'VݪVgR0!NetBSD/earmv7hf ramdisk 08Rg<  Rg/at atRg@@<@T 08Rg<  Rg/at atRg@@<@TU Rgat`ARgRgRg$h RgRgRgARgRgRgA.RgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgmDde$RgRgRg (08@HPX`hpx@$RgRgRg`hpxN$)RgRgRgK$(RgRgRg (08@M$CRgRgRgHPX`hpxFARgRgRgCRgRgRgARgRgRgARgRgRg!RgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg4!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg B!RgRgRg B!RgRgRg!RgRgRg"!RgRgRg"!RgRgRg"aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg?\!RgRgRg>\!RgRgRg=\!RgRgRg<\!RgRgRg;\!RgRgRg:\!RgRgRg9\!RgRgRg8\!RgRgRg?\!RgRgRg>\!RgRgRg=\!RgRgRg<\!RgRgRg;\!RgRgRg:\!RgRgRg9\!RgRgRg8\!RgRgRg:\!RgRgRg7\!RgRgRg6\!RgRgRg5\!RgRgRg4\!RgRgRg3\!RgRgRg2\!RgRgRg1\!RgRgRg0\!RgRgRg7\!RgRgRg6\!RgRgRg5\!RgRgRg4\!RgRgRg3\!RgRgRg2\!RgRgRg1\!RgRgRg0\!RgRgRg2\!RgRgRg/\!RgRgRg.\!RgRgRg-\!RgRgRg,\!RgRgRg+\!RgRgRg*\!RgRgRg)\!RgRgRg(\!RgRgRg/\!RgRgRg.\!RgRgRg-\!RgRgRg,\!RgRgRg+\!RgRgRg*\!RgRgRg)\!RgRgRg(\!RgRgRg*\!RgRgRg'\!RgRgRg&\!RgRgRg%\!RgRgRg$\!RgRgRg#\!RgRgRg"\!RgRgRg!\!RgRgRg \!RgRgRg'\!RgRgRg&\!RgRgRg%\!RgRgRg$\!RgRgRg#\!RgRgRg"\!RgRgRg!\!RgRgRg \!RgRgRg"\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg\!RgRgRg \!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg$!RgRgRg4!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRg!RgRgRgaRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg?\aRgRgRg>\aRgRgRg=\aRgRgRg<\aRgRgRg;\aRgRgRg:\aRgRgRg9\aRgRgRg8\aRgRgRg?\aRgRgRg>\aRgRgRg=\aRgRgRg<\aRgRgRg;\aRgRgRg:\aRgRgRg9\aRgRgRg8\aRgRgRg:\aRgRgRg7\aRgRgRg6\aRgRgRg5\aRgRgRg4\aRgRgRg3\aRgRgRg2\aRgRgRg1\aRgRgRg0\aRgRgRg7\aRgRgRg6\aRgRgRg5\aRgRgRg4\aRgRgRg3\aRgRgRg2\aRgRgRg1\aRgRgRg0\aRgRgRg2\aRgRgRg/\aRgRgRg.\aRgRgRg-\aRgRgRg,\aRgRgRg+\aRgRgRg*\aRgRgRg)\aRgRgRg(\aRgRgRg/\aRgRgRg.\aRgRgRg-\aRgRgRg,\aRgRgRg+\aRgRgRg*\aRgRgRg)\aRgRgRg(\aRgRgRg*\aRgRgRg'\aRgRgRg&\aRgRgRg%\aRgRgRg$\aRgRgRg#\aRgRgRg"\aRgRgRg!\aRgRgRg \aRgRgRg'\aRgRgRg&\aRgRgRg%\aRgRgRg$\aRgRgRg#\aRgRgRg"\aRgRgRg!\aRgRgRg \aRgRgRg"\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg\aRgRgRg \aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\ !RgRgRgi!RgRgRg!RgRgRg!RgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRg!RgRgRg B!RgRgRg B!RgRgRg!RgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRgaRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgRgRgRgbpf!RgRgRg $RgRgRg$RgRgRg$>RgRgRg$RgRgRg$sRgRgRg$RgRgRgARgRgRgm RgRgRg$RgRgRg $RgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRge7qyqSF|N<&4ghP4}+Ox*yuu~zz>04& hSX|vP<{i8 i\fm BiblQ}H <hL_0\U=I-1V'#g%T|W{ vUJrV *PK(2 C>DvN>q0/:ædS_tAl(X loE`Hg5&N?j2/> =5(GngϹ<{3~M<!P] IE9-+6adT6%G8,\]Ӻd ^{N{ON"yp| ZVUЗcK)de3y"6V<䊐_9g7&Lb؈7єWg!{bF!O96|tOjfwr7YaMcv!U)0s3LR@i sI>6n4at . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4b$4 (X#X#t#t(t(,lLLt#t(t(PtdX$QtdNetBSDpmAPaX NetBSDearmv7hfH-MQ `10 @@PP R     0R/S SP P뙛P( `p`pV*0/V:d>\`\p`pV*0/V: -6'`5'6''6'5'< 'H4' '5'xp@-8@@4PPUp(P`0/h3'X4'0H- @ P@P0/T0(l '2'A-@TpP$`/]P@ "@P@dP PQp |(@*@ @0}0 A/A-p (@@*@ @k 㒃"@` P@"@i[pPPU: VP VP K5P@H-O-M`PL!@h{Ԁ@p p@(@(@(@@(@X b@Qp p p p p p p p p p p p $(@(@BP/@ (@ (@(@(@px (@`P  P A ^p8 a(@P6!@(@Q(@QQ(@Qk  p(@PU k @cP (@ @P@PP2 ppx (p@`(@P` `PP#p Y P  X V @`@@@(@P(@P X( P@ e@ X X* (@P8X@* (@P`pP @P` >XX^= (@Pm*@! @6@ (@P^`pP @P` XX$Q`O$p`I`pP @P` !XXM ^pu `pP @P` X `XI^I p`W^MpY `pP @P` XX--vpG  (@``P@`pPy P XX& Xp!(`pP @P` XX^^Ep `YA`@?Qp Qp Q X` X -@ (@!@(@ ` `@ W i"px (p@` !@(@`pPUS"P(@f @TЍ(@Qp(@OPWp(@U k @xbP (@P 㬙pPvJ po (  PzPwPʇPpUb 㑙ppPZ(@vWpm Q@`V PZ ` V ᕫP  @_Q (@` ZP@ 3p=@Y HP@y (@!@&(@OPU Kp G!@(@`PUhG8 @`V V`1@l6!@gO-M`P!@㴸&|Hp@ (@@  0QPd@Q) ,,,,,,,,KPP HP 8LP PP: RP /@   XP!x" ( @0Aq@-T@P V PX P pRpP0px (@ R&p[pZplQ @@RX `Pl@ ᴙp@ 7@@P @ `;P "@P=P;ePUp`@ P2Ldd@@P =pPb  @)P @ $ `  @`T XZ XQ 9/P [ !@` "@8H-d p (@@0Y>O-OM@P]!@xm(@ (@$u(@ (@`@(@(p@(@ ePH@ Q,X L$\ (@(@(@oP fP6 iP9 lPF((@pP/ rP2 vP<0(@aP. (@(@(@ (@(@(@ (@(@(@(@,(@px (@@DT,%(@( @ RQ' %(@( @ QR Q (@Q(@Q G@i@d (@Q (@Q4(@㋗8(@凗pDh(`@Q$O P@ =vVPQ/U P  A A Q Q/R h@ic (@P&pcP'T{,(@P (@P! (@(@ p  P) T^p/U$@ !@ p !@  P,(@(@p `V @ PUP:@ /R @ @R: A` @/R `V  <(@/O-M` Pp9Pz @;Pm  (@P @p@PTh8hh8hh8b   @  ZX 0` @@ P \ @;pP-LPPZ, P/W@P !@^P 0,/QV/Q/P@ E0A P: @V   P Pp/Q  PP (@P pP2 X 0`P!0#0`(%0#P @ቲXp  P  ^>Z  U+ : S 9 @PnX Z 0ZE0P0%V UW`8h\h8hhh4(@PF uD,5(0@`5(0@P5` PSM Sg@5@e(0@(`@ Rpc P  P) PS m@%  >L(@P  P P LP  PPPpU 0P(@P( G @ "P (@P LP@%( @AQ<@P(@P XN @ӱpW:2PpaP 9Ѝ !@ "@.>@ @0@6_a .?@ @0@?_@- M@0 `@ *` @*@TP @z ЍO-M-MP((@P (@@ӕ PF   up<} Xp(@P (@P`(@P (@`V`Yk (@+Tp8y , (p P@ p4` x 0<=p  PM$`  Ap (@8P< (@(@`p@0GT# P`P  0 A1 `$ @ 4 00@p  }@T` !@$(@P pH (@(@@ @fP@sr (@PP (@@+œp8p(@!@pt`xL 4<D(@(㪓ZP8 Ap DUh%) @Ѝh)@$/H-@H-M + @ 0#h%) @ЍH-M 7 @ 0H%) @ЍH-`F)@)@@P! AP R0PPPhU)P@aQ8)@ h%) @/H- "@ !@kH- "@ !@bH-,!@" @ZH-,!@" @RO- MP@j!`@ᨯ px (@@7F)@@$P  6"@!@8$(M@( "@8яp($ ?)@)@ (@P: @ hUE)P@)@@$P "@(81@$# "@8 !p(8 $0 !3/ p( $ !@h)@xheP)`@@  BP XF)@@p PRp3WP PU)P@#   Q 0p@(!S#U)P@1#1/@)@@@o@[@[P)@@ @ @-( @P@ @P)@  @ 0R*[ Z [[80 ($03/Pu p?!p 08op@@? 0 `)$ PI !@g  8p!( p1/ $!@p   0@`P0@ 0 p@8 0@@ 0 @ 0   B H)@U)P@1/wh)@@ 0iU)P@ kY @H-H)@@P 8@PC @PP-hE)@)@@  aR*FkZ! U)P@` _Z!`Vp `(P 81/p)[P 8(1/p!@v+@oO-MhP)@ E丅)@@)@pP P)@ m  80( @0004/ @p  PpP/ Z P`8@< hP)@!p?# 0@#   *"@ hpEP)@)@@ '%'  `)@Q ``$)@ @㇪  S pWPWQP p Rp0pRp k*h )@E)@@" " Az@H%) @  p`> Ѝ"@ ЍO$ @$ e@$ @$ !@H-MPP p@`)@ 8 ((03/@ZP ZPЍp@-(PUp@8 03/p`81/(`p"@L@-M@(8 2/P$8  P 0( 8D3/P ( 0 1/pYP  Ѝ$ !@@-M@->PЍ@Ԟ PЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-MHE)@@  @ 9  @ 10㕍븕0)@(^^@@8#4 @,dDPp$8@HPpK -2 }?N}SbAW(/ P,$PbGS"CS?0s@h /"p@`@@   @   d# @dK ݋   @   }# @do}K ɋ    `C@`#d @\jK ᶋ /0(S؃`Ge 0!s=@@# @d` P=KK ᗋЍN@-@K4G-Mf)`@ 9 0pWE @]㨕㜈(P@)@!@8 ($0 3/PP 7 Z$p!8 ($0 3/ R!:80 B($0  @T@pGW0p@(! pS#1#7/p Ѝ@$ !@B-MhE)@@ 0P`*(!s# p1#7/p#C P`80 ($03/PP`U: 8 0(0  H3/p Ѝp8 (  0H3/p U* !#P"`P $ !@LO-qMM`}!@㘪( 0@@lFhV)@@)P@  G@-QHIIRRRR(JIRJRRRRRR8JRRRRRRRRRJ`IhIRRxIXIIIRIIIIRRIRRHJx)@ p)@t)@)@)@ )@)@)@|)@)@d)@)@)@)@P /@@T nQ QoPo@o@)@,IpPP ,IPPP)@UP @@W ,qI@pPDpt)@P )@Px)@P)@x&)@)@) @ RP_@HP x (@P뤆P)@ AT F|㏟P   `!@@ @#p @  P @P@@P )@!P )@PI E)@P)@ _RP )@P1 ᇦ- )@P)@Q! )@P@ o @sP )@ )@P5@ 0X@TZpd)@)@Q )@Q P )@PDp>`GpȬ @&)@P +P )@P  ,J뗺%Z P  ,xJpV d @)@`F꤆)@ppP)@P(@U y0"@+Ap)@P)@[ 0t )@@Ș`$T Q eHaHP`U7 $ `` P a1;U0\0 ";@%+![ *ar A  a1;U0\0 "; P@ $@+! *`r*a @0 `@r*b A `r ` B p[tU)@P)夆)@Q' P :PL| PpU:pt)@)@PtU)@P`)@`U (rqߍۍp@@@@@5@@H-U p (@@H-M@P P|`PP `PU FЍT@]0H-@)@P Q P P Q)@)@ 0O-MM)@P  0P %R @ MR $c@8LxP)@p0`P&0R @ @Xh @3@~L xP# @v C|0@p !!t@V X)@㔦 )@Q lF)@㰶)@@)@P P#  P4 @@R)@@  E P!  (@@@ @= B(0@ 3 @ @,  (@@ A@ h)@Q (@  @)@}&) @@P=P(0@  B m0(`@ R0 0S P` P @&`)@P vp7@0@T70@; @  )@P uo'@ @_@  0a@Eb(@ TpRH TP0h)@Pl 4 )@`Vo8[Dp@P0p (@["@  @p0H-@)@P V)P@P sH-p ,(@)@ %ipPP. `)@)@ H@ Bd P  @-)@Q@)@ @0 0AQ00////O-MxZ@)P@` V V' @ЍP Q1tZ)P@p)@` QʔPA)@rP pP  0  0oP2PJ`PUp@-@)@h@)@8X@)@)`@@ )@)P@@a@PpL)@p K- xX)p@)P@@P)@8)@l)@  jP Q`L)@#A6O p (@@ "@PL)@yO-MPx P)@P (xH`p ) @)p@)@@)@(@` Q0PR+h`)@PJQe  PJP  R R `PʌP  @J(P @) @p PX@J(P) @] jPu p)@ R)@P#8XH)P@)@@0 R0002@ṗPa 8(P) @)@P)@@PL)@me B( @) @px )@PPt MP9J~`P0J h  )@P,Jx )@P( @) @pYU< p)@ @P @JP PP8`PJA @'Ѝ P,`6N @ "@8)@PL)@ [ @wH-)@)@0S)@ P0^A-P() @)@(P) @0N^`pAT V@@pW@`V@@P@PA-@!P @0b @ePP >`P9Jp!PM啠0p (@["@ 3o @`" pD)@Pp (@@ h )@`@ Mp0p (@["@  @nO-MP@m*)@`) @ 08)0@| )@pP h)@p@@pP)8 @)@)@P8 `T ` @P, PL)@X- VpPW(J@ `TY [VZ)@)P@P" T@  P-L)@*& ! Z@)@)P@p (@m0p)@ 000T0PW pT` Q`ЍAO-M0H$ h8)@@)@)`@)@P PP@:Pu U4`3pZ  Z  "3 ʕPJ $8)0@ Q `L)@`O P )@O$ )@R R,P0p00啕P $)@`PPL)@VY  '^L< p (@@ "@;P8L)@71 @Z+  )@ )@*) @ QR P  @ !L p (@@ @ЍnA-@P!P @d``P  ;P6Jp!PKɞ0p (@["@ g @ UpD)@Pp (@@ THUPK姞0p (@["@ E @PO-Mp`0)@P @W( W&|@)@cP) PW )@P)@P P PJ@AP*`p P0)@P  ЍH-0x@P`)p@T Q @DPp[K9 p (@@ @8O- Mxj)`@@pp PW.@P' ,)@(88)@W)0@!  W  ,P@Py 8@)@PP L)@ @p Ѝ@ l? @@PJGZ(hGP)`@UI ` )@P PBpZ8 Z)@ pPo `pP  `L)@`  )@(?U5 @P. (hJ)`@ @PJxPPZA @J僝 p (@@" "@8@)@PL)@Q} QpZ()@@C8h()`@)@ ZPᓓP QP% @+jJH p (@@ "@GPLXJ6 p (@@ "@5P:L)@@ -O-MpX 08`@(P@)@)@)@pP p @:Tp`E`` R R,p000"P; QpL)@J D` )@@ V\  )@I応! @`, @@`Tx)@ЍI壜 @D "@@PL)@ R O-M`@P > @mpx T(p@ (@[ `Q A` Ep Q? P@<Z X"@j` A` \P @^RQ*p #QpQXX\X\`V C @ Q>P CL:@@0@`p Q0A`0QXk8X X 3`p A`0Q&QX X XU`p QQ0A`0X X XpC`p QQ0A`0X X Xp2@TPu`P@`XX X ЍO- M;PPr@op <UZx pT(@@)@P@(@`/p@)@ oP p EP% SPH)@`xP! sP& pP AP! -PD)@P``@)@`\  @ 0?;D)@`@?P @"H<P@HHx@HX )@`P%[P)@QP P $PP n @hP{ @@?Pm @hq @34hq)`@P 4+@) @Q !@X<PPJ `)@P P3d )@PJ+ P0JP h )@pP$Xz)p@PN D)@PIn @h @P)?P. P`A @`Pu u6 u( n @qh ?PX P)@Pn @ch @>PP \ )@4; @)0@DG4 "@8P) >P\ )@4; @)0@%p>P !PD  T)@"3=4+@) @OH-ML@)@0 h D{P JP#@"(@#% P#@"(@#%ЍH-8)@QL@)@0  H-8)@QL@)@0  0H-P<)@@P !P !@BP /9P @@0A-lZhpjtJ)P@)@)`@)@@PJxz)p@ 0 0 ;R,R ;Qp R R  QpO-MxJ )@@(@ 00@ P  00@ R @p=0G=SG`PlX lLL$ؑl,ܒH\ ȕhHlLld)@P; 8 @0 W$ !WZl )@P PP%J` QpR nR lR   `l)@Q 0l0CS  QP`| )@PPJG@okPJVW`GW`PpQ nQ lQ` @`pQ nQ lQ`l)@QD`pQ nQ lQ`l)@Q.`pQ nQ lQ``pQ nQ lQ^`hz)p@kPPzJ`PpQ nQ lQ`hz)p@PPP_J`PpQ nQ lQ`X*) @ R D(P) @ RA l*) @ R@ PP3 p`PpQ nQ lQ`l*) @ R@ mPP !P$ @l)@Q`pQ nQ lQ`pZ)P@Q  ` pR nR lRE   `h )@PPJ`PpQ nQ lQ9`p )@P P` pR nR lR4   `h )@PPJ PpQ nQ lQ" h )@xPPJpzt)p@)@`P~Jl )@P  XJ| )@P V X``PpQ nQ lQ`h )@BPPQJ PpQ nQ lQ h )@'PP6J PpQ nQ lQ @ l )@P| p)@)@kPP p`PpQ nQ lQ1`匊zP)@)p@`0 A R*KD P\P@D"Px ` QoQ Q gQ`pQ rQ``h )@PPJpjt)`@)@pPJl )@P= XFJ| )@PA`pPpQ nQ lQ`l)@Q`pQ nQ lQ`l)@Q @pht )@)@ VPPeJ1@PC ʱm(`@PC"P @ H` @$ @= P6l| )@p*)@) @Q 0 "@XD P#d )@Pp )@uPP |l )@)@b PeZ ht )@)@ PPJp  )@` PDX)@)@`qW`P`Q`"@)@Qn xP Pd )@Pp )@t )@PJ9P Pd )@Pp )@t )@PJ|  )@0RQ Pd )@PiA P Pd )@P[p )@t )@P X  QuP Pgp  P P`p  P PYp  )@t )@" PpQ nQ lQ P P:p (@)@|:)0@0SB`P P'VGGGoogPPQ" P4)@q. P T /@-)@( @0 Q S   P4 )@P p (@4+@) @ PPJP 0l0CS  P @P Pd )@PTH)@@Q opP)@p;PJ |)@PX )@t )@p )@PpQ nQ lQ`P PTH)@@Q  op*P) @L 0t*) @ !