$juD$(0* ŅD$u1 ^_[]ÐUSWV[øL$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0, L$,+|$ $t*D$D$Pt$(L$njUD$,0+ 1ɉȃ^_[]ÐUSWV[è|$D$ hj07) tk@ uVxPQ4$9vDt$jW6F) t9<$)HL$PV9|$w jP7+ 1ɉȃ^_[]ùfffffff̀rS[[ḿ̀rS[[̀rS[ä[S[Î[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[$D$D$hu,ET1}8XM4tI$P`{E8*$$E4E0|$ 1D$L$j`QPu8VR ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$`\d|$ Wn,$Ƅ$D$TPW t.$Ƅ$8u$L$ThPQp $ 1 $Y?l$$PW}$D$t2) $j UW$WaƄ,j W$U !RjD$$PU: ʼnQD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFCt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW |$ u9nuqF$hPW^ nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$P4 E$$t8OltC$($,2D$XP$0 $0$$toOt$t$';$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TP)$,$ $$t%(tPD$(PQ( $$(1?7$($,91$u$QPW t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tP$$t M"$($,uWPL t$l$$t$|$t$P^E$$8$j`ot@8@P$i$t$|$t$PE$$t8L&t$l$tW$,$$t(SL?$($,t t$7$QP t$$t$$tP9$$tL$$snSWV[ÜtM΋uA~8t:~4~"`N4F8 I9rP~F8^_[ffffffUSWV[%$$$$$9$u t!6t$!P$VURQD$bI$>I+`|$ L$1t2`r/j`PWD$ .$D$ `1t`rŃ`j`PWL$ #L$ `댃$t!$9b`Y|$ D$荫$ $` $hjD$ PE tF;EuED$E$D$ETt+hPt$$V+ Vbƃ t$ $tVD$PQ"L$ t$$uO$;$uSuO-wBIux|$|$ $u5$t&aH0;$^_[]Ë$lD$|$ $$Pt u틴$L$t$T$9rD$Pt$U! 1gL$Y;L$OG :4ffS[nD$L$ AQ jQ0" [ÐSWV[|$t$t+jP6 tH  W6^_[ff̀rS[ô[D$t8t9@€tuuuuH+D$ffUSWV^E$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]É)ffffUSWVLXXD$L$ht$dl$`u/t+t'\$ ЇPQjkRa?L$x|$lu'\$tЇPQjlR3?L$x1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$Z D$$PT$)rh,D$GD$ \$UW|$t׉t$ l$Uуx6l$V\$t$ |$WT$tx:|$ 4l$l$x \$|$ Wt$T$tx|$|$D$؉D$ )\$VD$@P|$t׉UVуx4\$Ut$@VT$tyx\$Ut$@VT$tx|$+D$l$ \$UD$ PT$tD$ WUT$t|$ x!A\$|$Wl$ UT$tx($x \$t$|$ WT$tx|$l$|$\$V|$W|$t׉ljl$UVуx1T$|$\$ T\$t$Vl$UT$tx+T$|$\$ x#\$t$Vl$UT$txT$\$ |$,tPD$tY\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$VWT$tL$uӃ|$,\$h|$tOD$tY\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq21pjPQwc1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[,t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø+Pjj%Q-.SWV[lD$L$Pt prxxp| pPxtz xyVd1^_[ÐUSWV[|$ l$9v`wDt9xtNȅuT$81$Xq30<01*׋PtIQPEjPQD$ pD$,@L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y/ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p+ D$ L$Q$ЈA1ÐSV[t$ V P2btHP tQ P Vb1^[ÐSWV[Ìt$>gthGt tww$Ѓ gpNjPQw;u<tww$Ѓ 2.^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[<D$t$tA|$1ɐt 9u)tPjQG) ^_[fffffffUSWV[t$0|$,ttq,TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P, Pt$8=t +l$1jt$81^_[]fffffffUSWV[|$(T$$tMtpGJB t zRty+  _QPQjGR%T$4uQPQjHR%T$4h`+F \$/}u-D$ $$L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$a D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPVT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$L$T$( 9J9s\$VWPK t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[k|$tpjW0G 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;dWLPCW2& jW^_[]ÀO @1USWV[Ët$u _ՈPQjVR N 1tQ~tJ.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[ t$u _ވPQjjt$ [ÐUSWVP[,8|$t$F0PڳF0P)9tnPj苷F0Pt8PQ说jt$RڶN0PǁTt!