@@WWPwJPX )@T @d} @g @b"@X QY ^Q QKJP)@@ OD)@P^'"@7P P5| )@IP8J 1P4JP7JP!P T)@ -TP)@ R P@pPJ (@X )@@ (@P Pd )@P  P' @8X[)P@ FP *) @Y P h )@&*) @ )@PL)@n[ )@)@" PJd)@ RZ  " QpR nR lR   h )@PPJ`PpQ nQ lQ`P PPY  )@ Y!P  l,o oRQQPPhL)@ka _DX*)@) @qY QR`hi @EP P?d )@P ` PpR nR lR   `!P  ,o oR]Q[  @P P P T )@,T)@N! @JV @DPЍ`PK-P" P| )@P3`0P hp)@@P  0PP JpPW@"@@O-MxJ )@@(@ hz)p@P@ Y  @ Y A|)@ I6Ru0稩<\<``v? ӭPPg?"Pcinl:)0@;Y p*) @PPR.YPGI/Io[PHJPY7^YC 0 @ S @%^Y-YPn? `Pc?"P f^Y`-Y`P ]PP JJ"@ @/PЍP U"@JQPO-MY7 h|)@P)@pU W!ppWpW  `P @ )@P  0  0eP pW @ЍH- (@ @)@HO-Mhjd8xx)`@@)@)p@)@P PPA  Q PMJD `)@PQ Q=P.Q& P# PT  @P UX)@PL)@  Q PL)@ Ѝp P(@ ` H-l*) @ R p )@t )@p*) @t*) @PP| )@ Q"@6O-M8)@`  v P% |)@P$@Ip Pd )@P (h )@ @X )@P pRPL)@ЍeA-MxZ)P@ Rj㘊)`@)@ QG8xL)p@  P_ Q@7L)@p0 j (@ @  00@ R R{ @@0s@P) !Q)P JJ)@@ L@ 0 S0 0pp pp 0p WP@P@Ѝ P @q=d p (@@ "@c@PL)@ K-(k@)`@p W 8$)@)@\tP$ QPL)@50./OW $ G)@ 0\S00S@ Q  .=  p (@@ "@ PL)@qO- M@| )@`P@ P6 8㰚)@)@PP p)@@Q Q@  Pq *) @Q@L)@  41` P `)@@Qڰz8X Q)p@)P@@  хPR  )@@R L)@l f )@ @KPNJhZD)P@8H )@)@@P  P X)@ P 4 /P+#o<M p (@@ "@LP]<; p (@@ "@:PL)@  ЍL)@ H-/ ( @  @*aA) @1S )@000O-M|ztp)p@)@)@@ 8)@`PBP0`UP00p`@7 -P P $P P P` P1)`Pp`QPp B@dh )@)@@Q X)@ P L)@ЍDH-P)@Qe|zL()p@) @0@`S,   @@ up$A!@$P P.P` ◀P @ᓖP/Q/-e .Fh0 p@@ N)H-P)@Q L@)@0 X )@žO-MtzP)p@-@p )@`0phV)@0Qp0  BPQCS8x0FXP)p@)@P% `U ` CPP PL)@@HX@Q PL)@Ѝ?O-MH<)@)@   @@g {x@)@P^ p )@`8㠺)@Q)@  Q  "`ȃP *) @Q`L)@AB!P !Q" Q %QU YA Y `ៃP *) @Q`.L)@' W_ @U U`P *) @Q`L)@ PP \R  PT)@Q p,)@`QD  Q ,`=Pv *) @Q`1L)@* J)@@QQ z)p@ R( R `PN *) @Q (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`L)@  A Q P A Q   P 0 Q:p/J)@@UJ)@@L 吊)@ U  "`ςP Q`/ J)@@59僌 p (@@" "@PL@9o p (@@ "@nPL)@" "L)@J)@@ -)@P!@oBЍ[ @ @@-@q~P 0G9% p (@@ "@$@- )@ R :)0@AT B R@Q:H-P  q\Ro MH-M 4  0)@' 0{ЍH Ѝ/H-x*) @ P P' @@G00 QQ \\)P@@T< @@78@P3 \lP)`@z)p@P Q}P @@)@@ |P 4+'1) @婃@@ 8噋 p (@@8 "@O-MxP)@`@ P P@ @\P [Pn@P] P]  PPd`D)@V` )@P8`)@)@  V  "pᔁP PpPL)@:+ , )@@P)  0ЍO\R80 p (@@ "@/PPL)@  !@ @PЍH-  ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA-xp)@PPP` Vh )@P @3PP PPP1 @R7PP P7"P @PgPPO-MxZ)P@p%P R lLPp )@)@@[h Y8 Y)@ p` ,PᫀP  QP @pP L)@p@P  \Q Q'Q# Pd )@P ph `J(`@)@@P P*P P ` @Pp )@8X [)P@p `  "@KP  Q@ @$(lL)@@P"} @7 p (@@ "@PL)@,@ h)@ Ѝ6҉ p (@@q "@PL)@  @p  )@+1O-Mhzp@t )@)@)p@Q o @uP 0s`VjJ@V2 XP_Jt,8) @)@@`P6 @V ~ `P( T8@)@PL)@8&t p)@)@AXW 0%`PZ8)@PL)@   PJЍO-Mp`PU% )@P  0/ @` 0~P t `)@@p[B ` V? x )@[#88t)0@)@  [ , pP 8(x)@) @唚)@ppPL)@P  0t<)0@ 1* @Fx  `)@pW#8 W)@  , ~P x)@ P唚)@L)@P  0 )  0PxJ@`pQ Z Q  0 ͔P] `@x )@ Rt R8)@)@,p000q~P4 x)@pPL)@jQV  P 4 @(P  05t|)p@ )Z  5 p (@@ "@P ߍ5 p (@@ "@PL)@ 4ɇ p (@@h "@8)@P6O-Mh|)p@x8t@P)@)@)@0ll)`@ \P3 &Pm P`D R0 R 00< p}P ph|P)p@L)@UBF P00@81@Q70@P3R`D R0 R 00< p}P ph|P)p@L)@UF P00@ll)`@(T  T P  "pX}P= ph|Q)p@ L)@YZ@IP]T  T P  "p*}P QpL)@12)3׆ p (@@v "@P3Ɔ p (@@e "@P@L)@Ѝ+mG-逜\)@)P@p`P|d)@ BP  p (@@0 "@~|L)@@q   0!A-\)P@AQ |)@ 1S@pT 5`U~V@AQh*) @ |(@ )@ (@O-M(@p (@pO @.\|*)P@) @h:)0@PX )@"8)@|P)@J 0PCpa@FT:V, V<!0 0 10`'0CaP`!` ` a!P@ !`PP` p`! 0 1p0``Sqp'q0 /P0 1 0C @P`p` 0Cp d )@P 1h*) @P  |*) @L)@ЍHO-M`@P/K'P`"@V.P*! @ṕpx (@EQep_l|㌜㔼`@)p@)@)@ ᚕePrPf@PbPP )@KPLP PPMsP vP wPE )@FP )@ )@ )@ )@ )@p$<)@= x (@)0@R-RE ,) @ R R<|)p@ )0@ aP P P @ "@ Ef)@@Q OfP  P1O 3fP  PPP `P PP5!@ H-1 p (@@0="O-uMM⠜)@P`P U7  +< QP a.P" @0 P;1?H )@)@ @Q  2/P   Pz1 !@YpuߍڍeP   P )@P eP   P PP, )@P' /P eP j @@+P a.@0" @嬾eP @  eP`P )@PVz )@PVH P( 5d0 ,P /%P @@/%Ppp,P D [G X Tj  @N% e )@c 0Pc dPJ p)@P\ )@ 0 @㘾Spx (p@X$밀@ CP@`p (@t` P@ep P YP )@P   PBddPz   @ 0p"# .NNdPZW  $.dPI 8-<="#A H-L="#9  @ E\\,\ \ ,H-XX0Dd T  V H H0S \\H+H-XX0Dd T  V H H0S \ \H+H-XX0Cc T  V 8 80S \\H+H-XX0Cc T  V 8 80S \ \H+H-XX0Ee T  V X X0S \\H+H-XX0Ee T  V X X0S \ \Hl+p@-X X`p@tPp`t0 T  V  p\\p@W+p@-X X`p@tPp`t0 T  V  p\ \p@A+O- MP@ !@(`&발P)@ h DpcPP$(@ p)@ )@`bP㼬m)@p`@ x1@GQ>HP\hD4T8d<` )@ )@ )@)@ )@  )@ )@ )@ )@ )@p )@ )@| )@ )@ )@ )@ )@ )@@ph )@ )@ )@ )@ )@ )@~ )@ pJ  )@q )@ )@ ? )@ )@` )@] )@ )@' )@  )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@  )@ )@ )@ )@ )@ )@ )@  )@ )@ )@p x )@(@,) @)@PP !@2P B$(@P 㨼)@-)@) @`q =  )@)0@V`)@)@`R,0)@) @`S` Y` ``^`RQ X)@ )@/Y)@Q pP P P6l @0pP P P, @&@# )@P @@ )@P p@ )@@ @ )@@ D@R$)@E)@Q p@)@Q p@)@Q @+)@ @0|@S(-P) @ ,(@  )@ ЍH-- p (@@㯻ᔸO-Mp )@@% @P RP P`  )@P ЍO2 )@pPbxP\ M㬬p@ @@)@@PKP4(44($  |8LP \.P )@P*  )@P, )@P  @㔺 \ |P  @㈺, )@J )@PX  vpP,@,@,PЍ "@ 5S \ S \ \  S / S ,) @ RL R $-) @ / S \ O-MQ \)P@)@`pL )@PL @(P$8<4T HD@0, ` PP $ \ @|p )@pV \.P  )@P )@Pp0PPLPP X`40@Ppt Xp   R0RD 40R03PP @Px0P|,pD  U  RH pP,pS0P H * ) R ( R4 S"60 S 80P< p0 80Q< l )@P gP0+" " @#PP )@P [ 0+" " @ P (Y (p$W$ )@P k @ P `pP pp჆~ )@P P s7v\)P@p `TT@TTQ PLP㈠ l8)`@<P  ,0)@ 0B?v%s@/ @㗸)@Q V%@U%EQ$s@  @D@zH0+" " @qQ @s@/4 @`n@ )@@P VDUEP@@( P sp!@ 0CQ` 0:HQڴD@P( )@1/, )@ Q  uZЍH-PUph @(`@ p   $`P@`XXpX 㛹PUH-MPXp `)@P  @4@@ )@P. )@P p  !@ӶpH  !@x)@ 0B?$ )@0@Q@ @ )@)@ e )@P q@)@Q @Ѝ )@P  Q @XO-4MM@-0=) @)0@ RD PU9 p 3p2`(@ ) X)@P $ @㢷 )@P1 x)@Q *! @   ; $?p  !@ Ⴗ)@ 0B?# )@m0`@P@k  `)0( @ ` )@P %0@V % @Q )@P   @G   P(8 40 &  P$,@3`p)@Q !@` ӵp , !@  )@P 0 )@P@P )@)@ o )@P { )@P  )@P  Q  PJLP a." @0\(\0! @x +[p @ )@)@ "({0v @b )@P  )@m`@,P@c !@㒶`P@`XX X طPU4Ѝۍ@0H-MLQ ,)@) @  )@Q  0J 0;$!@@@p S@RЍ0,j) @]N0,) @ P S@@@@B?  0Ѝ0H7@H-M T:^PP@pH P`p(@@V`Q A` p Q P X X pGwXd )@P P`U`Q A` p Q P X X `F vUXG/p0 /O)@!` @0 p P \ P`U`Q A` p Q P X X `Fv*X`pP @P` XX X P``Q A` p Q P X X `VX`pP @P` XX X Ѝ0H-@ )@P ]P"@YPP\T00H-@ )@P uP"@qPP\l0 )@Q \ a"@[\!@WH-q! Q  ( l (  ( (  ( (  p (@`p Q0AQ`0NX X @GIp (@`p Q0AQ`0@X X *6p (@`p Q0AQ`05X X =(p (@`p Q0AQ`0*X X %p (@`p Q0AQ`0X X | p (@`p Q0AQ`0X X /X@ X* X=X%X|X/.O- MpP )@P$P )@P )@P,P )@@ )@`>$](P@`Q ЍOF4M(@@p8})p@Q oPt   @Q  ! "     QP`pV`PpWEp P(@ V* 8)@)@0P,$ XP@E`pP @P` XXX 㗵@T@Z`P@`XX X ヵP Ѝ;ptO-M@P )@P$P )@P )@P,P )@` )@p$(@`VЍO`\ppX (P@W9 ` / [`P@`XX X ) $)@P,  PJ`pP @P` XX`X YpW`P@`XX ЍX ЍOO-M@ )@)@P$` )@`P P,` P)@px (p@P`UH $,(@ = [2`pP @P` XXX,㻴`00@`0 0 QPpP XX P XX X 㜴X 㘴$P,  PU`P@`XX ЍX ЍOzp@-@ )@`P RhjP  V P@!@  pp@@ |O-CMP@D$A$@T4∠pD  0 Evp `p V wP?P ?` $ P (@W:PU:? Cߍp@- M@ ` #vPp TR BQP  p (@X0 dT *wP ЍpO-M@`H!@dw:XJP!@/@ P χmP ثP pePopPpx (@ATe l@p"@ Xp UJ:WpE!@O>`` 1  ` 1 [ pXp [ U:Wp D$pXP Jp  P[ /p2$pp!@`@TᐯH-$ p (@@㟲ᄯO-MMP@ᢪ!@vnD@`@)@p)@ +hPfP hP< )@ vP iP:  H )@pp.x (@PEU(A L)@@o#< )@PE!XP  P `$Z P !@ U=NP Z/P / `p.p/QP pp/EPPP  Q:@|s`  P`X@H-[# p (@@0خP )@/O-M-MP@ )@@PWP VPs N#P 8WP 8`WPM !@ @ gD )@PvWPd @X@  PMVLL )@P aWP 8jWPWWP)@~T2` pX< !@"0@ V0p (@ @py0@  P  Up$@ Up GTX})@)p@XF L'WP @㴐``p (@@ Gph (`@P@pp (@vpw W  AQ e Pp `YPD !@y$글gP $ UP;pp 㵋(@` SUP[P `)@P  K0 A pማ Ѐ C0 AP)@ 1@ 0 @  ְ p$FUPx.$ p,@"$QU80 `@*` @*@ UP %@TX ~UP" #"P 3@@@P!@cVP @@@$U U1@ YUP G@ݏ SUP !-P T@Ϗ TP !@2VP @H `)@PG @ ᠯЍЍ Y@0H-MP@UP=  p  o@@q o@@㓏P$R o@@qЍ0UP7  p  @@@@P$R @@H  )@0oOPw}/@ @@@ @v6"0@!@OU /@O@@@ @M-@M8}@(p@p iT` )@、d )@(@h )@l]pm')P@)`@* @Pm""@#p##T5 !-Tp5(!)  @0)9,T2 !Tp;@T. !TpB !^  @0 97T (@t M)@(@t <)@(@px)@Q" t D)@(@t D)@(@ C  @08px)@Q  P J *@Q Np M)@@/Up  P  P%  PKt  )@@ @L8 t )@~ 0 @@8S@ 8DUPЧ`V T (@  *@*@` (@nQ?& & &x' &V# *@PU  S 0p*pY P Чp `VE:VE@1*}:0@P 0!QP*@~\V0P% \ V  *@PU ?  z ~\  0r \U [ V*@P~\ ~\*@PT (@` (@P@ЍyH-M pP`@Sp/2Xp(@.P VpSRRV Si `@Si `@SRR 0p Ѝ @ @ @K-M8}(p@pڈ j *@*`@p)@- P* *@P X *@P @   d )@*@h )@ 㧮 XJ *@*@@  @cl])P@PM)@@SP   Pt )@SXM(@(@@P | *@P PVRcRP  P XJ *@@@? *@ dh )@)@0P SPR" Pz *p@ P\(@     Z XJ *P@*@@Q P @  *@* #P *@ @P0 ) *@* @ p 0+09 0 @dP*@PЍO-MMA"P"(@@`幌()@ P *@ Zp00p  (@㰠VXW P 0I `*@@$)  @#@0 / ~ @/)  @0' p @7U8b*`@Q 㠐$)  @ 0F"n'  @ QQP@*@0` &~! @/)  @0۫' p @"08'0y * @*p@@$i \=`@(0@     *@ 㹫 p0 / n @/)  @0᧫H'  @ "`0嚫U "N P *@"> @ ᑬߍڍA-~Mp )@PT](P@P 8m @(`@~,PP~܍0H-M)@@p )@P8] (P@0@QJ 0p !  @5@Ѝ0H-p )@P* @d5` )@Q \ *@@0 *@ S5H-@P`p PPp@DPTWH-@P`p oPPp@DPTWp@-T](P@@T9 p )@`8 (@uP@VT d*@)@ 00T" @ ` )@Td )@t@\  (@@ @4Q\ (@! 0 @P5pO-MT(@@T8(@`pP  PP@pPE`UW@T d )@@)@p )@^)P@@Q *tC P @@4@sP4TP  0Q*J P0PZ#P P P tP P@@EP@@T JT @d )@PT @a4&T tP *@Q AQ  @\  (@@ @G4 ^ @\ (@;" 0 @4ЍG-M@)@P_T(@PZ (@P @Od)@Ph-0) @0p-) @`V!*8 )@(@Pp 0p.QJUpV` oR` 0 U0QZP P @ 8 (@ HPPJ% @@3ЍO-MpPPPPCT(@PU>pP)@@P7:8 @(@` 0PQJ )@p 0t8 `Qo(@``r`pP  0P0 S P  PY#  @3PPЍO-MMT(@`VJPp )@P PyU @c3pV 8M `(@@p~,NPp8(@Mᎎ@H/`H`Ppm/H` Pp~ ~,NP} `@~,NPpd/H`H`OpGW` taQH/HOpp p*@`@US  0$4! UM + @U8m(`@ 0q& P 0s\  (@0P  @o`p'-H(  @``pq! $  @((  @ #  @p(  @ (  @3p`pߍۍ HqOp[$ 0 @( 0 @2O-MM  *@Mp$  @2  Mp$  @2@)@P)@P$)@P Ѝۍ$k *`@P *@ @2t D)@(@PiP <(@cP p )@pWWWP  @62\ (@ @b2Ъ  *@@\2  @Y2l2P6J V g I9 Z p@P@`@!@@@@.P& P  `P   P  12.2,2?2PZPZ @2T @(@n\- ( @3 @@W 2 T @@W2~% (@ @  @Q1Њ  *@@1 @1 @1 @11P9JJ 㣥 E U v t`@@@@P@p@)@.P) P QrPYP SP ?yPp7i @sP3 1 11111PZT @(@@.) @< @1 *@ N)@@P dt.P)@) @ @ @1#T @(@y @@@-@(@p'pH-0)@P 0)@ 0*@F)  @1H-Mp Hyc)  @{1@-@TMplw)  @0m1@p@-MPM@p\@PP NPP  P P M` Mp   P B`@ЍpO-M@PsJPj *`@H0/PlJ 0/PgJ@ PU8rp (@*p@̄㸔X @Q @0`3/P= 0P*4P3J%f"P!P*JP%J/P PPv   0p (@@  0PP P (0/ *@ K SЍ)  @0O-MhM(@(@@P J\(@L B 0SPp\PfJ*@pL  PpWPH \PEJZ(@PN  @&0  `(@PJH  2/~p(p@*PJH  2/pPJZ(@P"  @/Vp pF  nA @/ LA P *@*@T ЍO- MP *@*@p`pPJ @P,PJ *@@$ 8*@2/P F R g80*`@ 3/P @ PG W(@PB  @/ @`p[ P P pW(@P t @/ bp P+ @u/ ЍQ @R <8*@1/P *@ @Z/O-M`P=JP *@H0/P6J 0/P1J6'P.J㎅@ *@PP (@JP *  @/p *@P $PJ@IP (0/ *@ `YJK'Ѝ8bp*`@̄㸴@P  @Q @0`3/P 0@[PJ P   0@`P t *@P KP  *@*@& KP! *@*@QPP ` ` Rp RP~JPyJ # 00 @/P P@o    *@*@& 4KP! *@P *@QP ` ` Rp Rj *@P X P*@ 0= *@PP  *@Q (@P P@@Q:P P   @P3 @*@P @pJ @03/0 *@P@ 0 *@P *@PH X *@P @ 9 7  0\t`" *@P *@P X *@P @ 2 .X *@   0 @39" @-0 *@S 0@PP (@p  *@G-AMp8*@@/ P P`PP 00*@p )@ሾ/P *  @0p-PP/P PW*  @0-AލO-MPj @*`@PPeJUUZH0/P]J 0/PXJ *@P "PPJ Y p#PIJ ㈪ *@*@Z *P@  *@@ X *@;P4 (0/P`!P&J *@J *@@P X *@ @9@P *@ ,H@  0@@,Ѝ8R㸄*P@P  0pNP P P !PJY #PZO-MP p*@ Z P2J `P/J,0/P*J0p *@P Y"PJ8b*`@ P W 40/ *@ `G$ *@P $ `ЍJ P*@@3P[PJPT PP o!PJK_ Z x PJ P a.  