ǁXN0TtXXu\QjN0Q^_[]ÐSWV[ ,8tR|$G0PԲG0P#O09t,Pu' O0PǁT 1T1Q{^_[ÐSV[},8tJt$ F0PEF0TuǀP8PAF0P^[ÐSWV[ ,8tn|$t$F0PбtF0Xuj\耵F0TuǀP8P謲F0P{^_[ffSV0[zD$<L$,QPF1;T$,uȃ0^[ff̀rS[$[SWV[ |$t$u5=ىPQj9R)Wht,@V* ^_[fS[þL$T$ Pt$(t$(t$(t$(t$(t$([ÐUSWVՉ[tD$/Pt$3t[ËD$01[ÐfffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[l$$t$|$tu"IPQhR-D$,tL$ z91Ʌ1^_[]ÐT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[Mt$u"%tIPQhRkD$ t|$tT$t121Ҁ9 11^[ËD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[U$BЉׅtϋ$t#RWPQ$$$4UhVH$yPVj胒 S[Ιt$jt$t$PUSWV[å$$$$,BЉՅt$ t#$RUPW$,$<QhVt$,t;l$VPQhUJPUj腑 ,tWD$ hjP' D$D$DŽ$DŽ$ L$VPQjP,$;$^_[]ǃ,הP,҃¿+w狔у̃ǃƒ蓰S[Ηt$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[JD$ D$D$$jVj uƃ tjljj0jVj賏 jIjfffffffSV0[êt$̀rS[[S[ޔ\jPt$t$t$[ffSVP[ìD$L$T$t$4$VRQP%^[fffffff$D$4̀D$̀fffffffT̀rS[$[PS[ [fffffffS[ޓ,8t3[Ë[ffff̀rS[ä[S[Îj1[ffSV[mXFu!XV*Ku ݏ1^[fffffffSV[t$ u"|9l%PQhR;FF#EgFFܺF vT2^[ÐUSWV[èt$u"|9u%PQhR|$$|$ u"$^u%PQhRn? NV@)19vt$ jvt$Ut$$VPL$  L$T$e$19s/D$ (L$>@9rt$ 1)ƋD$ȃWVP^_[]ÐUSWVD$$4$4$4$4U$0R&UWs=r,j$ J;$u;^_[]Åt|.u|$|UPQhW fLfffffffUSWVX[xM$L$p|$lGtG,t$x>t$|h=0PVt$|UQ$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$DxnNj$L$|PQ I$L$xPL$QH$ǃ$fB$) $W 9$A A L$|PQlH$L$xPQQH$Pj\H$PQ%H$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPbCƅxՍ7Pj G7Pt$G7PjG7PjdG$ 1۸$IUSWV[Jl$ |$t$D$@tۚP) l$$FPj)FF|PQFfFD$@ u1ftPFVPyFVjkFG fffG )^_[]ÐUSWVP[*Il$0t$$T$ |$D$@tP T$$։)͉ $9L$(B99t$4D$,WPEGPl$UEGUVP蚎L$4 )΁r&QPQh=R裮L$8QPOE+l$ ^_[]fffffffS[Hjt$ [ÐUSWV[G$ $D$0$jUDEt U uEEEjyU U fE@$hjV輯 Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhtkǃhpjP, EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU+CD$ djVU PvƅD$$}`hVW ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ xQ0'tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Sǀtǀx|$t$$Whh$P8A$<#t<;t΋$doma1$in $sear1$ch #"j P$P` $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w  A< vhQt$H ƅ_/Pt$iD$ kc$< t< H$< w&A< vhQt$V赁 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t-PVg< D$<@@@@ @@D$@D$8Xj5Pj j$P荮D$PD$;t$ s E$EtJP<EDt%uHu8u X$ t ( u# h6 $ ( xD @, T 0 TD$ D$, 0  ${H:tnq6w 4 8  K<{9u 뷐K<f;{tK;|30ҋ8 D$4 4$t$L$ 1|$)T$ 0 C , t_tUD$tKNjD$ 1t0<2 u*l)փ, !D$ D$ 0 L$$ ( ,},T$tD (MD E,E,, E9u9rT$ }(PL$|$щ)ʃ|$ $sO߉ʐ JHJHJHJHJHJHJHut1 : 89uD$|$,$},uǃD ED$T$)E uY$}[u}M QW迷E7)Ɖ, D$L$,E <$t r }tz1u"t' t"$ ( IL$9uʼn $ ( @D$ J$ ( @D$uWjP<ƉD uxX8<ڈu$ ( @D$uWjPǬD tuD $ ( ,u1ɅD$uBtE,1.0D$D $ ( , $|$;E vAVu趵l$ A AKq NjED 8L$@DPD$ $1t$0 L$8 D$4 19E<2 u l|2 uߋlԅ>$ ( @D ,  ։L$9Pt$ t$D$ 2,  T$kH9tt  y6w 4 8 K<t$k9t$u 말K<f;ktK;|;0ҍQ6w 4 8 K<S9u t$.t$KKF($ tl( 9tF F$FQ($ ( rD R, T0 ^_[]19u말S[QPR jЙSWV[ìt$8$ t3( 9tbt,0 , zD $ t7( 9u ( ~t vV ^[19uΐS[Ît$[ÐWVXmL$ twAQQBQQAA,$ tH( 49u8( 4~D v, T7 0 ^_19u뽐SWV[t$tvT$ ( t/<t)0 , zD qjVVf jVX^[fffffffUSWV[õ $t&j$$P)$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjr菋Njh$t!A3APjhjjEt{Njh ʁʀ $4$ujjjV]!ƒu.pu8u$$! PNu(p$t u|! D$$Pt$W-D$| $WPt$l @ &H+tt(ɀ GGG G GGGjju"C tTP у1uP VPuD $tMtH! u?jUu.s(W誖$t 4$es(1Ġ^_[]À!SV[]D$ pFtjP6*D F!u:s^[ffffffUSWV[t$ D$hEtjPuC EwL$<8uLrE(t6}$.E(! ujUtst9v! tn9΍GjPU t,L$M(}$QVWPUQ !@uEIBj7uB 1WUƅur}$O^_[]ffffffUSWV[Ët$ D$hEtjPuSB Etpq^_[]ËD$8t;v! uWUƅuƃjWU tt$jjPU7 !@uEj7uA yUSWV[èl$(9s$QPTD$ L$t$;t$,w D$,D$1;t$t$it1tKiutWV/l $$t$jD$PVU6u&<$Q;t$,s!^_[]ÐUSWV[XL$,|$(19D$t$hty;D$touF$WV诜)L$(žϋ$E/ht ;D$uD$ )ʼnl$ɋt$ttjD$PVWL$5L$uu D$,91^_[]À!USWV[t$(9s)QPě$$D$ L$;l$, D$;|$tel$Íh1Ґ4B;t$s9Չulj)‹l$ut$($Rt$,Qi $jD$PUVV4u;l$,b1 !