Gp )Pap@/P LP   T *@P  p  @Pv* 0 @v, _ P ~ @*@PP X P*@ 0X *@*@1/pkP *@P *@P4 X *@P @ & " D03/ p~ *@P *@P X *@P @   . *@ ^  $ *@WJ P P J P PJ pP 8B *@@8  8 *@1 H- *@P N P JP JP *@H0/PJHO-MMz `*p@, J P  @`M+Ѝۍ@ /PPU/P /P@Gp&   P+<`PJg PJ#PJp *@P PJ8b*`@i P  *@ `SFE#9 h* 0 @`h+@ @ℚ d@P  p@*@ᰬP* *@  /PPb  @*GPA  PJPJ M P  pڬ  *@*@ kGPb *@P X *@  *@'x * @*@Q  *@QP.P4` 4P(T@Q:P PF Ep 6uppڰ pp _oX,` R p Rv *@P *@Q4P:` :* 0 @*hp *@P_ *@PZ X *@P @   㐡 *@E` RV p R4L |,  0H-I  *@@Y *@*P@ RP *@ ~ R> @~< o @<)0`  (@*@ t )@ p,PJ  *@,9 *0@  () * @0@-) (@* @  I *@*@@Q R ~ Rڠ @~<  @<)t )@pPJ 0 *@0 *@() * @,) * @` ~(@)  *@* @  *@/O-MP\ *@P  @S)@Ѝ  *@`} *@`(p@R@PJ( , *@*@pA`? X P0P0 RpPPCJ9 PU*0@ U`p(@Q P. P:`(@ @}PJ`(@  0) * @ Р*@000ZMPSS(@S@SU- @(G-dm@(`@PE (@P_ @(;0y p*p@1P3J` (@*@Pʔ P@ RUPpP(PJPPPjP ,i *`@ ( 0*@@ ,9  *0@@BM-M@ @@L ,y ( *p@*@ @00C`So``V``  /PP`5  *@ ? U P'J0) * @РPU`U @APPJ  0P000S00PU `u @Ѝ@K-8 *@Q `mY (`@*P@P0 ,i *@p *`@p(i *`@0pp P 0I *@*@@pPJP mpppP\ *@0H-,I  *@*@@P0( *@PEW` P(@0HO-M@@ *@ `*@(@ P  P @'.pd *@() pQ* @a`T` *@`pPU U- PCJ p*@() W* @?TP`D) * @pV2(  *@9,) * @`V!) * @@D` %P ,) *@* @Q BQ \ *@Ѝ, *@pO-M`Q!, ( *@*@p`P(@@HT]PJp@T@ pPE`UpЍO-MQ, ( *@*@`P@pKWpP`Wp `@DPT`pЍHPpO-MPP$, ( *@*@`@pKW` (@PJ`pWPpLPU`Ou`ЍO-OM`PpF w 2F*@P |Cp~ 0 @'X,y (I *p@`m*@@(`@ @RP-J R APXx KCpH L0"#  @k&p  @c&- 0 @&~ 0 @&OߍO-M@`pQD J CP . 0 @&ꘐYZPPP崐1, P*@`( *@ @RP) 0 R P* * @ R  0` BRPZz``W J R PnX `` `*@P 8P  @ @%ЍO-]MPpp4 50pE,8 @s 2E*@㌄`P 8vBp ~ 0 @%`4`D`EfBP .  @0%P[ө (I $` *@@(@  `Pl@P&`P0$ R( ,[? 4u4 P` (@ @`P Pp .@)(Bpx |0" P#`$  @ @ P 0%%`~ .  @0~%` P s j.  @ P0Pq%`@0$Q(, p!R P4p`]ߍG-`@P   /R HI p*@@PY!  @$QQ  G3@pQRP+ L *@QAP/  @0坚Cpp3ʴ ㎏ *@@ pP$( *PJ 0⃚)pp w/  @0$X *@0/  @$PPWPpS O-M@//Q/<P@ p` P`/AP/,pP+\p6 *@P   @pAP G 09/pP  @Q  PЍ/p@-Q$J@`P?py UP/  @0x$Pp@pj / 0 @k$KWL *@pG-MQjJ`P@T@e?pL /  @0M$ *@P $( QP *@Q P  pQX T *@t*@P??pI(@(@ P`p pHP 7?p /  @0#F@VL *@ЍH-`p@f@PP %?P X *@ M!  @0#P@-@?PX *@ k!  @0@#H-M@`Q0 `3aQ(`@(P@PP* @P !  @0# Q 8 =b0A0R``pBQ H =b0A@R B5?P t NPP >ph "!  @0i#Ѝ/H-M@(* R $ PRP ` V  P ?p   P @ " 0ЍA-MpP@?P e>P-   `6P X#T"  @0@#t *@Q "#!"#% @ "Ѝ  P "@P >p0?pX C"  @0Q/ 0 0H-M@P ?QJt *@Q   `' &0 0`' &# @ @"ЍO-MMP(P!08@P#`E($pEE ,( $p@P}~~~~ *@H @-P  *@P C>P8  P Y% L#J=p; C>P8p P p,j,j =(`=n=P% . T T lP Ze *@P 5pl@ R $ @0" *@P  P/  @ 0!8J *@@Q P l< P;Q$l匁㈑(@P(@D *@ @P< >p0PP,P. ( @{ @ a!@5C>pl? 8Q?"0P8  $0 @!0 .@ l@ @ o`@ $Ѝۍp@-M` @=PPJt *@P PЍp  P"@)P =pVP P P@ =pX *@>_ P@P  0R!PO- MPRa 0PpP4W@@@P `T V RQP z z8 4 *@*@0 , *@*@P 'R  hP (ZJ?  qP!N`P  `0PpWPE @} !  @!  @80 Ѝp@-MPR ` 0@Q JP *@ ;p ʦQ P@Q P@ 0 PЍp0H-M@PJP; *@P `$P  @0 Ѝ0O-M Mq` V k# o;PPp@@ PP  ^;P`8`9@Pp*$ <p`HL  # ` 0` q8P  @6~ 0 @  @* " 0 @+ `Ѝ ۍ@- * *@* @ Q\ R* *@* @ R@` *@P $Md P*@ @P J *@P P@Cn @@O-M|I *@@P x *@` pH d ~\ p *@(@@*@(p@\*@*@Q P Q5`P|p PV P` qP V  `| P*@ `Ѝp@-P@P @$p `LP P@P/Q` *@ f0@S  l *@ PPp @l) P* @Ppp *@Q  | *@Qt  *@  *@Ql *@Q P/x *@Q |  *@/H- *@P ` *@pWp B k(@P@@`@Q P ᖕpWO-M-HM@t *@| *@Q PPJPP P( p0x PbS  `*@$0 P@,4MP @ P,ȌȌ$  -PUZV  @TN4 ϊX   @ QD0 +,9pNʗ  0v#  @$*#  @0' *@P" X` P8@0 Pp8 <0 @DP"P $F#  @gPX  P8甎@@@@@@4& , #0 *@P  `Р  C $ 0 0 , ,(@  *@ @PPp *@HЍЍK-hMP *@@P1 (``pT}a QpqP!@0Wp   @  V<PH @ 6P$0  @DhЍK  @;0 "@5<@Q* @PI @$ VhЍA-8MP@0400 ށ0!4 @p`usP 4 $ 0@ @ @0 P8Ѝp@-XM@` P0`8`\0D @ 8XЍpp@-MP@PP Q `P0 %QЍpЍp@%H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|*:H-A0\ Q: W \03#€A#2\ Q :A1^0Q:0AQ*H/@-Q0E\ 000SQR% PH* 00@C TB"/ A@CTB"@ a@CT1B"`   \& P"* 0@0T00C!\@? S 0! S@" P$: H-00C\ S: W \03!€C!\ S :C^S:0CS*@- @*@Q@@ @H-P *@@p/p@`Q` i *`@` S! Hd`U?`-V, *@``````V nP:Vp  (@ @H*gy `*p@`:Px (@Q ! x `(@`p (@- @0d?`/p@-i *`@PpP  *@@ nP p V (@@P@0 AP *@H @tPQYO-dM/Vz P*p@Hd `@N$ |Z P*@*P@ T *@`w n Pp@(`@@  0B0@JQPLLd(LLLLLLLLLL LLLLdLLLL4@LLLLМLLLLLLLLHLLPL@4ܛLț|XНLx[P(LLlLLLLLLȟ؟LLLL|/@<(@pPc}| *@x(@P" @(@pPHbt *@]/@ P*@7ڀQx ))@"@K @x)@Ed(@@ *@;/@(@pP!( @* *@%(@6 *@T *@(@'@KP  /@0 *@ *@p *@(@(@(@(@t)@  *@/ @9 *0@  *@x  )@ @/@pʬ(@P*/@-QQK t)@ 4 *@P *@(@ *@(@x  )@@ *@(@P *@P/@P hl *@P$ *@} *@Py(@u4 *@ *@lt)@ e(@pC 0 p x 0#(@ X: X (@ *0@  R Q[q q8 R*@h(@L  ! *@P* * @Pv -q @`v p@@>  (0@a /PT0BJPl0000000000000000h00000 88h000P|Х0@000000@80p00pXx(0 0XH 0P (@ BP 笢ܢ00 *@RFx/@)@(@x  )@ @| *@ivx *@`ph *@`jx  )@@dp *@ `^: /@z AQ*0@*p@(@@(P@ lRmR oR pROaR eR!( @h,/@X p1c$t/@)@`k *@i/@@) * @ p*,g *@f`h/@(@  @ L0hP P*@ $ h*@ *@g/@p @KfP 4dv (@pp@ *@b *@a/@ pe *@dl *@`x ))@"@$)@/@) pb *@e/@  `*@P *@c *@@|lxl/@Opq{ *@aj/@pojbt *@@`\ *@jVR[k P@d(@v p@IrRB  P Pp X (@*@X.0(@0'L Q P *@h ㈉ `@*@p[ PK@T*@ @T y @P" P|P P ) * @p *@ p pGp@Tv pp*@k p@PPP @  @#@P4 PP PA  8P XJYW U p @ PWU ;J=p 6JPP p  pʝWU Jk @p P(@ ᥺8 p*@ PQ   @Pj *@e (@'D" @ @Q Q-(@0 H0-(@0 HB 0(@O". @0  #Qh P (@*@LP$:@Q:P7x (@ PJ *@ 7p7xb (`@ P7pd(@xb (`@ P pd @HO @B N /@@ n @6 /@@& @,z /@@ "p (@@ @S "P@L  !@N /@@  @Ɖ2 @| @ 3 @p[ KPY P% pP!ʔ@Tw y @PYm p@P @PPZ pptPk @P  @㣌PPfpX (P@P. h x @`@p@ P  㥦P XpC@P y@T5EPZ/k @P > pP}  @$P .pqd(@ tM)@@PPP  @PP @dЍ>| @ :7K-a@"`@ P=pp a/"`@W  P(p pm%  @0n *@P  /H-p (@ @@-p (@@  @0y @ 0P @ 0J @ 0ᡈA-M `P Pp0 WA L: RI 0lS bS kS(k5xP;mS wS(o1xP.`k4xP# (f:xP  0S xS *SP(P6 0R!0 PЍG-PQZ @n败P) 0 I *@*@@PP" ,`P=P p AP 0 S00PVn @ @n @3vGKG-P p *@(@ @ @U җ ㋮@!@p5 oo VUP@ڰ  G肋p@-MP)P P@P PPPpAP PE`  8 *@`P8 *@`ЍpK-MP@P @e`p\Q QY QppQ&?Q) [QS.QK  !R`!Bo  @`P? ]P# p-W pW]W Wpp#P @P *QSSP Q! QP R`*P P P  0P QP P l *@Q /PPG-MM@(@PP `p.W.P{  @;EPyW Q@@QP.QP.QP/Pf < *@P U` PP^ P P2 P ` PLp *@P| *@ @oG @w @ @PP0J G w n p!@@@`@ ÿP R P! @ @E  PZ P/P @ JPЍۍ.P P @pP P @g` p,WZP @U P 2. ,:T *@pW7 P/P`P  @p.W  @PpW P /PP ` P  Z @ P.WP @P~O-MM@< &p*@`P,X  @'@P(P`'` [h 0XXPa V3Q V* V3W V1: Vs P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  aSQ \R\&R Z:Jp '@` V Bp, P ZX  _ @& Ѝۍ V*' Q pP P   y '0@ V ` P' P  ',' P p (@ '0@ ἆp  (@@ ᴆp@-@P` 0PJQp  0pp0H-P@P/TN@N TE @ 0@ U:UNAQ:0Q0N0A-@MP@z~p X (@*@10E,P<8400l+09,P<8400`+0-,P<8400T+0!,P<8400H+. @* * @@0  *@0 0 b @ @,0\z p*p@P  uPJ opP  fPJ `pP  WPJ QpP  HPsJ BpP  9PdJ 1P\J +pVڳPYJ(@P "@3*p(@SP(@P p@ @[P@PH@@PP PE/Q .<`` *@V`'  U hd* @* @/@()@dp@@Px3"6  @@Ѝ @~/  @ x )@P  qP @@-@ *@ *@TV { @@NL *@P *| *@P nH-< *@P 0/C%=Q5aQ^ PU  *@P  /C#=1#aQI 0S  *@ R> `0p PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V RA-P@`PVz *p@P=>P8 #V \V `#P` DP`j:P P/C!=Qh:paV Q P;P `P@ @ ~  @ @v A-P@`PVz *p@P=o>P8 #V \V `#P` MDP`X8P P/C!=Qhp8paV Q P:P `P@@ @ , h @  @$ H-P`@V @/$pW PP`VpP0 F R :,VU .V,P (PA`Vt:P W`P @p bRCR MR mR cR5p @ TR(c p `Q G JpUP *@ R  *@ ``* `* @` @0 ! @ !p RJ @ 0 ? . @ | ?m @v H-0@PS$  p(@ .SmWpj0Sp`W =Qp!@p`p*@ QH T8PP!@k@d TO P!@P@P!@ P!@!@\qp0H-[ @*P@P  <P @ @0O-M *@Y: 0@P4 \1: РPq vM㐡`aV p !  !  pP` @*9P, `P$  @ `Ѝ ,  AP Q >>> @y H- *@Q 0$0 R: RC qN vAMDI%bAT0 $ P "P%  `$p% "  @T>H>K- *@P y`AT Ps>q>U@`V 0H-[ @*P@P)G $<P p d *@"@ `Z O`*P@A@p(@ '  @ U# 0 @V @0O-MMK *@@Ql p PG% t嘱(@AT `P  ! 8 tP7 ֛P8 @T 78P ` 0QJ iP- 0*@p` a0P  @ #C @@<#  @T#  @  `@ 0T lC @@ =Ѝۍ@-M @Q0@@B!S !Q 0@Q@?0 !`#!K0" ?^   @@@T: 0 cЍ0H-[ @*P@P <;P @* @0A-K `*@@P$ "@PqW 2P p 7P+ pRP# `LP qP @P `PP 1=3P . @'=%=I @ PH-{ `*p@P@P"_qW P p 0H- [ @*P@P =:Pp @ @0H-   PM-` *@@pW# /PC!=ahP Р+0* R 6P ` P@ @o O-M  *@PU 0/>3C=a 3@0'sfp$0 "Q  U `p'`&p PS0 R^ @ PN PXZ 6PE  p  p P "B @ K + *@@* @ 0%=R />3C3&3ᓌc1S ` p'`&` 0 0   "  PP@  @  @Ѝ 0@ P6P 0 pp ``  0H-[ @*P@P =9P @@0G-M *@P P=p aV  0 $@ P4(` Z ЍO-M *@`V8 @L@P@/8C<!=㐱hP ! # " # " (0@ 5P p ᧙P ( qP @$Ѝ;G @ЍOBG- *@^ /NCCD%C=Q%dAT $ `Ёp)P(PPЀP) p(P (PU@  (00 W;U;/G-Mp *@PP/P`  `P' (t5P p:P  @*@0 @ `P Ip0 @  @ ;{ @ ۍO-M[ *P@@T, ㌑㈡a*@(@(@p(`@P$P ;  p p@P ::@TЍ  *@ Q/H- *@0S ^Q $; *0@0SQ@- Q @P F @ pP (@(@q  @J @ 0H-M@P V `00?(P2*2*`` 00 Q*  ;00?( P2*2*`` 00PR PT @Ѝ0O-MP4 V ,h 】( @P@`@(@*@p @PP P@P# @ 0Q & ,8 @ @0@ @ 0ЍO- M@PS`PJp/( KAQ:,+ 0; * @*0@P 4+ 8; * @*0@w d  l , t 0 |  p[ Pp$``  4P  KJQ1Q 2Q ,  KQ LQ ` /R5Q (,,(  `  ` b$   l b `/Q``@ Ѝp@-@ Q P `W9peRe #p@O-EMP`@Q P`peQ / @( @*@Q@P@dTM  @ pS d @Q:P P/ @ @ @ @ @12 d 0 |0  ` *@@@!| @idPЀQ :1qpA~1QSpPQ: A0 cA ,\qlp Q :1QPA^1qSPpQ: A0 kAh 0\ytp Q :1QPA^1qSPpQ: A0 sAMIpJ: P Q :1ᒁA䅎1QSPQ: A0 A0s `  ?(P2*2*`` 0P eQPp pQ :1QPA^1qSPpQ: A0 Av0  @@Eߍ Ѐ |pQ :1qpA~1ᩑSpQ: A0 {AN  k @h'@PJPJP P@ //0H- Q @P PF  @ᶕP 0 @ 㭕P$ *@P< *@Q @ 0H@O-MP@PJ㐄`(  lY!R ,Z`/  KAQ:,+ 0; A* @*0@@5 4+ 8; * @*0@) d _ |  p P`p$p`  HJn)Hpt 9p ,` (spl (Pm GJP1 @R 0 H\d (  aK@Q:gPxP  ( xP"@ @ 4 @     $ *@QD KP  bC   1 ,  I PQ p @ /O! (  B  /R    / # KP@" @  @ Ѝ O-MP@Q :P P$ @*@P  @! dP$ *@P  F`dQ0$ *@P&Q$d@ApQ /Q @ @TT }T Y `/ P%  }d 0@ Sa`23 75ptp TT1p  @ 4 Hp `q `OIVDQ :1A@AN1qS@pQ:./O B0 PW&FQ@p hqQ :1A@AN1qS@pQ:./O B0 1 0 *) @ @0|` f$  QS:1a`An1qSH6pp0  |0 PK d {@ *@@`| @Q :1a`An1AS`@Q: A0 {A-  2) 0@ @@ p*@` pfL|Q :1a`An1qS`pQ: A0 {A ; @@=rutF`$ *@P  0Ljd` {`Q :1A@AN1aS@`Q: A0 cA  -0@! @i,lrl@ @pQ :1qpA~1ASp@Q: A0 kAi  F+0@" @H0Lztp pQ :1A@AN1qS@pQ: A0 sAI  Y) 0@ @( *@!@Aq:P@ @Q :1QPA^1ASP@Q: A0 A  ]) 0@ @@ߍ P0 }j !`@UP D)X` Dj  `  ?(P2*2*`` 0+  ?(}P2*2*``P P 0@Q :1A@AN1QS@PQ: A0 A  c) 0@ @}@PJ CPJD[ *P@P @k *`@ P J @ +PJP P@xA-MMM `P@^P"@, U U D *@ @D *@@ *@ mMލڍ @ ፋ0H-@P Pj @ 0HH-MM A0 S0Q / ( @@ 0P `.p*V ?V.`pp\pp0` Q0/P @#* 0 @ sv@P$JP.* 0 @ fvPJ@<* 0 @ ZvP J@D* 0 @ NvO@ЍڍK-M-PP  @YwPP ; 0@ TpX (P@㓉 p`@vP @ Q 0?k`P @p @(@U Ѝ0H-O @PJ @@H[ P*P@  @L *@Q0p *@P X O* @ @00Mp@-MP@\ *@pX   *@*@(P@ 0j *`@P  8 P*@ @v w 8Ѝp@Ѝ/ M@-MHK *@@  P0  wЍ@ Ѝ/p@-@QPL *@ R `A8P @ @aP@@pMH-MP@\ *@ph   *@*@P(`@0z *p@P X [8 `*@ @Vv  Pp *@]@Q  /Q@ pPP/Q /nPp.PP .PP PpW @6ppQpWPp *@rl [*@wp *@PU m p@ `@@、h P*@ Q PF \ *@P hPI d?PE `PA !@>T;Q 49 D62 QX+ * @ R' \+ * @ R Q  P   P  P T *@PPzd *@Pt 6PU~\; *0@P0hk *`@ `Xp :P @T@rp[ P*P@PSꜘp!@` @@ Q h4x\ *@Pn X Ph ``\ *@Q X PU P Pf P 5\ $*@QPF p8 & < OP\ *@Q. P,/\ *@P$P' P?P$ X $ a8p[ *P@o5T *@PP P\ *@QP  HS`۽pPvhd *@Pt *@P t *@ rHP D?P @P "@ᒇB80 @ H- p (@9 @spt *@/A- M@` *@Pp  (@@ spH (@@P@'P&l `*@P5 P P0 7P+ P' x@T *@P! @4`p (@㜠P P@፠p P Y@ob Ѝ`՜p G< !@"0@ V 0p (@ @p.sO-OMM`@Q  p  P#@ p PP Ѐ # "!Ѐ # "  PpP 0<w pЀX` XzPp X 0PX#UP 0 ZЀX` XzPp X PX*P 04ЀX` XzPp X PzXPr 0j W WjX`  PS  ʩpWPJWPB 0:РZ`ܲV`: Z `Pj PZzppp`P p p*@p!@jQ p p*@p!@^QOߍٍG-P@j!@6s"p@` FpP px (@P2P+ P!@pp/P PQ P p/QQ P nH- p (@` @qnG-P2Pr  pRL J*@GB<`'pd < <x *@ aRP *@P G H-@Q  0Sxk J*`@P@' `qW P `pP R 0S JA' `x *@/p@-P@U  QLl *`@s-q-o-PP *@P PpH-L\ x{ *P@@`*p@Q `'VPP *@P HH-@PQ  0S`J@' `x *@qW P pT `@-@P@K-Ll *`@K@;;x P*@ 1S ppW1 0'PR0PP *@P 8$?0@ _T ds@(p@ ``bdQ A >_`@T K7;~ @7p@-xk P*`@@Q  R @RP'UpO-MC, p* @00SqQ Q, Qp&]Qa 0AS@#$p&p&p&%%p&(%4%@%L%h%t%p&%p&p&p&p&p&p&p&p&p&p&%p&%%%%00 @G (, p* @   G 000 0@F0 G@*@@9(\ *P@ 1p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     @H-M@P9l *`@PLP  IRNP  pP  pE *@@ *@@@$ *@PP9Ѝ$ @ 0H-@Z$\ *P@ )RR0H- *@ @dA-P'@2 $("(@( @4e p *`@ P Q @Q A ,:T@Q@ A T Q:PJ!@@ Q:@8@ *@o@!@ 0P^oK-0M@( *@pЀ(,``TV F P :(( 0#@P0ЍI@PWV  F008@P`/ @0l n_G-@P$ *@ %Rpo`&P`( *@W@ 0W @ @E@-@Qx@ 8+H+`+p++*++++,, ,,,*8, Z # qY PM 0z^R R ^" #o ? `2 0PQS? @PS2 `QSQ!!R .," # 0, @ @ @p@-M0 Y *@*P@`{`@0(@`P T0 TPC"@@ z@PPP P R #@    RЍp @"@|A-@pP$ *@`P,( *@@$ 0A-MP@+$ `*@p BP0P `pR( *@`o`P 0ЍK-(MP`@p!PW&WI We W( *@ 0p'GP:$WB "W$L *@@#PtW> W|UH ЀJVn$ U*@K(l '@W*`@@P'WP/@ @YkM( *@ 0o᠂@( *@{ 03Ѐ( *@l 0(ЍK'FP]$ U*@ Ѐ$ *@`'V'VP/ @ k ] (Ѝ\ @{N @ww @sO-M8$ `P`p*@#@#@( *@   01@ DR0 0SR* @Z 0pD`PP PЍG-M0L (@@@>peP P< *@PU' `V/ 4 *@pW /(P @p36` Ds D)8t8PA!@^PP @[-PPJ @"@@P@.P.PP/P3#@ P# p` P36!PJ  P Y Q Dp  `P+ @Ѝ$ @{^P8 4 *@*@PPP @ @p@-4l @*`@Pp@ *@Q = @PQP 5pp@A-LL P*@@pOp +`PP *@P W 0(@6QP 4 V*@P @)[@ P@P *@P zO-MPH4| U*p@Q)8L *@@P 'L\ *P@PP *@P SP : @ \= @ [@%5< *@ 7(4e (@$*`@(@@/Q PQ PP@16@UP U/P@DpWI Y㤠!P@"@ PQ /Q @P P,  {P' P@5@/P P@5@Y$(@T1T   t/R@pW$(@T 4| *p@= @@_;4| *p@P@5@/P5@8\ LL *@@*P@P G&$(@m4 : @I[= @ D[P@P *@P Ѝ< *@P/ 0RS /S  00B /0H-M@P P/P"@tp op  0"# 0"#oBލ00H-EL!@@Pm<pP< *@P6LU_84\ *P@P0P) dC(@@X! !XQ A 3X oX0-v @&A @"U @p@-@ \3`P 4"P P3`34 *@p@3Tps- @H-4 *@Q =  @HxZ @HG-ds(p@P`!V  @.P  @'Po`Vl P @T7 \T0@a DR0>?\@ ER:UU ~, @* @_0 @ H-`@P pW pV #VB&D *@ *@,O-MX+ pR%pPPP :PW [(B(@@`Q&P$b(`@U@  Z/P/Ѝ ', * @WQ:Q:Q "@ЍO%O-M;P P@p`@-b@Q'4v,vu0 0Q P Ѝ0P *@P Ѝ0H`H-.P QRqO-MP P@`p@y)oPP VP`ppP vP@cP  /o0"  1 *cP) 0@! @ @I @EH- $(@HA-P(- * @00,- p* @p8- * @0H- * @0) * @0"( @(f (@$r4E R0m P(p@*@@*`@00yX PP@ C @@ALm p*`@` 5L p*@ @p` W ppQp&L *@ Q  @-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  @ l#*@( @  $0M (@*@@P`~P  Sp F  4   *@ `P<UځE P%Hdt0T,} *p@ p U :U U *@=UPutP pP Pp $(@ AApPPp PP~ tp^pP p@Pp=P ( *@pP} P|{( *@P1$ (@@Q)pQ&uP^ PUTP('PpPN p~PJ=U PpP @Yp ;p P5 P<;w p( P gp P!iPP]p UP *@P p*@Dp<p Y P`pЍO- MH *@@Pz @ lc*@(`@8} *p@@` P_P @Q::P @P- T0@ PT5  U5*@T T` `@P' "@ ㇹP P `PP PPU:"@ r@ UT PP ` U: PpW pW|Q P m  ЍG-PN L] Ll T P @*P@*`@*@*@ >RR4 *R[R?R pP ᭶ P "Y PP MP P  R? Pp@@T0H-P0L] @*P@@@Q@0H-8M *@@P L\ Pl *P@*`@ppP P PH *@O-M P-$0m (@*`@A4E 02p☠*@@(0@P[ 9[ ځKQ:[ Q W [ [ /[ Q A 02(0@EQ ЍQQ P YA!@EP9 EP p#@Z y P p P*p P PP~Py/PU/PO-,M (P #@o = n@    P*  |P2 p `(  ( *@/ `Dp$0= (@*0@P0RC$ V< YH0 ( 0 *@ D( P `p Q( @P( *@$0 (@*@02(0@0AS p*P@P p R Tp$Pe R$Q P PQW0 V*@C4 *@P( `FV00`/PQd0 U*@  `p P 4 *@P( 4 *@P( PPU`F R $4 (@*@0PA `倐@ c! !@PH *@P ` `@BQ;*$Po  0  _ l0 U*@ f `#@u P 4 *@PD( 4 *@P6( PPU?BQ0 $pP 4 *@P0= *0@$p!Wp( P @0 *@( V*4( 0= *0@p$(@0PA0 0pP0} $"*p@4e ( @*`@ 00 @ p$0 (@*@ A ( R , *@ 0S S@`VW   S S00SP,Ѝ  @ DR *@1 @P #P   *@ B 0L @ @ *@  o 0@O-M,2`8 (0@*@ `$r L, 0 *@* @P(p@ @H , *@*@ @uE , `H *@(@, *@p[4 EL 8 *@4`*@ @ *@@P@ʴPqJPP *@P  pʻP UPS p@X X@[P P[ A E@QPE P@P@DTPPP #@ P p P *p P@@PJpP ? P  *@P$ (@Eo0 *@PPP *@P vЍO-$M0 $*@(@4 *@ PHPi@a`@A1 *@`p4 *@ AQd/ @> @@ 0@S "R  @ $ЍH-H} `*p@@PP Q Q 8 *@`P @PK-H] *P@PJ 8 *@ P#8m *`@P L| P *p@*@@ @P P P P`P  QLl P| *`@*p@@^ Q@P P PG-Pq Q:PP UᔙPE`#@ p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F :`P@V -PO- M,(@, pR*@`4E 0] *@@*P@P 9V$(@p p  >@p ЍVP02  #@0@0 @'-<(@@ y=O-M, ,*@(@PpB`W*(Qp4E *@@P 0 *@0- * @W$(@`P P @,̭(, Yp `P^V`ZpW:!pEW: `PGZ`@P wQ  0S Q:ppW*apEW]: ^P<GZP wQ  0S Q:pp`ET@* AP Z Q@0- E4U `* @D*P@0`CW P@0] 4e *P@*`@D@p6@@ЍKO-:P:Q @ PPP3[Pq -Q PU ]U \UPY[44@ $ `81PJ $ 84P1P]P9 R RX #@ X* RX 9#0@00 0Q 4X* @P  @Q: p  [`N[ `?<Ѝp@-M`P@P*PH @*@P< U9 P5P2!P(@@P@)0@@ P%Y@@ j*`QP=PPV H *@V @D *@U PP @ЍpO-M`P RP@,P! @ R00 *@hL ,LLLLL8(@@P+ ?P -P#@@TQ04u 0 #P@(@*p@*@aP P :  P@TH *@T@ l*@H5  *0@(@`TA0p  0S0P o/oG4U 0 "#@@*P@*@だ  X) PR  P PP      P( W P :P PP      P< [ P PP QP PPPv v *@0M *@@-Ѝ0@ P *)`P=PPV VH *@V@H *@Q(  *@ @嘀``P 4u 0] 㐧*p@*P@ぐ#@PX X)  P PP       PBPQ P PP      PPPPN PP|?D *@PT1P5 4E 0m *@@*`@pU P :P PpP   |   PP G4U 0m #@@*P@*`@p P PZpP   I   Pp@- M P0 Pg0`BfF TDaOa`C 00``BS:UP0p4U -*P@ @P @ T@P ЍpO-M@P ZRDڈ0BSP:RD [RF 0^S!S 0pCW,:[S ]SD S# 0:S:0ps`\V:V  ]R V 0S /SpV /V]V  00S/S  ps :R *R?R R /RP PR/R Pb [ P AR*Q@ Q:Tm *`@T T/Qb D"@;P> T/DZ`PFQ*VP `*@P"RP p .P.V  7P Z Q/@E&T *@-XZ/EЍT]  *P@0pCW:S000S P CPJ "@P R0H-@[PL P*@ 0H-MQ)P`p pAQE@`Ppepp`@TP@`PpPЍH-MPpH *@ 00m $R(P@, ("@*`@( @*@@4E 0 *@@ CPA @ЍG-@@ !@27d(@Q A ʩ5pY p`PIpɪpPU| @7Q A ʎ5pY p`_5Q A |5`@T pH- @uH- @p@-M *@@PpP *@ @O-MR} (P@*p@ Q rPP *@ crP~ ((@q5<(@n5m 㘭 *`@*@ Q / P# 0P S S\  A  0@0S0P0@Q*R ,pBʐP P:#P6 Q/ P)JI @4 /kPJP0(@P 4h(@4PЍb @A-L (@*@p @`V PP P P P(@  *@ *@ *@0 $T PP *@P AF *@Q/"( @ 0S  R0cqo// - *@* @0C/K-B(@@L| *p@` R  $- * @ 0- *@* @@VPP@ 0`  PP *@P KH-ML| @*p@Pp5`P  P 0] PLDP+ 0J -P $PP *@P Ѝ @x @r @k @p@-Ll @*`@Pd @- MU/R(P@P-@P 5 *@  *@ (@ QpP *@P p@Vp"( @ R/0S0H-R (P@*@0 - B*@* @(@@ @ 8 @    $0p@-Ll P*`@Q@ *@Pl *@ *@ (@@QpP *@P p@ pp@-RLl (P@*`@@PJ,P s PP *@ 00 `*@`  *@ (@ pP *@P p@p(@/p@-R@(P@QQ Xm *`@Q QQPp2 @0H-BX] (@@*P@P00H-P 0BX] (@@*P@P P0(,0H-a @*`@P4 *@PTB r(p@p ,O @>pW + @+P *@uPW{U B]///l0S *P@P pW p(  @ lRQ *P@P p4 R(P@p# +///@P P <pPUf @.20(@N̴ @ ,ô @ #꺴 @ "( @0S/H- !@< *@HH- *@QG @PE !@q3P T `pP@f3`pVdS(P@Q A 1 2(@"p L\ *P@_@PP *@P  @ @K) @.@- @!@@O-M !@ *@PK P 5 *@rDD(@Q + /P Q pTPTP RQ /PQ Q׫P PP *@P 'p @%F00"( @N RQ Q  P |@-A *@@Q *@Q *@Q! * @ 0S 0RS Q q @)A-MPP0 @ *@P* R0V`!P@ @,LX d 0@LX  @P !@ "@7 PpW U P@P pWPVP m @P!@P  !@[ @ @ @{P !@ @p Q P !@ @ bP !@ @ @TP !@ @ i @  !@3 @P:P !@yI"@vg @ro !@l`V Pu U !@p@P@^  PV`V @@  @=K @86U P@D\!P@ U P@U P@U P@U P@0S `*! @)'%P  0s @*! @n) Pk @PЍ @ @ЍAO-M *@*@ Q@H} #@@"p@` P<UځE Z 0 @$P 04P #U $U'U =UO \U U:F"UYP\P3`  P @@ 000C S: P @@IP@P `}P` @ 0 @ S )P!@ " "P0QPC[P@0U@Q V 0PQ P0SP U  "`=P:P `Q"AЍp@-Ppl@P"`@T PA>PUpO-Mȱ @P*@ P T h *@*@ 0 S|( p`P(@#@ Pp pPe QP/QiP@ PJС *@!0RITG *@Q PPP:PU P Pڠ *@$ (@p᚝Hv p@4 *@Pʓpᱛ-" @ a@@Pt&hs(p@Q A o& XЍjO- %^ P P ^Q! * @AoST 1Y^PsP6P.P  @$P P Ѝ0H-L\ @*P@!PJPP *@P P0HC @q0H-@P7P0U'##H-P @ZH-P @R@-@tP @ @DK-((@L\ `$p*P@W(@~W`~oP& ` "( @0@Q0@P *@P `@FPP *@P  @H-P$((@(@ 0B @ fH- $(@(@45 ("8 *0@*@( @0 @0@-LL 85 *@@ *0@ PP *@P @p@-L\ b*P@ (`@@ P 4$(@((@4 *@0PpP *@P p@qpO-ML $((@(@*@ bp(`@Pk@8 *@U+ Z(1P9 8 4 *@*@p Q 0D@ P0pp SDp@ p   PPPP ЍP *@P ЍO @;@-L ($(@*@0 (@@  C RP *@P @0H-,(R(@(P@@P J T $R (P@($4% * @D0k$"( @4 *@0H-4E (b*@@(`@PpX$ G(@AH-$((@(@0 0C@4  *@ MK-$MDpDQ p P @` UP`Qp`X`v$*r@@  PU `Tq@ɗp[ ` PU$ЍK Ѝ/ @O-,M V du *@` P@*p@@oPP dPpP rP`@< *@P9 ,PPp Tp Q"o#pY @&@d($(@(@ 4 *@+T"@V`P@p\A+po `\W P# \VW W P- "@ 㩙PPPT9 P4 Z` 4 *@Ppq+ P+pPPwJ PPa~!]W[ 4% Z* @P@$p(@@KHPTN `P Y @-4u P*p@ $BQ(@@ N$4% `* @P@ʗp@$BQ(@@AʉK[((@@`+ P#+pP\ @vP4E *@@P` @$(@ pQ@ gP `K"@  PZ $(@pP@V MPQ Y @#$(@p @ #P `A#@@ #PW,Ѝ @+H-MK "@@`*PL| *p@<@:PP *@P < *@PU%  (@$*`P V*@qPP *@P Vp  + @S"R 0p`0VZ`0@ P0p!VW]> r  w  @ x   rw x  rw  x  0  @!dC(@@   @o Ѝ1 @s  p @jP @eO-MW fP@@bRPP HPSP aP(a#`@pT  pP @:< *@[ ZP  @,Y@P5 @}YP @0B P 0@L PS *0@B!PH0 @ R 0:Q@MPP0 6P:H%Z< ӷ or @"p@@  @T!@@ P % C!Q@ 0@ 0P5!Z  0!Z P5pD [ @P@ Pp?P ݃( *@@P@ P%M @ 0 !@0 dC(@@ X @dЍ @h @`4 @X @SR0 B0S// R/0R/@-M@0@ P 㘚 RR @( R!Ѝ @0A Q/Q/p@-@P P1P `&"@ ׈@P !@ ψP Vj@QP 0@ P*p2PpA- XJJXH@L *@h @0   0pP!U:P @A  0 0S QB 1 Q PP *@P F @5 @ @ @@-` *@0SQ< *@ @T9 -Q60Q2 -Q@T+ P 'P% R@ R! @ :R  @ R :R R< *@ 00P d% * @ @ @P 05!@-LL *@@9< *@QPP *@P [@-0A Q  @) PH *@ @H-MPH P*@0 \ 0 0Ѝ\ @XO- M0PQ`V R 0S -QpW  `-V0-`S @T 0 B@p@@1?`Qpf R 0 :R  0 Rp:P R W @!@ U@:T  @ `HQ8 p @ @; @@1< (@@ < @!?`@0@p*@ @! @ Y @,P` ` P Ѝ:T   @ `:`< (@@PPm0H-C1 (@@P P*0@PP  P!P P@ S(P@]@P0  @xH- *@HeO-Mx(@#@ @ T P @ T+ @,P) P! @p`QᤘP pP }P @P] GA@T ЍO-M@(@T P   8%A2X Pdp`P@Q* P pU [ PPFP*pP PT"TV@TZ   8A1 VhTЍnH->(@   p@-@`2P P`P V`0(@pO-MS(P@[B `@#@ P  *@ h  @   B/o"V`!p  @ pQ    [Ѝp@-@MP(@@ P`[ P ,  @ , #@ @1 ",  @ "0 `ETU J- #@ @1,  @0 JA-(@pP 0R@(P@PT5@DP pd9P}P @`PP%PhP` @W ! @H- (@0 @O-Ms(p@ ; @ P$PP@2,Pd;d;d;d;d;d;d;;d;d;d; P 4P 08A P%0`P     `tPRP P0 @4PcQa #@     Rc   PsQ< Q0bP`p  &P#p QQ;p`0\  P @Q* P QA P8   0P Q,QF 3 (0@ 0  @P%"%`P Pi`Pi P$PPc@ @ T Z P  @ Ѝ0 @YP PP(@0`p   `t PP p(@ @R*sP(p@@  0 @zH-S(P@$@B PU@Q* HYP$(`,P R R R @0 @BT:R R  r R"0`8p7     F   P `F @@-@P )# @0/0S/00/H-P@-@ (@    @O- M Q  Y  p(@#P@@`p P'0 @ V `W   @   p R =R    QV$@0`@Q 0XQ]PO R(P@40 pBW:R R$  r R2 000- PPPd@08 F0P0 Ѝ/㐊P8A4 @9& @)# @0 0S/=S 00// 0AS:Q Q/q Q/H-R@`P(P (2 $ *0@*@0 P P-PP US(P@0`8p     F 8 @PO-M R(P@@`pP|($(@4 (@*@p (@\[ Vz P ` v\ VpQ P P  `Q P K VP F PpQ? h KoT\V P@ʔp` V <`p#P@ʅp/ P P@zp ``pP #@ P  P@Up$(@@G.@AЍO-M$2P((0@(@(@4 p*@0 (@8$#@`Q0`#@ "#@ Q `&`P,`@rQ P MOMO\PN PxOpPbPPMtMPPZ @PPd  *@cPbP_CP~PTP~&U0@ETY*u0Q0P@o0Q0P@'# @ P Q4 *@@@pT_ 0  "11  1p~(P{`P(V-@A" @T) `0 "ap!0 a!@W P p@\  R} Q}4 *@@PpP8 5TPU @DP( 0P @PAP  @Qr @P@P P{P #@ $(@`@{U@#P#P}P@2Q PP T PQ [4 0T*@0r 000P !P  Cp (@)Pp! B!x @) 80R8 *@p!R\P`P "P $P }PQ  p4 *@@Pr x 0p\ ER0p@@]eeee]DTH[e[[eeeeeee]eee[e[[\e[a@_ T 0P@T @@NPU @D#@Y p4 *@:4 *@@@ TA  @(@P@9'U#@P @$PT 4 *@ U "U ` #@ @ (@ f}PP ` #@` I#@@4% * @P@ʉ`PvPm0E Q4% * @P@u`PbP0@ P3WT 4 `*@@PPPKPcQ pAA\#@ QAQ A AAp=04 *@P ! 