^_[]ÐUSWV [L$ ;l$$siT$ T$9s^D$ǐT$8t 9u)L$jD$PUt$,3u2;l$$uNjD$ 1D$ ! ^_[]fffffffUSWV[ t$D$xGtjP7< Gt\u^D$tR;wUjPW t=(@PUW 1PU7b< ujG(u~k^_[]ÃtRG$jPW tՋ(@PUW? 1PU7; uG$ 1랾뗐USWV[ D$$|$ DG4DtFPt$ *.G)VPP# foT$$tWr&l`#PQhRdT$4ft4uf!Bf9sfL$ yfl$l$ Mr&Z~ $P~PQjbR#dL$)r&l͍`#PQhRcfl$ftz $1f/f9tM_l$f9r1ߐff9sfOf9sfO)ȋl$ $fsD$ f@D$1^_[]1f\Of9tTOf9r1fOTOf9r1f\OTOf9r1f\OTOf9r1룸ffffffUSWV[[ t$nEtjPu'9 EjVtE 1t- u1@u)&c1Ƀ V袊t^_[]ÐUSWV([Ø t$@l$<}GtjP7a8 G ujUJ0 81qujWjjjO 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjnN!уtRP5_ u !1(^_[]fffffUSWV[ë |$ t$tGw#jPSdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUVFu^/|$$KQ;v RP螒t2MQUQRPD EG/1^_[]ffUSWV[x |$$G,D$$jj7N3 :Ƌ\$(D$1GDF $PV74\$ jt$72 ƅ\$(F `~r&$Z~P~PQjbR^\$8|$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,t!$1$!cD$L$,tc;l$tW14Eju71 t%MLH4jP73 ;l$ubL$1 Gw)f_ ^_[]ffffffUSWV [X |$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9unLUL$)ΉL$+D$PRT$ Rg $ fL}$fD}9L}D}fufL}1ً|$EftEftUtUr& ȞPQhR[T$ftUfUD$ @8D$$H1 ^_[]USWVd[ |$xG =tjj$Wg$jj$WCt$H I xfL$0.AD$D$D$D$|$ UDu (L$DLu)L$HL$T$LD$DPD$lw9sf|ww L$LT$)‰T$PRQ$n ;D$|uDu|$f+|$tBlj)ωL$RPQ7 DuT$ff+DuL$fDMfTML$L$D$|$ <1 $iEft$t$,pt$T$0z|$(D$ L$l$L$$T$ T$|$xMfv#f|Mt$[D$TP$D$,p Pt$t$(W [L$Xɋ$OT$TT$ ?T$\VL$ЋQL$ IL$(hD$$D$ t$tM+D$,fE<L$9v&ܟџȞPQhSRZXET$)fLEfTEjt$(V$WmO t΋hD$,L$ ɉD$$tQWl$ l$ l$D$ T$Eft$T$MfG =t‰T$fl$D$tuD$ (L$4 .))ƉT$L$<|$@t$8WQ$k ;D$|ufL$fyr>TQ9t$|$|WƋHL$T$TQ9vPt$ |$|WU&ƋHL$(T$P2QM D$ff|$(f}r#L$0IT$4RуDE9T$0vZVWƋHfyrD$0@T$4RЃTQ9v*t$4t$4VWk uR"t$4GT$0t$431ɀNG8G8tO(1;G4~ Wd^_[]ÐUSWV] t$4\$0V{4ufr\$0K4T$Ns DDxKS !T$S$1҉|$9,$~t$ 4L$͋|$!E;l$\$08un19؋$p xL$08rT$0jjjjQPRT\$08mD$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj T1JуT$  1fljڋ$jt$8VPR4z1ɃFttHT$*]tjLjfLjfw8\$$8)ȞPQhRM\$T$ D$4@ftjf|jfDjfȃ^_[]Ë$Vu1Ʌt‰ D$0L$ЃVhP4O\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08诅1USWV[( T$B =t $|$ t<|$,t5|$$|$(j<WjwT$ D@fw'TI֍ȞPQh#RKF P=tfOtfO1 ŋJD~t-9$w$D$ u( D$ uD$D֋$;PD$ u fjT$Ty)‰T$ L$ʉL$‹D$Rt$VPT$ D$ Ɖt$)$ƋD$L$f xD$ L$fDy9f)tyfyuM|FalT$NPQhRBT$2|Fr"lNPQhRB1<$V $D$D$ $09wЉl$$uL$D;QuLN)L$.Wt$PY |$$)Hf,Nf?Ń$r)lNPQhRAT$flFL$fLFt%f~t$t$<2tWŋpf~l$M|FlNPQhR,A1$^_[]ÐUSWV[ø t$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UlƋD$cPUT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σr+lΠNPQhR?$E ʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]ÐUSWV[ |$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQDHjWPVVi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P] L$,1TAGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[6 zA =tl$$G)B fT$L$D$ uf͋t PQt,$Uj}m|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$4@^_[]DGjt$ PV}f t׋@f8u$dž wSWV[ü |$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[f T$$wA =tF)G D$ *$Ffu^L$t P{r4$jkL$t$,t$,jWQPt$DFjWPQD$ 9G u%FGL$$T$UPQ $a>Ѓ^_[]ÐUSWV[ t$0l$$D$jPj :|$dŅtUEfxuftDf[ffffffffffUSWVY T$r 1t\z:_E _E _o ݃E 9stǃuƁE ^_[]ÐSV[J VjVLVP^[fffSVP[ >u1$ TjjPVjQt<$ t ^[fffffffU+aaaaaaaaps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgfsckfsck_ffsifconfigmknodmount_cd9660mount_ffsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsswapctlgzipgzcatgunzipchrootcgdconfigwsconsctlping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %stotalCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp fileinvalid address/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/202502180950Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?mbr_bootselmbr_extDefault bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedasyncgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizefragment sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s %d %d # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s /dev/nullCannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) newbegins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %starget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s, %sError in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! INTSTRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENALIASregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkdkPkNkh@7kDkbLESS_TERMCAP_DEBUGTERMhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lcmsobc|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread errorascii8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},%s %s %s...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupswheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s/bin/sh"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf record%s: unknown variable %s=%-5daccess denied out of core beautifybaudratedialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrkeymappasswordresetvideomodulesbootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!m:pusage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%s: not found%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil done; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %strueallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... chdirletfalsefdflagsgetoptsfcinputrcsetvartestulimitumaskunaliaswordexpevalPPID20220122 BUILD:20250218092744Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%hhu:b%c#%llu:f%c#%u:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinfsck_%sstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedv7fsusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s %s=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]%d%s (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimevltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] inetin_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediadata != NULLsubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s S:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkexpirehopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] SO_RERRORRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlen%s/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Crypto self-test failedCan't lock memoryCGP:STUV:b:ef:gi:k:lno:sptuv-P is only for use with -g/-G action-P only makes sense with -S flag-S is only for use with -g/-G actionundefined actionusage: %s [-enpv] [-V vmeth] cgd dev [paramsfile] %s -C [-enpv] [-f configfile] %s -G [-enpSv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] paramsfile %s -g [-Sv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] alg [keylen] %s -l [-v[v]] [cgd] %s -s [-nv] [-i ivmeth] cgd dev alg [keylen] %s -t paramsfile %s -T [-f configfile] %s -U [-nv] [-f configfile] %s -u [-nv] cgd can't open cgd "%s", "%s"%s (%s): clearing wrong number of argsdevice %s already in usegetfsspecname failed: %sparams invalidverification failed permanentlyverification failed, please reenter passphraseopendisk_werror(%s, %s, %zu) called. getkey("%s", %p, %zu) called unrecognised keygen method %d in getkey()/home/source/ab/HEAD-llvm/src/sbin/cgdconfig/cgdconfig.c%s's passphrase%s: (echo)failed to generate