1P! 00 Ar4 *@4% * @P@ `p=Y Y}U 4% P* @P@p# #U%U #UPP54E :U*@@$#@ ㆈPP' "P"P4 *@UP g@ (@D@ B#@ bP  P"# @@$2(0@0!R IPKR@3Y 4 *@(@@(@TG"YQ`1P QP A PAPA00 `#P#@P'U UUp`P P?@<P*?U% \U \PPm   p@P0@ QR A@Q7P@a@Q)WP@pW% m@@T g  !"#`@1` ` 1 \UP6 P= P#`P\p@%SU Up@ƕu P P\P 'P P p P*@t@M'# @ P@p@ *@P- * @PiP%P'%@%& Q Q@ƕ p B  SUC UApA: (@%P<%&@#%R R@ƕ%3A3 S SAp@0SU Up@@PquI%)@#%R R@ƕ%6A3 S SA%#@#0R R@pA SrW *@ `@MU6J%,@#%R R@ƕ%9A3 S SA%&@#0RY RW@P??P p: P pP p:pP@P #@P P PP@w`$(@p @P<PT ,F ,@ A PQp @Q@PЍP FP `P pp$ (" * @*@ WpWp>U WpC&P |P >P #&P >P <P@@ ` (-P(  @p PQ$` @Q@zz @9t0 @0P *c @)d @# @ @ @ @O-M(@P  堑 *@P J  rm ] (p@*`@*P@80P@N@T:T D P@fggggghg0hP0 @*@ $0@- @*@P  R  @3O-Mpx . /@`(@ @@` `7pX ^ P@/@pvP sPV` #pVG7 Q"@ vP p+P -P  #@b{]P"@XU: 1P  Q Q"@HPQo oᠢWi aQVr  % % p@P0P`P{Pt( *@W$ *@WjZ  01)p- P[ ! 0 0P P QWOr jpK   R ^pF Y  0L`VV!$R *P@P J@@ 0:TdC(@@ P @ЍQs @ᄮ @, @z  @ < @gj @cO-Mp`pJ WdsP(p@ !@  j!@ `@[]?`߄Q8#@@"0@!@"@"@  PU[ P[  UPP |0 @S[U  @ p @ЍOjЍp@-@QD PAQp`R P@`b#`@D>Q <Q  R !@?D@Q:P Pd @ r!@( R !@pP@-p@-@ P*@P QU0p *@P Q  R <p `6p O pU  Up  @w   @@-@QP @*J"@P P0H-P @C PP U **P@! @ 0b^P P@0A-@Q P@5 hyP!`@ p@  ?U U P@P@UO-M@P PP9v"@cPP4P @[PL k @UPP&e L| P P*`@*p@*@@P iTQCPP @@T @*@@%U` @&P @ PpPU`PEv"@P IA^ @d(@aPPEYU @@U)Y e c S㤉@*`@@"P@ @p WWp@WPT T  T@Ip@@W}oY㠢 *@Pc@YEP P ̵ x` ;^@*@`@"P@@P*pY$ Z P @P Rk @ Ph (@  @ GP @PnL *@P P WeL *@PP *@P ϫT  @U m c㤉@*P@@"`@ @pP P T }P T@p@Wp@@WT  @xp ;n@p@"`@PP V)@@T@Ѝ-PPU@H-M@ *@PP 4 U*@`Q U PTT TT0(@NP *@P `P`UP TV T0(@6`P`v T*p@`P PVЍ لp Q0(@NQ= T;'7 9V V V @gp U`V" PD ?Q @:"1p  㗷0(@6Q@ *@Q `6QP`H-LL U *@@*P@`pPP r`p W: *@ QP *@P H質K-P *@Hu oLL P `R*p@*@@*@PP`P:FPP XK *@Q/ *@ 0S00S/ <R:/0H-@+ P*@TQ  L *@*@Q- P+P *@'Q% *@P  *@Q PT  *@0" *@( @6 R TL *@P*P0p@-f @*`@PP@Pp8pUp  *@*@PQ /PQ/O- M  *@w V % 8 `*@*p@*P@* @*0@*@Q@P.QAT  PW{ߴV 8 % `*P@*0@* @P  P ٴV 8 % *P@ `*0@* @@ Ѝ ?*@ R3/1!@R/0H-X @*P@P0# @0H-$ *@  *@A--JM  $X *@*P@ P *@ *@Q *@Q  ( * @ R $@PD *@@U$@vP D *@*@@Qe *`@@TP;L $@*@\PD *@@q `Vf@ nP @ϊ}yF?Qϊ:ڂ"1` 㳵Jѵ9凪d(@0H-@Q PP@U Ph(@P00HGh(@p@-@Q(( * @ 0 P /Q(Ll P*`@ AP L\ *P@t QP *@P @p@- Q @RPH Bpp Ӳh(@G-@'PtPPP #@㻏`P1 P/ P@`'"' @hPP@m"``EP@_`\'PpUWB 'W P@IpV P@<P@2P@(Z`P #P pP@`V P@'h(@PG=0H-@#@P'sP @ U0P0H-((@$<(@H A-RP`p@ MP P kP  T@:pGWPH0H-LL (S*@@(P@ P 5 P0P *@P 0H|0MH-M  0 ЍHЍ/@-M@^P gЍ, @ᇧ MH-M d(@  ЍH Ѝ/Mp@-MP@, `,0 PP@X۶!@Ѝp@Ѝ/@-M@8 ) *@* @ @ 0B@I " *@@ @RЍH-M@x #@P@*p@` &P p)pPWH  *@@ @ P@5ЍA-P``Q=QR`V XJ@' ` *@A@pW P qFP @PppX@p@-X @*P@``I`  @@TE)` !@@T @ p@K-BMpDL `*@@PP   p*PBߍ0H-P0SR00S @#@00SS @0P0PSS@DR DH-M@ P=`P" pU rp@pPQ A =U `"Ѝ  @=K-BMD| `\ *p@*P@`@&P `@BߍA-M0p(@@ PPTPPI `[ TL| *p@ R < 2/`tQ  Q  OP!h *@V T *@V P"P *@P  ^  #< 0 `1`,  Ѝ  @ᡥH- M! 0  PP -P -H *@P0@ *@Pc *@Pf0(@6QiFQl  *@QpPs   @ Ѝp@-Ll P*`@U @2PUPpP *@P p@p0H-P0@PPU0K-ML P*@@-PP5  P p    ` 0R`` =Q  =pP-  -C(@@ 0(@Pr P& *@W  =Q< 8( *@* @AA Y 8 *@ ) * @0Q0P *@P Ѝ0H- @P P Q 1/P @0p@-@ *@ R 0`PU0=U=UV =upPp PkP ` Q 1/P 0 R=R/="o/A- *@ 0S p00S0W 0R:I *@@`pPU Q Q 1/P`PpW:H-Y *P@`@T p   ~@ @p@T`V:HH-pW  @@-dPpU!@u @HN1R 4b P@`@'W W 'oP @p <@8@pD "@H/A-@`PQp8T  @W  @dC(@@=P Q A ʌ 00 =PX !@Q A r 1/P PPO- M⤹ *@Y `@*P@P0  `*@`p Z T    V WpX:4 0@ 1iW` @ 0mpW ЍA-@Q,($(@4u (@*p@`=oP@=o@UPP@P@`P=PP@`AwYO- Mu` p@@PrUP pP nPVn@rU`iT`@ dT < *@P\ V   0N Ѝ< *@QG pWD `    P=XPP T  =X T=X 9P' T U R =X   pW;  @CZ @ZH-rP @Q @M0H--P R @P@KMPP IP@NP xP@@P "@ @@P?hPe ` @`up@@ P2@\hU CP@`Pb )$  tp@T Z*@ qXP Xr 0S   7/P P !@ P +v "@,  @ H-MP L *@*@P<  Pp (@ @0@0 @ ="@-@P#P XP   @X *@p@-M@`gP #PP-`gP PЍp @ 0 !@  O-MM@PX*@` p*@P`d: *`@ *0@h* * @eTp* *@* @l p*@i @PP$2 @PP `\g#@ p@bP QV@   :ql x `@*@/@ KA@6Q 8 `  L @ @@ @@  |  H @0@@@@ @@@@@@@@@@@@@  @@D @@8   @@@ @p @  t *@e wppg Wi *@Xjgf dppf"Px ` *@S *@@POh *@ *@E| *@ p >A *@&8 *@2p!@UbP)  @ObP=" "ppf"P: d *@ *@h *@  nf"P l *@ps [= [; pl *@P: @   @  @   @  @P  @p $*@Q0Q=0QP * @hj z *`@ 0*p@`00Vd: *0@0SX `: * @*0@ 0ST 0* @ PAo0(@ (@ *@ *@P Ho^? @= x *@(@pQp[PE pU|ڈ *@QWWta* ;* @WCp ʜ* !@* @ *@P  -P  P *@G@PJ H0`d(U; ( @N8@a.@0@P0" @3p  P@ P!@a@Ut 8P *@*P@ P *@P *@LU @P> !@U m H\pQ @PP@P&@ U  *@QQ *@@ U *@ @P^ *P@f/yYPT @  㴿 *@@P @@W^ * *P@* @| *@ f p p@(@ 志IPp d#PS: IPJPUt vPJP 㥗oRUb  @SPX P *@fc.`# V ZPo @qXXP@ W  P@ H p P NP% P^  @Zp ^ (@X@* *P@* @i| *@  *@@Pd@!@<⧘ P4͗}ɗޗ@MGP@@@0"@ r4S@℘@p ) !@ @PPpᾶ0H-@\ #@P@_P  PQ @ ^`: U*0@ UPPPl: *0@ h:  *0@ d* * @o@ * @00HA-@`@*`@D*@pz o*p@ PP $< ! @TP0@]T @ų@K-Mx[pP@c@p (@`#@@  09Qp!P@W@-M@" @1 P g @㒳#@ 11@"p`00@" O@q@D"tn@Ѝ0H-8@@ P "P<$0HS0H-@x *@PhZ *P@P @@P@ P  *@0H"e. D* @\p0Ȥ@P@@wP *@P *@P8 *@PeT. QD* @4P . * @-P0@jO- MPp (@X@r0@  R4#@ @!@( @, @{0 @v8 @q4 @l40 Pmf`@m&j@ @!`@\4S @ Tj!`@4S @ Jj!`@4S @ @j!`@4S @ 6j!`@P0S @ ,j!`@T0S @ "PG mwg@p@`@ P8  0*Ua0p 0 0S$ !S#@"@1@ P"B @ 0@0+"@ Z: ϲ ЍO5VO-M@(P- ,P- 0P- 4P @*P @"8P,08<Q4<P (]Q @ b @q @ @ Ѝ @P (]Q  @ @l 8*@ R*I @ݱ8` a BR RpA @Q ``@p  @0ıv0hS pRa`P R  v@㲱<Q v@㩱< Q v@㞱P PU*v` R 0 0R *0 Q*J b @ၱp pR:ppW:rO-,MM (P *@  pP p#@\#@ @MP@n@XM :SP(R ((@ n`P "@V (\P  @\P> &@\Po H @ PP l *@P *@V "@ L(f@#`@P ϳPm `@ V:0  MP  @pV. C@@P( g`( ᪳P  @㤳P  @㞳P  @ ư(p [ *@XV @P T0  P 0 @㝰p *@\ @P( *@@(dV`(d> !@M\Px Q@G\Pv t@A\P} @;\P @5\P @/\P  @)\P @#\P @\P @\P @\P @ \P @\P @[P @[P a`@VP $ @  0P:($@  *@W @ l  *@*@ *@ *@ 㰺 P0 HPKPH QD *@(0 4P7 *@,0 &P) *@80 P *@00 P  *@<0 P (4@  ᘯ *@40 P *@0 P *@{0 P *@m0 P *@_0 P *@PQ0 P *@TCl *@V*V:_  @ 0? @  ( *@"(L*@Q 4  ((dL*@V) @l(VP б@#@`V Q P P %P @[: P w( (@"#@wQ`(dP' @ll(P0 $P  @®p@"T :  @ Ṯ @㶮@@@(t P-'-''-'-''L- (( AtP P (s@L (* @Q P  (f(L * @Q Yz (W@L (* @Q~ Pm  (J(L * @Qr Y@ (<( L*@QpTp *@ o,Ѝۍ  @App@-Mn PW*`@VH@H>x *@Q.j *`@P!f. H* @7p'^P #^P&P m H#pڔ(@P@P f. H* @pʊ@'@Ѝpy@Q @㍰H-3(0@0S Hb]@-@ *@Q  f/*@BR@Y@-@]PP P 5@P P@ !@@@]@@設m(@H H* @O-M

( @>, @90 @48 @/4 %@*< 4@%$G@ $P@$`@$o@P @ T @ @ 0Hl!R@p\`AS p"P@ pW !@ 0HHHIO-MpW `S 8@T,PU@a @ 0@ !R0 #@@!@ @ QpS`TpS`T`T,S`TpS`T`TtTA @SP PD :!0@ @F @ =7Pt`2P@P$T @@ 0@t8Pp,@ Pu`PPP@$ 0@ @P\@a @ T0S*@! @ .@ Q8Q O[ @ G<P@PPW+ /L8@ D qPQ TTG*TTD  8@Oh @@ < P @PP+8=PQ @PP*F  @ 0GЍ++** y uH-@(`n@P9@ 0FP p 0pW:HH@-W%@V"H0P f/H p@- (2/0Ͽ ? 0 b B b B P2/<Ͽ>3?( 8 2/8 < 2/< $/$$/$D 2/D $/$$/$$/$$/$P 2/P T 2/T X 02/\4\X ,013?1  Brpp 13?1  Brl *@0`2/3?HVXO>_ XH0p0` 0P@5_4OP@@4O@JJJOJ ^:p@-@ *@P xf/G W5V2HR2/Rl* q* @ R3G-MP-d0P *0@  L!ꌊpH p#@@ P(@@ pa -`9`P@`XXX ppGwЍA-(S p (@@Q0@ @ 0E%㼉X @`#@!P@H0p`F vK-M`@@Ny#p@P Q Npdh`*@  *`@  ;yhTp*P@  `2/ЍK@ > !@AK-MPM@P u>PG* o> PG*R  `P@pR "Rq:*w=ںR  GP5R"P p4  h*@`yLp, T@fЍM|@ @  @ @@ "@:@d0*@ @O- MMP@X!@NP_ @NP  !@NPhD*@@弆p    P  ` @w L㭆p Y Ġ (NP [(hD*@@Q šP XZ 0p`P @Pp 0VH3d@ `w*@@ @p@hw*@ L_p Y   P ` 0(Y Rfhx*@B1p^d*@ rp 0d*@@pwhDx*@@B p] %@jX? p (@XP Kp>@[P*;$MJ p m @0F,m  P !@ @_TEX @0H 0V`pX Ѝڍ d*@ n@ @@> @p (@'@ @ @@-MP@  <P*h{*@H ጅpЍd0*@ @c@ Rp@-Mht*@ DopB dP*P@  @ @@J+i!@@  `@ @   0  @ X  @ |  @ @@ Ѝpd*@@ A-MPh@*@zD p  P` 0@c `C @[ЍBd*@@ H-MP)hD*@@ Dp"   Ddpp*p@, @H@0P ` J 0C> @ #Ѝ d*@@ p@-MP$`@!@KPP 5@KPoh*@ wH㢄pЍpd0*@ @yO-$Mx @izP/@(@p@` 4qP p ePjPdh|*@L @ @@hp Pа Q P*PJ @p  Ppdl*@@ )Q) 1@=0@ 0<d *@3 !@0@R0 @P Z`P@0p   x`@V: d*@ @j $ЍOd{*@@ @-MPh@*@ Ddp*@   @DЍ+0 @p@-MPLPPI `@ @KP  @KP  @KP @ KP/@` h ``@@`U @JP`hu*@ H㝃pЍpd0*@ @tO-M-PMh p*@P$}Pˊ@`(D( @ ϊ @wp' ˊUϊ@ @ U'd( *@["@ P : \dp*@` 0C ( @PЍЍd*@@ (1@  @-M@P P!@{JPh*@v H&pЍd0*@ @[0H-*JTR0O-\MPPHk @@`@/@p ᬱcPQ@Q:aPl@Q m,s n,sm,sm,s8ndP <p6x (@lW E R*W( rGdWo  @Ep acWoW(PdWt lW 0 Q@PQWQ RWQ SW H@ 9~ Hᓂp@opW] rW P$ 0 C @ @  D9Y   9P@@ P `PpU@Pb@UD`@| (H Wp@3XH@ j9~H Dp@  @ Y9{H 3p@pؓ@֓ ,P@ @F~ @.~&@ |}$0 L{PKU}E @ |P@QyR@Pw T_@ @H!@D[FT `CQyp `(@"P@rF   L ?BP( @p 7Bᨍ P tiFPᢔ ߛႠ@P Xp @ Y݋\Ѝ" +@ @w@ h7, @Z , @Ue@X@ [H-ML @ 0p (@v[O-$MHP A@PXE  r8L Kp@ `P: p  >p3 P5nX"@pP l"`@Y ZU @zZT  0X偗Y$Ѝ@@0H-PI @P،siFPtiFP rmFP# gtGP9yrFP loFP.ϝ&+{ " @@P0HZ8@!@#0H9 !@00H>PT @ZP0ጌ @O-cMPp@*@㈔t*@x*@|*@c*@*@*@@*@/@*@p4(`@0,( &RP"a@Qu\xzHzz${4{}yz8z<{yT{*@0@Q-A@QoxPyyy*@$80@* @0PK8PF*@*@Q>Q*@Hyyyy*@ <2<QXp U*@*@SP|*@z(@(@+@p`t*@/=Px pu*@_`/=PX @PSH  PO(@x*@Hp*@$*@48[@* @*0@P8P*@ P-ڠ*@(*@$"*@_ (@ R U33UE33CB @ @ P:`+@P /Y=P +@ pP  p 0W> /A=P< `9w(@a +p@"@0YP }PJ8pZ 4`Vt*p@ V *}PJU P }㈔*@+@c(`@`P  pW ,V /<PP y pE (f@j5NP#`@@@0 APEucߍ@+@!@EJppx |(@*@QE*@Q*@Q_*@Qx*@QVt*@QN P>@ @@+@!@ +@N @ +@e @+@| @ (}}tx$*@* @ R $* @ R Q@ #( @  /o"Q@EQsQ(p@!*@P-b? N4p P @b? ?4p@*@P @~PH  P*@4*@*0@ *@d*`@T+P@0尃`(@P@o2R  |pe @cY +P@4 p ʂIP+f  @+@nfP*@QP}p:  @eT'QD + @}p?w  @C'+ @}p4  @'  @+@%H!L1  D  @pP6  +@ Q< # @Q[@Aw+p@? <, (004'(g+ @+`@,p(P00?P4< y+p@y+p@0s(p@Py+p@w+p@07+0@+@[7@+0@ R7?+0@B+@@R+@+@+@0 P(@T!B{p(@ +@!@㫶{(@P U ܍P+@@  $+ @uP% +@P TD+@+P@*@@n/<o$U + @PO @O @O @O @&+ @n(0'+@+ @Pfp*@P$7* @ +0@*@ '+ @*@+@+@ P+@ P[+@@<7+0@?7+0@0@ 30@P&#+@ +@@P* ]b/a? P5Jt A 4 !$ t_/^? P Jxp!B$ 4p|1p"8P`RPP  0,@ &"[*! Y Q  t 4$!Cp] @*@P @ȗ*@P@+@+@$+ @4!*0@*@R (+@P( *@ '+@$ P* @U33UE33C@ !//@!!!@!Q**@d!+`@ 0SV*0qW WWG!+@@1@`!p0 `0,Pf0 T (pQ$ QQ! PP!R!RQ !С0 Z P  W p:  @% *@*@QP\ P( x㔇*@㐧嘷+@+@P+@p*@P t*@P (@ *@ 0 ,00(0083 @T*@P(@*@P*@Qm *@P&+@P TD+@+P@*@@n/7;o$U + @(@ +@R!@ *@P*@P5 x*@P +@P@㘖0+@P"@㐖E  @T*@Po 0+@+@   @Tn@P +@0+@(@PU x*@P @U  @4@pY*@ph (@yo؀+P@(`@p@ @P C(@@&q5 c G @@ d 9P8 8@SEQeQQ  㼔@SP[3 [J   >(@ r  @K  @P jny@?P `@ p@   @0@ @@@  0  @@ @@@ 0 @P@@ eP $P+ @QKJPUx@*@P @  @P 1  @w]Ynip P@ `@? p pppu @P 4+0@P! !T+@+@QQ1QFP `X (  *@0 P@;P*@" `)0  VPo @  @0%,0PT  @wG+@@P $P$ @ D+@@DЍ!@tO- M|p*@ P*@Q3P  @+@Q4H  @ ЍOYOPR  @SOȄmP+@!`@P 0PUP%+@ Q  @P9 @+@ 0U  * 0 ЍOP@ x  @OW+P@P8匤հ)`*@ @p W   0*P Q @n@W  0   0*@plWP" RJQQc  @N @?P Ѝ @ ЍO3@-M(@|*@P* @& (+@+@@ +@+@0 @0+@+@@ +@+@0 @0+@ @Ѝ@ @  @|N(' + @+@)+ @0 +@(@ @ @ pP  @bN+@+@@+@0 +@@ Pu @*@*@  @Ѝ@ M0H-M]  @pH (@@P@Pp (@P P p P@ Y@oЍ0H Ѝ/ @G-M@*@Q4 Q1 pP`% (+@P%& \ 3 p \>  @@*  @b  @m܍M-MⰃsd(@(p@*`@0 P0Q8 $+ @p- +@PT+@*P@@LTڤ$p  @W+P@P% @ؠ$p 0@T  @ m HspW @ !  @0 P0Q Ѝm HspW @p@-M@P? `PP P>"PP:P`ЍpA-M@|*@pQY ,S$!