Argon2id key, error code %dpflag set inappropriately?failed to read passphrasefailed to generate PKCS#5 PBKDF2 keycommand failedcommand output too shortcommand failed with status %dunrecognised shared key derivation method %dfailed to derive HKDF-HMAC-SHA256 subkey with alg %s keylen %zu blocksize %zu ivmethod %s unimplemented verification methodcan't read disklabel areapread: incomplete blockre-enter deviceunsupported keygen methodcan't read mbr areacan't read gpt areafailed to parse key lengthfailed to read key from stdinFailed to parse key lengthinvalid parameters file "%s"no keygen in parameters file "%s"Failed to generate defaults for keygeninvalid parameters generatedcan't preserve randomly generated keyinvalid old parameters file "%s"old filenew filecan't generate new parameters file/etc/cgd/cgd.confcould not open config file "%s"\\#action failed on "%s" line %luopendir: %srcgdbad name %sopen: %sCGDIOCGETnot in usedev %llu,%llu keylen %d blksize %zd encblkno8encblkno1printkey1flags == CONFIG_FLAGS_FROMALLprintkeynbits <= INT_MAX - 7ret == (int)nb64Can't disable coresfatal flex scanner internal error--no action foundout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()foofatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()out of dynamic memory in yyensure_buffer_stack()%s: failed to parse parameters file yacc stack overflowpkcs5_pbkdf2: calibrating iterations.../home/source/ab/HEAD-llvm/src/sbin/cgdconfig/pkcs5_pbkdf2.cprf_iteratetmplen == PRF_BLOCKLENcould not determine key length for unknown algorithm "%s"encblknounspecified algorithmunknown algorithm "%s"(warning)unspecified IV methodunknown IV method "%s" (warning)unspecified key lengthre-enterparams_setverify_method: unrecognized verify method "%s"keygen argon2id must provide `iterations'keygen argon2id must provide `memory'keygen argon2id must provide `parallelism'keygen argon2id must provide `version'keygen argon2id does not need a `cmd'keygen argon2id does not need a `key'keygen argon2id must provide a saltkeygen pkcs5_pbkdf2 must provide `iterations'keygen pkcs5_pbkdf2 does not need a `key'keygen pkcs5_pbkdf2 must provide a saltkeygen pkcs5_pbkdf2 does not need a `cmd'keygen pkcs5_pbkdf2/sha1 must provide `iterations'keygen pkcs5_pbkdf2/sha1 does not need a `key'keygen pkcs5_pbkdf2/sha1 must provide a saltkeygen pkcs5_pbkdf2/sha1 does not need a `cmd'keygen storedkey does not need `iterations'keygen storedkey must provide a keykeygen storedkey does not need `salt'keygen storedkey does not need `cmd'keygen [u]randomkey does not need `iterations'keygen [u]randomkey does not need `key'keygen [u]randomkey does not need `salt'keygen [u]randomkey does not need `cmd'keygen [u]randomkey makes no sense sharedkeygen shell_cmd does not need `iterations'keygen shell_cmd does not need `key'keygen shell_cmd does not need `salt'keygen shell_cmd must provide a `cmd'could not calibrate pkcs5_pbkdf2can't generate random bits for storedkey(u)randomkey keygen cannot be sharedstoredkey does not make sense as sharedkeygen already shareduuidgenuuid_to_string: %ukeygen not sharedargon2idpkcs5_pbkdf2/sha1urandomkeyshell_cmdunrecognized key generation method "%s"hkdf-hmac-sha256unrecognized shared key derivation algorithm "%s"/etc/cgdfailed to open params file "%s"keygen storedkey