@+ @!P@PbP+@1P@DSQ X @ 1g @  x @1 @  1 @|1 @ v ?0 @o 1 @f1 @ ` ?0 @ЍAW 0ЍH @ ЍAFO-M p0*@PQ  @ߍOL p pơP` P` P``$4 @@#@P $0 P  "@`  @ *  @! @Y, (@c ?v83 @ *@P  *@ RX 9- P1)t *p@Q QB @K @ P JP!?0 0W!@@ @ !?0 0 @ P B P PPDPP=Pʠ+@ P7 +@P2* @! @$  vPp% @`$p `P!@  @ 0h  0`@pW +@PQP ߍQ* @! @ G $p  p $@\P @Q *@/*@(3 @ 0@*Q! @0  @ #R=05 @ 0ot*p@(3 @ 0@*Q! @0  @  U @pPX$@U: R W*P* @! @ (3P*P  @ 0@0 @! @ w @*@P1@P Q !#P) pH "@ 0CA*3 @! @ 0@ pԇJ)P* @! @ f)P* @! @ t*p@3 @+G-锧㘗+@+@P@0 7` @Ve7T`X  BQ  BP  @GxTP R/K-MS(P@ p- C(@@`V-ږr0f!!  ?R5p  RЍKtoP+@noPUF,\0Ѝ @ @H-O+@@B^*  Qapa`?A aQpQP?QA@@DP@ ppW L aQ3O-LM4℀ {%p @ @@0pY ($ oဩ+P@@@0, D@P 8<4x |0  @=+@+@0 >60p8@< 046(@ ? &6Px| 06  倩PpY0@+P@p @0儀@4p( d( @㱋P  7IpHp$P P Q  (@-PhH 㻊HpD"@@"P@PX  @ "D@P P U+K  "@ "P  @ "Pa pY〩@+P@@8(@ "*@P 05뀩@e$* @  @儀 p P$0000`PTPQ(@ 00T0 P@pY+P@D H PxD0[| Tx | @-, @ @D*@〩P8< <0<LЍ @HO- M@QbQf Qa w*@+p@R PP[ @W0P4` P0R`0Lx8*@PQD PUA OㅄPEZ, 0>C$R' P `0p a1P0Fw [+p@Rx*@Q8Q t `MHQQQ% @ Ѝu @O-M,(0`Q4 ( +@ 0Pv p@v p@q+@@pWpW@PpPWPPpp[px*@Q\ W+P@Pr {Ȕ+@@!R RR>Q QQ[!+@p@$  PQa=txA*@`Q V ! Q  0  R Qq\  @ |GFR 6QpQbG+@@` x*@P\ P΄P$  B @ J\Z W+P@P 帄P$ @ Eppt0\ " #\p Pf0AQ  B p RprQD  *@0 @p Aow p@CQ @P\= 8P9 U*   `+p+@Q% QP x*@P @vWwP p@pv p@Q$ @{@v p@pЍ3 @@-GP+@@ ! 2A b A 4$U@O-M⠗@+@`, P} Rؠ*@PU 0 p 40p0T0PRPP B $$d8UU  E 4p g*@ B`   D!!p+@+@ @3` 3kV Pd 3`ᐺk 3Ja  ?(1`)?'+ @Ѝt@O-M⠓(@ pA (@pB1!?! gPo 0O1p  R,ЍORk!+@jkP 031 !  G+@P,, 1kPЍE @O-kMM->}^N`-+@+ @+0@  p@/@+P@+@@  VcPd @RE0DtDDDDDD4D<DDD`DDPP1 TPyP :P p ^*P  +@@T% 3P& @L +@   *+@! @2  G +@  = p^+P@N+@@Q?N"0@PQ nR R oR+@JP!@@   Q "@Pp .+ @x (@ V ^A+P@`  n@P @/,P@ @8$>" @ 0@ *P P)  NPt p @@3P @3P  @2Pf  0 P`:FY P@T. ;pT z D@kP e.DkpI jN)Pa@PC"PA*#@ATAj@@ (. +@4?  @0@`kߍۍK @* !@,  @ p@@ @ @. @ @.L>#@!/ @H-`@Pap<9 p H-u6 p (@_d1 @#0@ A-`PV )p)@_}' ` @0``p@-@P: P @2P @2P  @2P' +@`V P2P `V+@P +@P +@`V P1P `V@pO-MM+@0Z@!P@Q `1P `V@@ @1P "@+@QqT k 㬿 N0)" @` @P= Q"@ =P4 Q_@p@`"P@ F[᱿`P -P = q(P p    @ qpP @ @ +@ a 5&!@ @V  8 @RT JpC"@@P GW _ip @P9 P P NV @ H @BP A ?Ѝڍ p P PQP@#/QP $  @ ' @ &P 0P= G@@:aN】 ㉮#@pP"0@"@@d"@ @   5P [   ݢ0S4PP "@Ϣ  @ɢ N @ P[iXi.+ @+@/+@/+@/ M@-M p (@@  & 4G-p@4+@aVQ +@ @l^+P@P Q+@ @^ ጙte @QVP VP+@@Y4  @>ٿ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ឿO-uMM+@N"@xhpB@ #gp ppJihP/JPJn+@@  P-  P oL pP  !@p pP* :hPZ @- @*8%<5" #+@P Php   P   @ @ @ @a uߍۍH-M P 1 0+@ @@   @+@ +@ЍH-x+@Q 1/ h0H-3@#@0 PUf|+@P 3q3@0@-m3@D 32c3@O-CMM@ (0+@00p $40p (@+@㰀0 ,BP  `P 4/P 81P P0P o @ 4PY   0(` 6/PT $P , P ,W WPYPYw C/ ; kp z8DP `g`ev ᐰ m% (@H * @  +@`V P  PP `~` Y0S0+@+P@  00 0`` PU  a.P PZP 52 /PPG @ @8  @p;4PJ pW20P+@`V /AS @@"P@7 pW 1p `V+@P+@U@PUPUP ,`(P $Q V`@PU8!@Cߍۍ Fd @ @",,` Cյp  哐4 @C+@pW P p  ἵp U `U4Q   0 @Pɿ UUPP PP 0   @k PZ +@P` ` |||3 +0@PQ @  T% +@#T+ @A'  `PP$ʈ+@@T@ Q Q(OP $Qc V (E@P $QX `X`@` 8pi` Y, C+@@P% + `P!@" @1  @ 0@PU Gt!A @ p@ @@0P  ߿PU aH-M `@p0 p4/SP+P@ Q  0p4/P QPЍO-MTqP` p@/@#+@+ @ @mPn0@ So@#+@+@+ @LD`DDDDDD\<#+@+ @PPfP pQ[ +@P +@P ] @րx (@@`V< r0P L@l0뜣+@P L@c0V$AP [  0Gp`pcv @㒞pWH@PXPЍH-0 p (@ @MH-BM@+@ !$1P +@Q^T\  @>Wp> 1C+@+@@ 5*P@! @  @0o:Aph P @@(`@$X=$P@p p W  AQ  P  mWNW YWyWnW Y@BߍHЍ/G-M✣P+@+@c+`@ Q  @ٽo c@p P  b@P J @ P  ソP |txxPP\ ` @ @RA%>\0/`h\p P: P  0`] 0p z`R PU:P @=`PwP @=`Pi `bP; @= U`UD!  @P  @0` D @xb sbPЍP3`xp0|P"%  @'up5 @V ( PV @P `  @` `m @ 0B`Q  z5b  @O- M` DcP pW P @p|pwPP @xp apW!URQ  @g @y]l-H@TN LPJP L A@@ $!1X(,dwP @2[wP @)pDQD% yyyXY `@ P@) !`z ( @ @p Ѝ @e($X* +HU,0s80004p.' 00 J  QaPBR"rBa!DAAFPPP S @ "@pPY R"0a!D 0U:JA130p& 00 A  apP80P<@5 @  @7 @ X $P, ,  RTY @|@ @@&)DPFQW* * *JL>v @10p04& 40   `PA A O P& 4 @D  ` @0 R : `eV @Q xx "L P\* @ 0Ph0dl Q* /L PUPBPP=PUP8pP4[ @H-MpP`v@P @ p00/& 00 " S`P0<0@p10q& 00  `P $x7 @ xЍv @O-$M` 0lp@P PR>rP 9, P PP: LP p0p@@ @@ @ w0] @0t @; @y  @QPLCLpqD Q@>P PLp% P @P Lq @QP@LpPPPP@P PPPP @PLpPQP?:P P p 0    o@ 0  e@P 0  Y@P R * 0  K@PPPU:8w 1w$ЍG-M@XpPYqP  d 0$!  X_X Q i @ v @ Ѝ0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:L3 0@ tc @ 01| @o  @GP P @/ p3 @3/17"@ @/O-MPpP:HI `p @@ P 2R B p:C q : p4 q5* r& @ @ 1 @. "@nC p:S6 s3 0@4:67  0@"@0.R9 rE*# @G@  @  @P' @+rs#*H @@R @7 r&"@ @  1SA s:*C @@<8 0@  @  @P H( @+ @ P P<=&7  @"@   @ P  P' @P )F7  @@"@@ @0 # @P HI @@ 5 @ xHIP P @@ Pp`VE:Ѝ@-R:P P *2@T@PO-MPP:`"Q2 sS p @PQ`:Q*r@pTSPP`VP:Vp P@ RMZ:Z*0 b `V Q Z :AZ0:   z/Jb q:Z z*# @Z :Z *@ 0W  @  @ ( @&7  @"@   0EPpW:<D @ 0  04`P @ P UPZ *  V pZpGV:PQ *"0S 0@@Q@@PV P@ЍK-@p @P Y:P 0S *r` VP 2S  @`hP Y:P` Q*`Q `O- M`PX@ nP (Ul L q " Q&#  @a H0Lp/uPWPwPP   tPQG:/L0S s2Slpplp00rP'tppppp%r020'2Slpplp02#402Slpplp02St0pPPQ *RUlpplpp202#20P0Q: P @X !P 0"!  P\ P  @@ Y:@tt@ ЍO-MPpP@P<:`@Q  Q P`V:(   @ 0b@P @bP PQ *"0S0Q@0P. <`ql Q+@q PQ*lPP ( @-" @> @V"@.P PP:"R PV6@Ѝ  @:"@`Pl`<@A-P W@Bm`+@V` m@+@T@ +@P    @]s  @+KmP) +@K'D8Q:PQ*" P:R$ R 0S, r:yP  @  @+@$s"s  @~  @'  @ @8P #2+ @ pp p p@-#+ @@T +@0@00T@+@@Q #+ @0S @0S0SS+P@+@@@rc+`@r@@pG-`+@0CSp+@@+P@P 0   p O-eM@ Pd0 Y:P0Y*h0 L4D$P008 H<@D\`T0PdP 0I `!8@ q 0L S! +P@(`,p nZ Py YrXp1PP\` d( Q Q d PT(` VhpOd \8  @_ @P( d s+p@TP@(`0(JH 8H< Pw UP{ Xp P *  P:  @}PXpd ((dP\(e`hpP P P@@\ 0Q$P L 4RD`X \DK %  P  | Q@ P @Qt@Qt ; @ Q. 0  p R0 Ph FJ QDP @ @`@+@%0 L0 oS0 4D\D`4L@8 dD0T4     08H< 0 LXpXP@  Zq0@ pq0`Q L 4RD L DLXp`H XpLq\   X ؓ +@@ ,Xp`0@dLhXl# hPOT 4   D 0 8H< PP KT 4Xp Q+@TP@PL\T_  D+@ @PP$ Q]* +@h0@ APpW\M pE@P?pT pEP0U: T @>:U<* +@0 APpW@T- pE P?pR pEP0U:R @:U* 0SpW 0pP?0W0  Q: $\p P` EQ* \p  @\ p4[D pDP`@PP  @ @WDp DLpLpXp+@Z@PP; P0 P  !@ 7PR h{,  @dHPP*<  Q 4 <RUE h pb@ uF:<G  @@hS!@  @;P' hH  @ @lPHM PLpH!<P@APXpJdP P3P@?hi  @i  @d`@P @6P \XpHLp @#P] YXpPAT:HPT*<  +T TE H PTA*<dT@*h!C0 @ @XpP( $ A$$@P h  @ @@PP: P`6 LXp`P@P*DHd Q:hk @ @XpP HPAdQ*! @0+@ p _TP' [* p 0$룎! @ P+@ 'TP <`T  +@0BTЍO-ML@P HP P  @ @ @ @P- Dp ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P!""D`6oD`#@`6o@`#H`6oH`L`XLL02/3?6o8<\1L` X`\p `` @pt8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x 1U @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,s0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO ۍK-M,(@ p@QpPp  ̉Pe` VLB Dl# 5_ Pnv TP PO'a` 0 p ЍG-P@ p`CF P =FP  !  @Tc@@'FP !FP  !  PF@pA-@Pp9[`K ` @0`AO- MMHQP(8+@ 0Bpop @o?T +@4  P p P`+@P1 N+@@ R000 @Y,/X+ @?+@P`6o`@`To`@p@p pW v`ov Q p p Rm0tPe X/+ @@T p` Vk# ,@+@1/p@ ,+@P(+@PX+@P.+ @ R000 |@@0.+ @@@ 0n+@+`@  *+@ECX+@P =  Pppp Ѝۍ @A2O- M@+@ О+@`4  R000 -@p0P+@Q  P 0PU X?+0@`0 S< 0/?sP8PU  PP D @P `D p @R000 ?X/+ @+@00` R  W M  MP0Pr `P@+@QU USVP  PI0P+@`u pF0 PY6 D @DPN+@@ R000 ?X/0+ @ R q +@ /+ @00 P000 U   +@ ЍH-M 0ЍH-AM`(p @@P1  0P@CU :x+@P:q @'>P X+@Q p, @ P!@ "@1 @1AލG-Mp@PK X+@Q p`VP+@Z +@P0+@P` 0oP] ( PEUP x-+ @ #"(@ Q p, @!@ P @B1pF @ ԦM+@@P0+@Q u ㍦, @1P  @B'PB @=P 4+@Q P wp +@Ѝ @  @ ЍG P wppЍG2 O-|MMBNpX X`+@PQ p  @!@ ZI @0  +@P 4+@P`<  @&S @]=PR  #Cxm+`@ `Pm4/+ @`Ph@S$X+@(P@0 d$ Qp S 2/l$Q t 1@ l$ Qt pBxm+`@/] @v0 +@Pu @=PZ (@ 0S 0 L P -+ @+@ R5  @h&14@$ X/4?+ @+0@0 S R AqR AqA` +@P w  0r X+@Q p  PjmBPx+@ @`  0a t` @P:㠄f V @  0P! D@0  f Vx]#+P@X 0Pi  4B@ ZA\ Y!P@  ` p x  +@P x +@mX4?+0@+@ 0Sd Ri qe @/ @1<P& (@ 0@q #( @ P@;| @a/  @| @Y/ @+@@|Ѝۍ @N/  @x% 0`PPp@$h AB A @6R qkx]+P@A   @ 0/p 1 @0ᱤ +@P pO-$MPHp): @P`#:+@` 4  ? 0{BX؃+p@(@ PP  (@@+@,/+ @ 5_ ARq0?1<1 0 (@,/ @+ @+@ R A  Pt4+@@Q p@tR @(@Q 4O+@О +@04 SPpppp <Q x` h 'h A'A+@p R0 w0?N +@@cP(`@04PW00 b+ B'B pP4 0 S:X+p@@  R PUpPP _`@P 0? Vp `@P @P 0+  됋{ ` @@P }@P y@PXP+@P _ l@Ph@X/4?+ @+0@0 S R qR q $ЍO-MMZ:x`+@P 0Z0*0V0: V* Hp @~P8`P @H @ @( @0 @LHX+@p4+@<@@X@pW 0X t 0 X t /+ @`_ 0; X W  F0p W@W  F0@ T F0p W  F0@ T@ q HR=G 0 ?  4+@@X+@4 X pP  P8  f.+ @ P0 @S10 0cSc1dQ v X (Ѝۍ8=N +@@ (40+@p, P$p0+ qX+@PpxQ- '(  0@$P   @81(,X+@Q 1@0  (*` @@+ P@X+@ 0R p 0h 2/0h <Ͽh h44+@P@PpP0 0 g‏+@P5"' 0Ww#Q pSpP 8%0-p L0 0 N +@@pP000 9PPPlJ f+@0 ,09PPPYJ pRX+@0P q0?s+@(p@ 00 Q `+ @'@0@0 0Q: 4+@P0@PQ4 @P c:P @S30SQ0X8-L  +@0Sl9P+@PPa 4 +@P$ ppX+@00.+ @S @(`0P@ * P $@ P "8@+@P 0qqpqX/+ @ 0`R Ph 2/B1$@P $R ,Ph B,08 L= +@y gG+ @'@ @a+ +@P  @w! @7P  <+@$@40 > H\Ip@-XM@P`P 08l   AH A A( A@X+@h04+@H  PQ`p D@S  2/L Q t 1L  Qt P  XЍp@-d@ QЀX+@ Q 2/ ,/+ @ R M= ЀO-MdP+@tQ ppX+@ P p0@S1/0 B?0r 0/3? BR"p0,0+@t0 S =D @ W Q(+@QQ@ЍO- M+@p0 ոX/+ @[ 1 /r  ,?@+0@`0 0@SxO+@@`@0@Q@%*R# GP Q) pW(,PP^`S pP/P pW` `PH `+@P X @Ÿ Ѝ`+@P H+@PJP PPp[ Ͽ| L@P 0 L @@p@W0 PQ` ``+@P H+@PZO-MMMp8 0(@(PS p0040+@0pX+@W`V0  /r  : Sx * R.+ @ (%0P?n=+0@0S <PfRW h[ WC C,@ W0PVP 0 ( Xo+`@ $ .+ @ 0 0B?p( PX p  4+@@+@(08#40+@ @TR +@8% -L`T ? aXo0 Q+`@SQ(0T    R (0 P Q 0H $pR00HP/U, /@ +@ : @( @5P p+@4/+ @ 0R  Q L1/ YxQ =   @L+@+@ 4(0+@p+@ @X8 R (00pOaP!C_pXX   X/+ @ R (0 P X+@Q 0$  0 PHPV / +@ i: @i( @5P [3 +@pt?#"(0`V $4+@P "4X/+@+ @ Q@@R PP @cL/+@+ @ MߍۍO-MPP@h:x+@Pb: .+@+ @Ԯ+@  U :x`U?:k0 됷?#"1T9A'(\%R !p0Ž¯'Ԯ+@ r!V`x``p  g 0W 0QS0R0000 5+@0x` PU-+ @ 0F4+@0Q0Ѝ @0['+@ / O-4MMPH`Px@:/; @ ^Q3~@+p@@0 25Y,0 t1I $P(``*/*PA`0+S\1 U4KYc*5KV왢"p5#0 { !+ A a`0 T$P1 Q0kS q!(`#?$ P 0\/+ @0 X1S(* 4+@P (,0P(@pP,0p@T (,0P!2/!(QH+@ .5P4 $@@ pPK(+@tQD(,4q4+@P    / $ @>9P 4+@P ,, +@,  p+@tZH+@4$@ p(,0PXI4+@P    X/+ @ R  P X+@Q 0 Z&  0#HP#! 3@+@  }8 @}& @)3 pP$@,0  1/,0$@ p[(`P4Ѝۍ.4X/+@+ @ QppR  P P @o,0+@L/+ @ O- MRPP@hp+@ P P GPn+`@8Q +@P A A0  0 Q +@Q   @0᪛`? (6\%TAR 000U<6R pp 0p0 0S0T +@PN 6nR+`@ p p0 40 @ @d\5)S A0  L @#6 0S0! +@P 6nR+`@ p p0 l @02 @ 0* ЍO-M` +@-@+ @ p$%R: =+@+0@Р@ V 4+@:`+@0 +@k@@  Pᐇ/ !T)A'\P 0 ``?" ``  p p+@ᙳ@ +@+@T`p`࠽+@dPx$-T+@+ @ 0j ` Z03D2Q  MS  0e+@+@@03u U rQS 0v3T +@=4+0@+@P @pQ 4 Xs X+@@`+@YPQ p P hp8 3oPp7-PEuPp7$PEu@lT@+@+@(EQ<@X5 X+@(`P+@+@P q QQ 1P1PP`U TJ P   T:MH+@+@@0 c3=4+0@+@,Q Ѝ @0#A-`+@0Pp@ I -+@+ @P +@` +@` +@+@P84H +@ pP +@WP5`Fd,W +@=`+@+0@-+ @T@p P` D_P  @0# @#@-M+@@P VO-M4@+@PX+@U Rp <p+@0 0B? P``0V8PPe +@ ?4 V+@,` `#V*o $(p p(0 U 0?0`V  [:@X 0U p`pop0S`_o+P@+`@Q~.+p@[TQ  d +@Ѝ9 @"0H-P+@@ ?