urandomkey; argon2id { iterationsparallelism}; pkcs5_pbkdf2 { pkcs5_pbkdf2/sha1 { keygen_fput: %d not a valid methodiv-methodkeylengthverify_methodunsupported verify_method (%d)could not open outfile "%s"%*sshared "%s" \ %*salgorithm %s \ %s %s; bits_decode: mangled base64 stream %sbits_decode: encoded bits claim to be longer than they are (nbits=%zu, stream len=%zu bytes)/dev/randomcalibrating argon2id parameters... failed to calculate Argon2 hash, error code %d failed to calibrate hash parameters: broken monotonic clock? failed to calibrate hash parametersArgon2dargon2dArgon2iargon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=borderfontbacklightbrightnesscontrastscroll.fastlinesscroll.slowlinesedidmsg.default.attrsmsg.default.bgmsg.default.fgmsg.kernel.attrsmsg.kernel.bgmsg.kernel.fgsplash.enablesplash.progressWSDISPLAYIO_GTYPEWSDISPLAYIO_SFONTWSDISPLAYIO_SBORDERWSDISPLAYIO_PARAM_BACKLIGHTWSDISPLAYIO_PARAM_BRIGHTNESSWSDISPLAYIO_PARAM_CONTRASTWSDISPLAYIO_SSPLASHWSDISPLAYIO_SPROGRESSWSDISPLAYIO_GMSGATTRSWSDISPLAYIO_SMSGATTRSWSDISPLAYIO_DSSCROLLbell.pitchbell.periodbell.volumebell.pitch.defaultbell.period.defaultbell.volume.defaultrepeat.del1repeat.delnrepeat.del1.defaultrepeat.deln.defaultledstatekeyclickscroll.modescroll.modifierWSKBDIO_GTYPEWSKBDIO_GETBELLWSKBDIO_GETDEFAULTBELLWSKBDIO_GETMAPWSKBDIO_GETKEYREPEATWSKBDIO_GETLEDSWSKBDIO_GETENCODINGWSKBDIO_GETSCROLLWSKBDIO_SETMODEWSKBDIO_SETBELLWSKBDIO_SETDEFAULTBELLWSKBDIO_SETMAP +> WSKBDIO_SETKEYREPEATWSKBDIO_SETDEFAULTKEYREPEATWSKBDIO_SETLEDSWSKBDIO_SETENCODINGWSKBDIO_SETKEYCLICKWSKBDIO_SETSCROLLscrolling is not supported by this kernelBackSpaceLinefeedEscapeexclamquotedblnumbersigndollarampersandapostropheparenleftparenrightasteriskcommasemicolonequalgreaterquestionbracketleftbracketrightasciicircumunderscorebraceleftbracerightasciitildenobreakspaceexclamdownsterlingcurrencyyenbrokenbarsectioncopyrightordfeminineguillemotleftnotsignhyphenregisteredmacrondegreeplusminustwosuperiorthreesuperiormuparagraphperiodcenteredonesuperiormasculineguillemotrightonequarteronehalfthreequartersquestiondownAgraveAacuteAcircumflexAtildeAdiaeresisAringAECcedillaEgraveEacuteEcircumflexEdiaeresisIgraveIacuteIcircumflexIdiaeresisETHNtildeOgraveOacuteOcircumflexOtildeOdiaeresismultiplyOobliqueUgraveUacuteUcircumflexUdiaeresisYacuteTHORNssharpagraveaacuteacircumflexatildeadiaeresisaeccedillaegraveecircumflexediaeresisigraveiacuteicircumflexidiaeresisethntildeograveoacuteocircumflexotildeodiaeresisdivisionoslashugraveuacuteucircumflexudiaeresisyacutethornydiaeresisAbreveabreveAogonekaogonekCacutecacuteCcaronccaronDcarondcaronDstrokedstrokeEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLstrokelstrokeNacutenacuteNcaronncaronOdoubleacuteodoubleacuteRacuteracuteRcaronrcaronSacutesacuteScaronscaronTcedillatcedillaTcarontcaronUaboveringuaboveringUdoubleacuteudoubleacuteZacutezacuteZabovedotzabovedotZcaronzcarondead_gravedead_acutedead_circumflexdead_tildedead_brevedead_diaeresisdead_aboveringdead_carondead_dotaccentdead_hungarumlautdead_ogonekdead_slashdead_cedilladead_semidead_colongr_Atgr_Etgr_Htgr_Itgr_Otgr_Ytgr_Vtgr_itdgr_Agr_Bgr_Ggr_Dgr_Egr_Zgr_Hgr_Ugr_Igr_Kgr_Lgr_Mgr_Ngr_Jgr_Ogr_Pgr_Rgr_Sgr_Tgr_Ygr_Fgr_Xgr_Cgr_Vgr_Idgr_Ydgr_atgr_etgr_htgr_itgr_ytdgr_agr_bgr_ggr_dgr_egr_zgr_hgr_ugr_igr_kgr_lgr_mgr_ngr_jgr_ogr_pgr_rgr_teliko_sgr_sgr_tgr_ygr_fgr_xgr_cgr_vgr_idgr_ydgr_otgr_ytgr_vtShift_LShift_RControl_LControl_RCaps_LockShift_LockAlt_LAlt_RMulti_keyMode_switchNum_LockHold_ScreenCmdCmd1Cmd2Meta_LMeta_RZenkaku_HankakuHiragana_KatakanaHenkan_ModeHenkanMuhenkanKP_F1KP_F2KP_F3KP_F4KP_HomeKP_LeftKP_UpKP_RightKP_DownKP_PriorKP_NextKP_EndKP_BeginKP_InsertKP_DeleteKP_SpaceKP_TabKP_EnterKP_EqualKP_NumbersignKP_MultiplyKP_AddKP_SeparatorKP_SubtractKP_DecimalKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9f3f4f5f6f7f9f10f11f12f13f14f15f16f17f18f19f20F5F6F7F9F10F11F12F13F14F15F16F17F18F19F20PowerHelpExecuteFindSelectAgainPropsUndoFrontCopyOpenPasteCutStopMenuPausePrint_ScreenCmd_Screen0Cmd_Screen1Cmd_Screen2Cmd_Screen3Cmd_Screen4Cmd_Screen5Cmd_Screen6Cmd_Screen7Cmd_Screen8Cmd_Screen9Cmd_DebuggerCmd_ResetEmulCmd_ResetCloseCmd_BacklightOnCmd_BacklightOffCmd_BacklightToggleCmd_BrightnessUpCmd_BrightnessDownCmd_BrightnessRotateCmd_ContrastUpCmd_ContrastDownCmd_ContrastRotateCmd_ScrollFastUpCmd_ScrollFastDownCmd_ScrollSlowUpCmd_ScrollSlowDownCmd_VolumeUpCmd_VolumeDownCmd_VolumeTogglevoidSymbolL5_GbreveL5_IdotaboveL5_ScedillaL5_gbreveL5_idotlessL5_scedillaunknown_%d%d: keycode too largekeysym expectedparse: %s [%.*s]keysym %s not found%s: not a keysym%c: illegal character in input%03o: illegal character in inputsampleratescroll.reversescroll.distance.xscroll.distance.ycalibration.minxcalibration.minycalibration.maxxcalibration.maxycalibration.samplesrepeat.buttonsrepeat.delay.firstrepeat.delay.decrementrepeat.delay.minimumWSMOUSEIO_GTYPEWSMOUSEIO_SRESWSMOUSEIO_SRATEcould not list calibration samples%s%d,%d,%d,%dWSMOUSEIO_GETREPEATWSMOUSEIO_GCALIBCOORDS%s: invalid calibration dataWSMOUSEIO_SCALIBCOORDSWSMOUSEIO_SETREPEATinternal error: field_by_value: not foundinternal error: pr_field: no format %d%s: not a valid encoding%s: not a valid variant%s: not a valid color%s: not a valid attributeinternal error: rd_field: no format %dlk201lk401pc-xtpc-atusbhpc-kbdhpc-btnarchimedesriscpcadbhilmaplesunsun-type5sgimatrix-keypadbluetoothdec-tcps2logitech-busms-inporttouch-paneldec-maxinedec-pm-monodec-pm-colordec-cfbdec-xcfbdec-mfbdec-sfbvga-isavga-pcidec-tga-pcidec-sfb+generic-pcinext-monodec-pxdec-pxgdec-txgeneric-hpcarm-vidcdec-spxdec-gpxdec-lcgdec-vax-monosparcbook-p9100egadreamcast-pvrhp-gatorhp-topcathp-renaissancehp-catseyehp-davincihp-tigerhp-hyperionamiga-ccsun24sgi-newportsgi-gr2suncg12suncg14suntcxsunffbhp-stihd44780vesaxilinxsgi-lightgenfbsgi-o2pxafujitsu-ag10displaylinksun-xvr1000omron-lunagrfvncapple-valkyrieimx-ipuvideocore4omap3530windermereclps-711xallwinnerssb-mgxamlogc-mesonnvidia-tegraplatinumprimcell-pl11xssdfbvideocore6ukczbeponeouanodeaddeclkswapctrlcapsdvorakmetaesciopenermachdepcolemakblackbrownbluemagentacyanwhitehilitblinkunderline%s: not a valid number list%ld: number out of rangekeycode %u =adf:kmnwonly one of -k, -d or -m may be givenexcess arguments after -aonly one of -a or -w may be given/dev/wskbd/dev/wsmouse/dev/ttyE0"%s" not shown with -a; use "%s %s" to view.'