+@P !# " 0X @0"p@-N+@@Pp^+@+P@Q`@UV*UUpA-MP@`pWX+@Q p% @ P! @  "@#Cm+`@P!  @H+@  R0Q  pL `P0` px64+@P +@, o @y/PP+@ 95 +@   +@ЍH-Pu @ 0@QUd:x+@P8q@~ @A X_+@4o+P@+`@P  PpR 0OP  @  PpR 1A "@Q p @p +@P " @0PpS   0 @P(Q 0# @HH-@X/+ @P8 0U 3?`@0&0 0t0 D gH-@@P`V DP X+@P 1Qx+@ 1R:P 6oVx+@P:pPa0H-8 B@$|0@P@00H-M@ $0P @ @! >H4 AR: Q Q Ѝ0 @b!O-MP+@` @*4Q P@x+p@ U *4`P P@%$ +@0 p '!/+ @ U R/: Q ``W`1QP p  ! `P* F00 RP+p@ Ta3`+@1\%T9AR !0 0~ +p@  ?/+@ lXT+@+@Q P QP  +@ U @ P PP 2 +@0 p! Q.\0 +@0+@ L#@ 4t 0S4 B  $*+@d1X+@P 9+~  X+p@  X  X+@82 4+@p s1W X/pp+ @ R  z溯X+@QN 0P(t z溯J @ n  @ nd 0 XⰠ=vX/+ @X  .+ @p  0`T @ br; RpSQX   0  4P(& 㰠dvX+@ P 1. + @ ?T b;r RSqQP  0p h+@, +@+p@ p0W  ,ЍO-tM~0+p@P 弐n@.+ @`1\%T9AR !0 0 ^  ?+P@- XT+@+@Q P QP U @PPX@X p @$ ~4OP+@@X/+ @P pR 1dPdt0h 0dPdth `P +@,+@ P+@ @ P1`PQ d h0PpppP P2+@  R0V ? 0 p!Ur p@Q\.00N +@@4L#t0  4   $*&+@/X+@P '*P PN+@@0 PtЍ @`TO- MP+@X+@@P0 SUs2# 0cQcUaQ T /r 4?0+0@@YT  @QY@ Z@.+ @ 00l ?PR v Y2  R4 P200 PV`0 U@  p㑊PU`J+PU p Px*@Y  R  p Q( 0 ^ 7,RQT 0 O (,  04+@P  0qX+@@P p@  0X/+ @ qR 7@  0x+@P`0 +JZ0+@0@@ Ѝ9 @O-DM4+@pX+@`W VP +@P@WP`0 p V ` p l  hV 0,P@ `T><4 @dSD>FQ 0t0"8PrPV p+@4/+ @,080 $4,0_R 0PV X/<+ @ R 4,!T 0T2pS` $0P@㕨`Vp8+P 0V P 0 @P-*0pP040 $PpW@̐N  `Y Wx   @r$PQT@E 0PE QA 4O?X+@Q 0,( `+@0X+@ 4+@0S R  0 R  9 0 0  $h+@ T !8P `+@4/+ @,80 00?R00 X/<+ @@ R 40$ !   *,`@(  064+@P  0*X/+ @ R _  0X/+ @ R 0 .0+ @ 000 *4`V[p>8aPE p+@4+@800 /Q0  X,+@<P  $ 0倁, X+@P 8 0 4`(V& 0`F4`P@`}pDЍX@+@Q 04 $Tlt @T @00H-^@+P@88-  0 *@0Z@0O-M@|P+@@8P 76 +@p +@d +@p +@p +@ `@p/@+@ ,gTP"a@Q)D0ؙ̙,HT`l +@EP FP PP  +@UP XP BPp!@P|  @P u +@  +@pb"@ 0  +@ @u :+@ @p ]PY 7 @WPW =c @ 0+@P +@N @rSx+@0 +@pq m!@0 (@ R * @6`p+@Y+@H+@P+@pI+@+@@ +@p:+@+@/p} RY` +@P  `P  @S`x (@pPUa +@P+@P @ +@P @@U6@+@QL֫PP @ X 0  J1pp8I`5T@ @T@v @pMJZ@+@P@Ѝs @H- p (@ @*p@-M@P` pQ QЍp @ 0ܤO-MMm@+`@P@ +@PP  @@p PP  @P/N+ @P+@@  @#P & @; @+@P P ` @l0+@P ~ @d @pP @iT P @bP @[P) @T +@P PH @H9+@ +@ 8@ov' 0p  c @/+@@dDt!!/00b  0= 0:dP@0!! 2 0# @  @塏 ^+@+P@+@Ps x+@o+@ +`@Q 0M+@@   @PW +@@`, ?P4?@R%8p+@O!4# @1!@0@?ho p+`@0@p0Y`0 0   @L^+P@P  @D`V H @@ <`V P  @1`V ?H @@ )`V +@A@^+@+P@P 5o0n +`@@04*]+@)X+@P ^$ Lo+`@P +@( O+@@,P pQ K ,pW:KP+@  Q P F @1+@]@+P@P, P @!P v @P ("@P( ( $0@"@"@$@4P P @3@ЍۍO-M--MMp+@+@+@P,P=  T Az/:&\%R0 ?Z 00 0 0Z p`Ppop`PWPOPNGp@`W+@,Z:4@HL$0P_`^@PPA@ UPQ+@pXp+@n+`@+@4 @t,P pP4P8圏 xD+@Ћ(<p +@(@+@@0 qTyAT@4!\5S 0p0 0N +@@  ?Pp & dXT+@+@Q P QP  +@4+@ QDR Tdp`,p!0 @ 0pQ  +@P 0 +@PP> U @P\ 4U @P TI  @U @P X X0 P XA0TX@ 0pX@0gp` T劁 X` *ADP p$@`@(ppp\u:  hpP )Xl+@pQd 4/+ @@TQ@  `  +@+@T 04%!TX\ p+@` p pdPd +@ PXZV00!  Q  :0QQ : ^dVa: d+@P ;  @ 0ᾌ  @ 0lPo @#P  4\+@hpQ6 ,+@5\+@h<(0 pdP X+@ XPXb   @ 0o @#P  4+@Q< ,+@;+@8 +@ `@6 @+@8pP7Ȁ @wpQNJ  @ @[#PG ,zPX+@+@@4+@ 4R Q# 0! +@l`@hpPpY:pȀhPQ 0? ? 4`O,H`+@X@0 B?qk8 ` * R`@ Pm4H0+@Xp P(d+@Pa(P J S:+@Q <S* 4?P+0@!0n S!So V: FPt,L@/jb F`Af0+S[1kP4[Xs#5[W2"F  K '+&A ``0 T,L@1R0;Wb"!![-d+ @X0 RH Y  @ dN;s:hP X(+@LP 1Dd +@ ?+0@0"00@$P+ H@+@P  0X  @@U ~P( 4+@Ph pfP 4+@Pha ` v4+@ V&ʆ( pP (1_0l X V Vt@ pP?  pP U4+@!X0 PA_@p3 Q L!X`PHpLP/ ?X/+0@+ @ R l@ \pP^*BPJ .LP+ @HpX`@ O =+0@0S P' X+@ P y  0 @-+ @ R P X +@P @c 0  @@@蘊X+@XP 1  @㌊+@*  @  @!LPPHpX`@ D  Rlp  0LP+@lp8p4+@!P7(+@Q2 X+@Q pP PpP lX0+@P/Q ?s0 q3?p01 p0 t4+@(!+ @P0!+ @X/+ @ pR P1t0Xd0PtXdp,py4+@P 8+@P +@P;4X/\+ @` h@R 1Q Q  ,D  @ 0c  @ P X@+@\ Q Ol M8+@PW X\+@Q 0PN  +@L0 @LP@PU +@ 8X/\+ @ R 0.+ @ 85 =`L0`T  0b0 RWQ!d`  X/+ @ R !40t p2/L@@\+@ 4ap %4+@P`P X/+ @`@ hpR  Xh+@Q 0`@hp 0! 1 , C  @ 0 P +@P  @ y @ PJ 5 4+@PQ X/+ @ R X+@Q 0h,P  0  &ph}+@H0@XpLdX+@( P 2/  @@@Ĉ+@ q+p@+@P@0 pXp6:p*0+0 `1 T@+@40P0003`PPS`Pa, \`&% VB*(CPA \pT@Q`*$HpnT@+`@㜏@+@+@,Tr:zE\+@Ѝ؍Ѝb  @`0x  @b  @0$  @ q  @4!O- M؁PH `XRP:  @?P " @(+@ p R  @p pW8^`+P@P   `PRp.+@1  H`00) / @^0a+`@ 0 P >-?PS Q +@ Q ` 0`& 0#0 Q"+@`0``000  +@ # " `pW%  @ +@P  @`  @`P +@M  @+@@PP  @`P  ЍP! O-lM@X.8+ @خ+@ +@ 4 @X,Qb p (@+@@P Q d> p,  ᜿ @0+@Q6 pT+:UP& `4+@X+@ P@pR P1\t0P\t`#P  @PpW:,X:lЍO- M `V:8A^Ѐp+@@+P@  PpQ   " / @F Z ZP Q `Vpp ЍO-cMMz#AP $Hb  @ @P,  @P X/4?+ @+0@0 S: R?  <  @ @{P +@!K  @ @nP  0  0  @S +@  @TPR   ,CN+@P #o N+`@+@@40 0@ S^XqL @4xP($NC/@(X+@Ѐpp (@P `+@+@pK@Qd^ @ 0p塆+@p(P% P%`, @k+@PE  @Pj4/`X+ @+@ (Rh Qn l+@Am ` 0 "0/+@+ @ R   @ @    @ @ M+@@P  @ (+@P@vZE(B @|P4/X+ @+@ (R Q '+@Q  Q      CX+@4+@PU Z (C.@0 Z. (C.@,C 0(, Q 1P  0`P0`0 , Q): 0@`30`$ Br0C ( 0, R 1Q00 `Q`, R: 01  Br$ aU B Z $U1|0$U|CS/@Q+@([:`+@Qu +@@(Tm*CS^(`pp(Pa CX+@4+@[ Z (C@ ^ Z (C@ UC(, 0R 0 00 ,0Q:C(, 0R 0 !, Q:[ `$ @CZ 1|[ t1|[ t(@T:+@p(W]* !@ 0(0S `0@&P#P0s(pW:B `  @  @ 0  @P(  @@   1  +@0P @  @ 0 ~@ +@+@p+@PAP` pPQPW:+@pW*P    " pP=cߍۍ{  @ 00@/O-IMM@@P84+@X+@P%(+@P Q 2/R x/p+ @7  W *Q 0P x+@ P*O   @@T "@[PQ Q 0,O+@@,Q"@ HHHX- @ R  `p  Q P2 r  @  @-d  @*P` @Q/ @pp)P 4O  C (- @  @ P7Q 02d  @P4  B+@p :P  -  A +@,+@PP@p.`Q 0,+p@,Q !@k  (( 6 P  P  /r P0 A q0 P0 AP=X +@@0 BS qPU !@DP1 } p@ ppP P<  @  @7  @7PH Pd-+ @ RZ  @VX+@P 5_ PPP - @  @ Pt +@p  @X+@P PY-+ @ RO  @lKX +@Q LA- @e  @P +@X+@Q ` @p   ⰐP  0 xA@  Rr P.Q`VP. @ .P'. @PPI 0 Q 0x?+0@`V *8> 0@00PG @ZP6,+@P- Q 0PP Q 0P PQ 2/NP @0Q  @(PGP @5 +@PPi @ Q 2/0  P; XP+@Q 0% Q /* R   * R   Q 2/p`GP*PvWa @ +@P0+@P IߍۍGP:WR WxPW0 S 2/$< 0@PQ 0p0 P2   P 2/00. @ @0 +@P  @G @xPP Pǡ,+@PQ@UC0 S 2/>p 0@00  @OP +@p  @7 X+@Q/0/O-M+@P✟  .+@+ @@ @p (@P P+@`K@dw @ 0`庀P`(  @R@p00R =+0@0SP?+0@0S!@W, +p@P(P%J@P`  PT@0?+0@0S R @ p g:j+p@T/ @ S @P\ PX  `X+@ p4+@`\`@PpW P1dt0 "P%,Pdth? @ P  @" (x O+@ K+@@[(*ߍO-lM@X؞p+@@,Q _p (@+P@+@ Q d @,`|g @ 0`Q `PT:04P+@ X+@0RpS 1\Rt1`Xdp7\Rt`XdpppXp0pAWi$pW *P! +@P=  @%R0$  @/+@P+  0p0#p'0 Q P# +@P  @ 0~ @ 0 p.+ @; @ @`PUo:N؞_+@+P@,XB:lЍ @0bO-,Mخ+@@`p(P? .+ @P1\%T9AR !0 0倞 +@  ? x` XT+@+@Q P QP XU @P( P(   @|(` Y$`H` "`Plp+@!D`] +@P P  "0* V Q$PخU+@  ?YU @0P`?.1o(0+`@H PR L 4@P0A_!  $P(0 8 QU $4$ L# d0 4  `@pY .+ @:خ `+@`$PV0N+@@*+@VX+@P +P PN+@@ P,Ѝ(@ 8P$Ls 3 03p?`P e2! US Q0vO-M-)MM^+@+P@p@@x 0+@+@dPpXP2$P,M+@@P 6 @tpPP @ pP $/$+ @@@*M+@X+@P Np @XP$E0TT~T|ʡ @g @` PP0$0`pU"0.p0_~Pm  @"p0$EVM+@@P   @p`$͇J 0_P.1!`P@Ve_naA  @p0P1 P@PL`؞+@@7P $/+ @@@@*+@PX+@P %p @04+@Z `La P D!!H!`Lap؋$5_S!P!!T!]`@+P@PU B  X!!0Y4 \!_>!T!U @PBZ` %.8D|0< t00 @p ?.x0H V(o+@ PP0 XPUHP%~0p +@ B| B Bx 80 B oPR0c /0`P`OPN`q~``@@f`pPp,P TPT4lo؞+`@T\hXPXBp (@pd+@L@Pp dx,Pd 0 @P尀*|p1T9A'!\%R !0 0^ +P@  ?To+`@ X+@Q P QP  +@u$+@P U @P U @P  @P N+@@V +@P @P @P +@+@! p$#\TAP  0`HdP+@hp p pe?2w5 pU7Q% SFv qTyA4!\5S P`00X^h +P@  ?n+`@P 3 @#@ h X+@P |8 )A@\Q@TA\+@P5P8+@P' L] @P! p`&#\TAP  0`HdP+@hp p pe?2w5 pU7Q% SPl/)|p ORQ4@+@p@Xp hXlp  B%QJG,A\QJ P 夲@Pd$P8 P`p(@ R  ! S0!T@!X!1 A xPhU @ QD及QU @PLGX PJLpU @P2 PAP" U2 0@@QL!pPU:W:PP0UB @@/SqL!0AVp8+@P@ 0p_^pAP~0Cp70UB @@S0PpwQpq8 RPQ Qt1` U2 0@RP  01 2 p+@XPV  PD dU" @QD! !U" @QHPEPETd  PpsWa P  h$P\@`8!818`V[$0+@P(`P% \0X` p Q $UQQPQP`U`Qp00V:Q $%Q! ! p / a t/Q x/ALs  %/  㾰P5 +@P · A( @ 0@x @sP * `+@ H+@NX+@P # +@$+@P 尀 ؞o+@+`@N+@@w p,pW: 가` fPU @U"PD @Q\T SP$ X @P ` pU @U"P\T @QD  _N+@@6 +@0P+@؞ +@Po P4 `U2 0@QLpU @Q\P @ U @P\  ! @1P @T`VTP4:`U @U2P` 0@QpPP @ U @P\  !5 @P @T`VU @oPL+`@U" @Q \0P+@* PT @fP$ U @U"P\ @QL   P8JLQ qU @AT` A&H@%^ WPR +@P D$@p0<p@ 00H0`00o0` @`0 04` pw @P! +@0  *A+@X+@P B   +@)ލ؍ЍDF @0 @ @K-Q * rP`"@ p@v`@v@T qvP V:O-M~+p@!z m0^@+`@+P@ @1(# P& (@ v*CC+@UX+@P *  @ @a P P +@@P, - @ %, %*+@X+@P   P@UT ЍЍO @! P P+@@!+ @<+@/<+@/D+@/ M@-M p (@@  w 8sG-p@@+@aVQ <+@ @uHQ+P@P Q<+@ @u Lt: @uVP ~uVP<+@@  @uFs MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M     sO-uMMD+@N"@pB@ #p ppJP/JLPJn+@@  P-  P <oL dopP  !@p wpP* PZ @- @*8%<5" #L+@5vP Pp   P   @ @ @ @a uߍۍH-M  P 1 0L+@ @t@   @L+@ztL+@ЍH-+@Q 1/ s0H- @#@0 P+@Px@0@-@㱼mj@O-MP<HO+@`+@@` +@(pgԽ+@P 0  P f  @  @ PL `Dp+@S +@PY +@P q @ @\tH+@x 0nX+@+`@+@  @+@   9@ 9`+@` 9p 9P+@T WV( @ Q/9 K @J(9 ^ @tߍ>pH+@+@ @s 0P+@ R` p D+@LR> pA+@@ +@@Pd ؾP+@T @\%R p. P!' H+@+@QYP @ %, %*+@X+@P Y +@P  @sY T+@QKYI H`+@PfO+@ @ G @R* @Y`+@PS +@PPLD=+@ N@ p  @P fs@PW @  @ mPO   @  @LS"-+ @ T @,0hp+@0 X u @_?`P @XATl ءZ 0+@`4P [ Q ;0p8S8Ė< \$ P!+@T)A@$P ` @ P 0@ PE *X30+@ X+@P ^4+@ @ RQi O  @o @ P+ 5  %*+@\ X+@P 1 P:' @L @j P  *+@9 X+@P  <dQ:[ @L @G P < *+@ X+@P  4+@P:Lq1 QQ+ @|M+@@  Q J  @PL @ P*R+@ X+@P S 4+@P 0 Hq,  @FM+@@ 0RaH J  @XP  @P*+@ X+@P z 4 Lq,  @M+@@ 4RaL J  @&P  @P*+@s X+@P H +@Pg@!@F~ @ \4S+ R( PQQ PUQ P  @  I R  :  XIQؾX0}P+@+@+@+p@% M+@@P J  @P  @5P*|+@ X+@P } 4+@Q,QS 0"!, 0 @iM+@@0Q4e J  @|P  @P*?+@ X+@P @ 4+@ (R xQ2<Q0 8 @14M+@+@@x 0Q<S( J  @?P  @P*+@ X+@P a H8%<5"#. a @M+@@ HR?8<5 J  @P  @P*+@T X+@P ) @L@%D5"#D  @]+P@ LR?@D5 J  @P  @JP+*+@ X+@P @ @ @ p +@P  @8@H 0 A4+@,/+ @@QzPx,%Rs +@P>  @d?Lq QQ ڦ @UM+@@ Q  J  @hPL @P*++@ X+@P ,  @ @P (+@   ,84e00 < (%* @+@ X+@P Z4+@  QWPULpQ +@P  @ @PP $+@ h0 c L0Pp- C0pO$e>qV1 `@U_a\``@ LPp00   *+@' X+@P  P +@P*+@ X+@P  h mH +@p @4PL  \QW0P AH4Qd P8LdDL×+@  pP@ 0b432 R"1Q SP X] @:  @P T+@P  8Hdd LH+@P` 0b632 R"1Q SX+@P  p0P Qh+@/!`@ 94pP+@= ,o)P+@> xC+@  TK+@ 0P @5@1+@+@@ +@N)P+@PG)U]o+@+P@+`@P @5 @u @ `+@`8, @@ 3P+@ 0/+ @ Q P ᛦ` KQD+@+@ 0@PP p`L0ADP +@P  @`  @ P ` 0``@` 1Q  @Rm+`@P  @hPy @P  p P  @/m+`@P S  @EP  @P  "  @ m+`@P J  @"P  @P ` 0```n `piD  @P @% @~PJ R@p XLuPu^+P@ *8X+@P   p}+p@g  @PP  @ fP+@  @  @  @`PYp 0PRp @1Q/Q `V"*Q:Q"  @s}+p@P S  @P  @P   Q R  @Km+`@P  @aPy @Pj  c@0p @ p 0FP @@@`D    F? +@ @`P T P1$ T9A  R 0  Y SP TiP$ @ @ @+4 $ @ @ @ 0@sl^ @0+@+@ ]+@+P@/+ @QBP@   @Rl! +@`+@+@+@+0 p0pWPO +@@?p+0@R  p07 ! @"l`A&P +@P&U+@Pc  @ +@iO- M +@0PD+@+@U *o  0@Ppmp)ʅ @+@ X#@@?ZP` 0PpKP  X @[T+@P +@P  +@P  +@P P  @  @P:  @X+@P :  @P JN+@@*P >80!9AT)A\Q\%8+@A4o+@h YQ @2@ Ѝ+@d 04C'"}+p@p#%ඣ ?W& ^N+P@+@@iT+@P +@P * X+@P X+@  o,qTyA @1!\5S A 0X^+P@ ?>@PT+@P ᶾN~+@@+p@ h AX+@P 奾8 )A\QTA\?fP ؞+@+@P 4  @Q@h Q pka @P0 R DjP@pU: @m +@Px<@+@@E @# @8/+@+ @ 8A 1\%T9AR0 49AR1 8C\5-+ @ R \%R  CR/ATA\/4/+ @ RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R60H-P@ ` @XX<<@@\ \2 p 2@?τu/8 `*`*@ @h 0HH-P@ ` @XX<<@@\ \2 p 2?τu/\ `P *`*@ @$$h  ŕdp@@SD `PHPS0He @h ńdp0HeH襡\%Q TARTAR(  C TAR T@R 8AR AR /ER CR  $+@QAo TAR/ +@PP`/+ @X/+ @\+@T+@/P/@- @+@P  @ i  @@r@-X+@ Q /**B R*R&:@3 -@+ @ R Q p`  @hH-@ +@P s  @F @P hU +@PYH+@pT +@PU  +@P  @h @hph (`@XP@Pp (@㩖Pup W  AQ ᘖ P  mWNW YWyWnW Wh pyQP+@  @hO- M@+@+@@0`+@@ .Pj P+@ @A .P] +@ +@ 㽠@P(@ӟp -oWbo[ X::PT%V/ P%,DP+@@@+@ZP P p 0`(rp -W [o+@bo@+@@+@ Ѝ  @H-M^+P@@T +@d n 0^<Q>0S`p'`&p @T@T  @  0000 P@@Ѝ  @A-M+@+@pPdpp ` @P`2q`SpT,tQ! H+@ @'D+ @+@000 0@n@`ЍO-MP P` `@V +@ p*V ! @ @ @ 0 p 0p p0+@T<؎+@ R6X0@+@H`+@pL3 BR@Q  v8d H4LĐ@P 0b532 R"1Q S P  \p0@ `RЍO-$M`+@0p !?Hp$ @1P 0"P^  y0 @T~ @fWK P+@ @  1 +@ R0 [Q  L  0  @%0 @ /) ;? M ?0 +@ @ @0f +@  `Z sf $ЍO- MPJp+@`0@Pᐢ!( h1P@+@ Ѝ  @0P @fT PM1 P ܞ 0  @jf P`U ЍO'fO-MP (+@PЍ +@H+@P&J0+@ <؎+@+@P +@PH M+@@P $ @4P+@P +@ ? 0D+@  @'P( P PJ+@ ~ ? *_+@X+@P Ᾱ`H+@  e^+P@`#^+P@Y#p+@@T TPM+@+@@.+ @PL H]+P@P m @,Hop+`@.P""pU U@V @P& P%  @P$T$X$*@+@~X+@P S  @P @  8_+@+P@P  @@*@Ƚ+@RX+@P '  @ +@P  @  *㧽+@1X+@P    +@P +@+@@dP᜝0Y @ +e1D+@l ЍOh @B @@-\%T90@R"-RH?>ˀ c C*l "BLŐ % E|0 %,@ 0P%0@P%,0@Gp@-` +@@PP dp @ 09  @PpxbO-MPH0+@p8^h+@ R/P 4p+@+@N`PC YJ@.!2 @pS @000 R@0 TPpUpP\%1T9AR  !0_ 0N +@@  ?^+P@ XT+@+@Q P QP 効U @ P PyP } `Y!ϊ0P @p+@~ 0a"!on P P `"@Tq !N `+@@P8p+@ ? W 0Lcp R "pGp`@0p00GQ$ CP$Ls A$ R?0 B 0N〞+@@Xo*p+@+`@?+@P ᠷBP P PЍ  @)p@-^n+P@+`@ @ ]X+@Pp p@H-XM pP`X@P` @IXЍO-\M"`pP&@! o'+ @Q@P*  X%$H p !@"@ \ЍO?& P* !@`D@ ! @`@`@D  @K ᢻD/P T `+@+@ P+@& ?eH+ၻ\Ѝ0H-@x+@ P:0+@P +@ Ea1S0(@0  @00H- Q(P@SSSS@HPᄻ!@U +@P  @k @P 0 @+@/O-M@\PT@P P~JUQ PVPv V.  +@P  @4T+@P9 XL+@ pqqR ` 3 X` )Z LpWQ @ pW 5  ?>p(aCnHg0*/1 Ga]☠ȟLu C4 ʿw0*Fj0`\ 5 N P ߍ- @>H-P+@@paV Q PR }P P A@`T @? +0@00!R  R//G--`PP:@Pp'PI+@!% #^1 F7KR 9 # "7 ! oQ. +@Q) g0+`@<P  R   W+P@{)Q( `p @ P +@ w ap A @-.+ @0!% ^! F'K^ 9.$P% "  / #"o  O-8PU/t$#p@㤒q灰#@p> XʀA#@a pWQ\ 5_P5_pPQpH8Ph@`WXH-`0SYYYY 0 B @@o#? @ @ H-`0SHZlZXZZ  B o#K @ @ H-`0SZ [Z([0010B0B#[ @ @ pH-`0Sx[[[[0010B0B#h @ @ HO-M$uW Őlp|hh79ON`SQ0vvq|$p pWp!@4OW:0p[ P` N0AVU P 0f PPX@``U0@B D  Ep_T pa R  p NpG`P  W0D R| !  !P! B!Y @2/P 2/ ! !Y2/ B2/! |Y 0@0ЍO-M@R PtPu @ tꨠ D P pP e D pf (0 c0< C0 $ D8(%@Pp `P @ @ E F @ @ @ ( @ hP pY? z D rp8e D kp4 @p) 0( PU!*`aU  0 P  @?0 *@@ h\ Xߍ @ tK-8MM8 P;pP#``p @0 P9pW ` 2!8ЍۍO-MMP`pl@PJ   P)  P/(P rQ/0@ @p^kP{p `ȼ P `pWkW~h Upl~P `p -?@`PTVJPQJ  !o #PBJ040 #P9J0P5J[N/ @ 0^ @P#J~PH  upNP / @0l^ P@PZ` P V ,TJ@ߍڍ   P ` P/_ @0?^@^`{F~ PdZ@`oZ yP ^/Dp P X BA-M@)`PXp+@P  0~+p@0P  R Ѝ? +0@0@ 00NS+@@cP P*r+@P ӱu PO-MPXp+@ `@lhT ±؞ +@24+@QTР ᰱP @X/+ @ 0 ?  0 Р X+@Q ፱ p 0 Z,*P?p  p呴p` TPEXo0+`@P 0XDP`@ 2V _[0@P 0 0RP,  @% +@8@VApERp^1 F7KW0Su #3? @J,p+@#3 @: +@# @ -p +@P  @Bo @P; W +@ +@] @ +@P  @ u @P 4+@ `᷾ 0,+@0Z,pP40+@X/+ @Q ppPRp ,!$ ? <@P+@p TP (p @1嫊 `媊J`$WJ$%`Z:(p$ QZ :!p171(pQ p(pW+@0, `P`Chp(0(@@ @PX( (,p 0@P((P( Py@$+@[0@`Pb: J! +@ 0L  @G +@P J  @]  @PK (@$P@ ^+P@00? 0P0`Q((,`+@0`0` B (X+p@P0TPpW d, p@V @ @ Z @@( ([+@, +@4Ѝ0pSR z / r P{ o  @X+@#3 @O-MX+@@ 0P @Pw ؾ+@0 Tpp  0s 0RpPY?0@`p   6/  HX `+@ЀZ  Ʈ%$ @  Ἦ$ %`P@QPQZ ᦮@P` @  PPP@QC @*ЍO-M+@Pp0@o 0ቱ&"0W$!/+ @ `pS W/p  3R` 0p/+@>` ! (@Q` R5JXX+@P 0+@3?R' 1 Z @ +@R p @  +@P J  @  @]P pPTЍ p+@pO-M`IJ~ @ @V+p@1/ /+@+ @ +@V   SP 0j0PP A  !@ @Vo @gWXЍ`<0p @Z ppPx `pW 0@P X Zbp `@X"  0@  09 +@P  @O @P  Pp W+@O-LMXP+@ppXP 10P 0@ C@ (XP `vp8РW,$@ K@P %0$ !,A ! U pW`@+* , @ P #"A p`, p @P` , p 0 ( 3 @ 0 +@P J  @  @@P X +@P  $p$p , LЍ+@0H-^@+P@!8 ^! F'KQ#@ @\ @+@P$  @@3 @X@# # +@P@  @@P 0- @; @+@PiVO-M(`@,P 0ᖯV` 0p㏯P @h`0P " Z jP`pUЍA-M`p@,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8PVO@W>u%z5 @ @ 0@u?%R5 @ @ 0@u$%55 @ @ 0@@-@,P+@ q @,%,#8P0@u%5 @ @ 0@b@-@,PTP @u$4 @ @ 0@M0H-0@PP 8 R B8 Q   04PU8P0uf%5 @ @ 0@2(uf%z5 @ @ 0@,O-M,P/ ` p@0 QU   0"P  %PPU@@4[Ѝu$4 @ @ 0@FO-MpQQ `P 0Р `@`Z`Q @AT*:`[ 0P `QS [QP(PEР[ 0P:` `Q S[QP p`PpVQ  0 ЍuA&6 @ @ 0@K|H-,P @NQ CP\ @`P'`&P @TQu$4 @ @ 0@Qu$4 @ @ 0@aHG-M,P+ `(pJ,W @P P # "  0@PP pG@ `WЍu%4 @ @ 0@q u%4 @ @ 0@sK-0<S 0 @ pT@pppW@`LQIWPQP@ @ pQp^0 u%6 @ @ 0@~A-MP+@$HO p`+@@  @ 0UT 0`ЍA-MP+@$DO p`+@@  @ 07T 0` ЍH- W+@+P@P  @iP  @q  @PQPQg@G+`@p @@  T SP pW@-G+@@P,Q H-M+@P,^Ѝ Ѝ0H-P@4X0+@X/+ @ Qd0R 0 +@`QaQ 0! 0pC-M +@P P+@^@+P@!s `0n+`@Q a AR *7.@Ѐ2m @; @  @P  @ d# %a, %*ƫ+@PX+@P % @!2 +@ 0OP%  @  @PPZ  @0 %d3, %*㏫+@X+@P @ d AR *a#BP0:RQ-  @Q'  @l  @P"  @s0N+@@ d#a#*W+@X+@P ᶦ0N+@@V @ЍpPO-M@Xx#@ `0DH@`P p@\XTPLHD@ H *(kPlP tP bPP   p X 0 p(@|PЍxb (`@P0#@ ȊP0 0TP$X P\0HL P p X(\$,PT`@pDP P0 S *e @ @P[p ` pK$ #@ᇊP  @ eS p#@  sP PpW:PW @}#@ `P  pk (P$ $$0,   0 YP @Y 0, IPJ 0 a ( I `  P`V 8$ UpD 0 a  B`  R0[" 8 $ 9up) dP*00! @ 4 @0P @ @O-MyP8P`L p@H@@DH@D<40< &aPLP bP iP cP+ q   J pp AP8x (@PH`  P 3 P@zD p DP 4(@2<y@w@ߍ4(@&@ `0$`4 HL0cP @4HpLP<@DmP 0`,PP P  @2 X $pT p( /P'  @.l@ a-.e"@ @0zp4ڔAT3 $R4P `*@PJfp)  n (fp n/ P$%+_ @`"! @t< @`4! @ ! @n?! @ ` VY !A 80?(`"R10@``RP? p oo'@84P-`V* Z V. Y 8$ m0 hP#8P , !$  0 !( 4P , !$   pW @. @+ ``@F$0p" $ 0p p  @ @@ X  @K- @PPpW ` 0`W0 0 0KlO-Mz`P p@@ X%pPpOPp AP5PP fP/x p(@WppP"P` P [P y P  0@pP YpL Y@ @HL(@@B@ 0@l +  0@ZP, @U  06  0 @ ep+ @v @  @p@ @@ЍG-t`P@!p@ $fP p rP@x (@P  p  `P  UA @ d(@G oP^ @ A`W $ | p VP$ n p Z `P$ _ p @z @ @Q/H- #@r0Q0#1"$#O-QH p`V pQ^; ࠠ@P>k6 V  ``?k7 VPQpW#* `  @T pW*@`!C @@ X*`!F @!CC@`@T: G- 7O0@`pWT ?p@T s5T P@0S6 @T@&@T@ @@T@p@T1W1Z:@ PUpP*U p p@0p0@S VS(BឿK-Mp($D` P fP$ 00!  V P> ЍK-MP$Dd' 0 !`   P`ЍO-M p@P  @P  ` @`Ѝ  Q 4 #0@P`rQ "$  R)$HP  !ka 0Q nP PV % #@ 0pP`V0%1 # PP  @ 0P `P   @ 0X PqQ $W,>S  @ @ @  $`  0@ `P [ a P`u [sP@`To T#@ Z+ vP1 pD 0 PPT$@(! @ 0@P [ @ 6P  P qP7 P@ PZ:/Q   @ 0# M0H-MP@ 0/  0Ѝ0HЍ/M@-M@P 0  @L$ LЍ@Ѝ/M-MPp`P. @HL< 800d`@,$ 4(4;T$ĦcMp Zp H  P-$tTWР|p f &@  @,+_ @ @p  @} @ЍpWQ Р [  0`pP= @ 0zP Y @ 0` Ppi 0D p p 0pip  0pFp P6 V0B갤 ᴴ0 Ἰ!  @ &_D p pW @+D p Р  pk @| @y P P ${ Rx*0pqe @`MH-M  00 ЍHЍ/O-MP`pP$ @U P#? "R R$# P PP$ @ 0 @P  @ 0`P 7 @ 0P^ @ 0 0 @P_ 1SS@[ơʁT @ 0}P !p @ l1S SSH L0@  0 ip) 0 P @  @ 0>`A 0 @vP9`ЍP/@-M@BBQ  Dp  @ @ BЍ@/K-@`P p p (@P @ K   p (@ @Kp (@p rLT  @ KK Kw @-@pP jP  d`QP F @ @! @K- @$# @PT0U p`v0PU#&d  PUX 0ps`PUp&q#4' Up Pqv @` @ \$$ @-SN"@R0^\ T /$ T! /$  T! /O-Mp @P T= Pp 㼃 (@`@0 J@T-+Ю} @ :n!0@Pp (@P `@ ` @ 0JT:p@D!@  0 @`J@TЍH-(4$$,0cPO-$MP@P}P  @P $Ѝ 0~- $tX` H0!p *c ga 0 Q0 ` Pp`PZT X0 00SPR  @ @ 0  P QPU`a  0Pp $OPW p 0` pPK pZ0 WE0 P0IBRE#8\    8pu $$Hp2`r"pTp`` H QQP p`pZ P`pV:LP PQ, @JF @*k @C 0&p<  0 0  0 IP  4$$  兯 $@ ` @O-Mp@Q W#\ P@[B P@$P PP`  0P  @  @  @ PЍp@-M` /`@@PR @o`p  0r  @ @tЍp0H-hRLR aR bR,%iR sR tR#P#@ ፀ@P/@P@08 R @E ( Bp @ @8@0p@-MP@Q`/`@ PQ  @Ѝp0H-P@Q 0/@.cQ0 @0A-M@`Pp,/@ N  P # 0RS sS bS SS pW bS S BS R _PJ $$2!PЍO-M` o r 0R(Q0Q{ @pPt Pp fPk P P`P] (QQY R 0#"P R " 0#F$p@ T +0P p8$ m00 pfP/#@ P   P"@ @ 9/$ p)    T 9/$ p 40 @N@PUpЍ@ r#@ [PwpA-`p@_PP  7/$|p  7/$ qp 4 $ @PH- sR iR aR Y p. @A-M@ P $dPp0 f k @ 0`W @, (p0PP ` @ 0PЍW 0㍝PO-M/@@Q"@bP" xQ؀P#p@"@ @`ሴP `V    @PP ЍH-xP@`#p@ P@ 0oF`VO-$M!@ @*P#@`  G @ P !@ PU  `! @EG @ P !@̣ ȣ$ЍO- M`Q 0@4p P   @( ЍLP P0S* @  D  T +#@ "~P$   Mp  $ 0 T0 У0  0 :p S @ 7 @ H-`P#@ }@P p/p@P s @@p@-MP*` ! @  @VDp ՠ @0EP  @E TEЍpp@-MPx (@P:($,4 @$ @{E$$0(@,  @0G @P$ ` p  @aE" @# @* P80! @ @NEP* @JE |(@Ѝp@\ @@ЍpO-DMPP@tp ` @ p@(@ @4 A @8 }fP lP4 r8 1PWk /@@ P  @EPA  RP) # 0E@&Z r  Pp%0S" x (@P8,  @ @ @ p (@Z jr @ (@DЍ 8$ O-$M [ LH P p@`Z` [ @ $Ѝ `  pWp tL @P ` "0# pH L0 %! PP\+ \U& 6\ 0@ #@ !U#@1 @hP@\ \T H 0Lv @UTX $@(`P] @HTPLPX $$ . P 00R 00 P `p`8  'p00' @@T` P`&(PP! H0Z P L@*k !Hr`are B`Q H @@P/@-@$P @O-,MX TP\0R, `Pp7 @ P 0.TPTP 0@$ ` p 0@V  0 0 $X(F P=@T9(P5$P (PR`p;  04W0 `P p  VV VX,ЍRḯV0 000PvO- MS9J4pw60P@9  0 @ P0ޙ@TP p`T +X@ PR (pP+ V 0pp0X @ @P ЍX P  @VX0 P0 ] @ @ @ ` 0@P(  05@T P 0 %$#@PK*h[!Hrare H9 @0T ` \ @@PPT @0\ 0 @0T` 0`0P@T@*h  `Hrre5 Q Hv$R/0S  //QQ/K-P $ ` p@ PRPQ   TXp@-(M@(P`P !` @ P `PAP  @(ЍpO-MP4:}` @دP` UPE @@$GGp0 @@,/p@`(  $lPm@ P$(((([8 !8Po[ʰHP TPO@@#p $004Opꀠ궳 >.p '  ,(ppGG @@ꢳpP,  <,<P PpጳP  @ UpZx (@UU R!UN tA(p@   Q ,P #@pQ !PP4  @"@0PJ@9  -Q & P` 4 0 ,00(00`.`P 0 3/p @V @ЍS @g @ mUp@-}@ @׮Pp '(@P7 @ @ 0@ A  @ 0ᢥi=C P#`@"@@PEua>O-,M@x`P( p@(@ pPpp(ePp AP"fP sPx (@P(@P`;P p F @(@M,Ѝ  $0@p  p z#p@`` $RƱPʑ1Q PG(+@@@ @?@` @ 0O!RR'C 8 H0 @(P P  `VR R R  Q@ R  1L@ 0,p p{ $P 0O @O @O @O @ pi @]y @XO-M `0P W8VHQQ  @  @Ѝ(庨Z @ 0S 00S000S@P R@P @ 0뺨$$0pZ  P0#S:8X(+P@@ @*?#@Q @ 0~B<0 3/p 8 H0(! (唠$DỬ 倀PT 0 R0  pW:@-@RR R R @ R R@@@ @>p@-0@P R CP (pXpSp#S:8h(+`@ @@> pp ppp#@a' @ 0 pK-M0(@P @;px (@P P`P b @@(@ЍKqm ie$R 0 "0# "   @ Q   @o/o"R P 0 y @ЍP U0Zp  Q P  0P  0p Qp 0p(  0pP# p㝯U  0 0 pp  @; @ @+ @M-M`@Q V*㔋\ p @P@が [p@ P@ؠ  `RP p  @ 0F @ X @s @ ЍO-M`PpH V V9+ぜ  @B @ , 㔛B @ @ @$$  N` p H  L` 0$@p 0 @ F @  @ ЍA-8MP@ P @%{` @4 p@ A1 @0 p p x (@P)  @0(@)8Ѝ#@ a @/O-LMn{P`D p@@8<@8,40@0(, bP p qP   0%p% (x (@P8<PP 8< 0S0S @p"`!p P(@PLЍ,0@ D004,p pPp @@D,`P pF #@$uP $$ 0pX P pP pWx @7 @ Y " # # T 0 0 , 0  0 0t@!$ + !(P @P$p{  4pr   @vPiO-TM({H`PL p@sH@ sP  0FpMp qP.x (@P'HPL  0 PF@p5 T  @ 0D$$嬨P`pP  @ D @0 (@PH L0 @  < P  K @ PTЍ0 4 P, P)  $, p   QP @D @0,'p! P @ @_ @`p  %  哒 8Y*`p #@ sP  V  Rp`8倐Y:D p@0RV _(<0PV[,^@p  t  $  ^   D  ^D  ``Y PQ>7 @j@pD <0tP(0@  `mpO  0  V00 P  4$$  ̡   @ @+Y @( @+  0 Y0`  `R\  $@0 `P@ p 4P(0$Pq#( Q0 0 0 p @z @O-$M} @`P p@   aP bP iPTP  w TI TC  p=p NP9 lP3= "@2PGP  0S0S `p"`!p P 0T x (@P  0   ;4(@2$ЍO-gMMn @pP `@  tPa@ Q&Ttttt\t$ttd  pMuP xPIp<x (@P7 P @㗺6P P  0S@T `0"p!0, P @TL P `P `V @ PL(@PgߍۍN , @@" @9 , @9N @O& @ @ {P pH GP`$(@@pP 9  09`pP @P` XX X :`PpP @P` XX X :Q - @9 `P@`XX K@m9 `P@`XX X : G_(! @ 0*! @ 06P "@ 3 @99P *x8! @+0@P^ @*9 ^ @P$9*0! @pH @(@@9 @9$4p## !@ 7pڜ!@8$4## @8`P@`XX X =:8'p$m0  @8  @8# $iI @UG!X :@Q* *! @80 P $0   *$ ! @z  @8`VN , @@" @8 , @8N @& @ @ JPP