=' not found%s: read only%s: can only be set%s: write only%s: no kernel support%s: %s Usage: %s [-kmd] [-f file] [-n] name ... -or- %s [-kmd] [-f file] [-n] -w name=value ... -or- %s [-kmd] [-f file] [-n] -w name+=value ... -or- %s [-kmd] [-f file] [-n] -a AACAcerViewAPPApple ComputerAST ResearchCPLCompalCPQCompaqCTXDELDellDPCDeltaDWEDaewooEIZEIZOELSAEPIEnvisionFCMFunaiFUJFujitsuGSMLG ElectronicsGWYGateway 2000HEIHyundaiHITHitachiHSLHansolHTCHitachi/NisseiHWPHPIBMFujitsu ICLIVMIiyamaKDSKorea Data SystemsMEIPanasonicMELMitsubishi ElectronicsNANNanaoNECNOKNokia DataPHLPhilipsRELRelisysSAMSGISNYSonySRCShamrockSUNSun MicrosystemsTatungToshibaTSBVSCViewSonicZCMZenithUltrascan 14XE17GS17PSVendor: [%s] %s Product: [%04X] %s Serial number: %s Manufactured %d Week %d EDID Version %d.%d EDID Comment: %s Video Input: %x Digital (DFP 1.x compatible)Gamma: %d.%02d Max Size: %d cm x %d cm Features: %x Red X: 0.%03d Red Y: 0.%03d Grn X: 0.%03d Grn Y: 0.%03d Blu X: 0.%03d Blu Y: 0.%03d Wht X: 0.%03d Wht Y: 0.%03d Horizontal: %d - %d kHz Vertical: %d - %d Hz Max Dot Clock: %d MHz GTF2 hfreq: %d GTF2 C: %d GTF2 M: %d GTF2 J: %d GTF2 K: %d %dx%d @ %dHz (%d %d %d %d %d %d %d %s%sH %s%sV) Preferred mode: %dx%d @ %dHz Number of extension blocks: %d 1280x1024x751024x768x751024x768x701024x768x601024x768x87i832x624x74800x600x75800x600x72800x600x60800x600x56640x480x75640x480x72640x480x67640x480x60720x400x87720x400x70%dx%dx%d Analog -0.7, 0.0V Undefined monitor typeChroma Info:Video modes: Default GTF supported Preferred timing Standard color space Multicolor RGB Monochrome DPMS active-off DPMS suspend DPMS standby Serration vsync Sync on green Composite sync Separate syncs Blank-to-black setup -1.0, 0.4V -0.714, 0.286V -0.7, 0.3V640x350x85640x400x85720x400x85640x480x85800x600x851024x768x851024x768x891152x864x751280x768x751280x960x601280x960x851280x1024x601280x1024x701280x1024x851600x1200x601600x1200x651600x1200x701600x1200x751600x1200x851680x1050x601792x1344x601792x1344x751856x1392x601856x1392x751920x1440x601920x1440x751152x768x541400x1050x601400x1050x741152x900x661152x900x76320x175x85320x200x85360x200x70360x200x85360x200x87320x240x60320x240x72320x240x75320x240x85400x300x56400x300x60400x300x72400x300x75400x300x85512x384x87i512x384x60512x384x70512x384x75512x384x85512x384x89576x432x75640x384x75640x512x60640x512x70640x512x75640x512x85800x600x65800x600x70840x525x60896x672x60896x672x75928x696x60928x696x75960x720x60960x720x75416x312x74576x384x54700x525x60700x525x74576x450x66576x450x76a:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u truncated(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelIPv4 addressSuccessRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s sendmsgping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumblankcntrlpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signleft-parenthesisright-parenthesisplus-signhyphen-minusfull-stoptwothreefourfiveseveneightless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflex-accentlow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketshut up gccYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaymotuesdaytueswednesdaywedneswedswethursdaythursthurfridaysaturdaygmtutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetetherTokenRingtokenFDDIIEEE802.11CARPmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]sysvv71kv8otherhpfshfsraidframejfs2minixfs3vmwresv%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdsk%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02a./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist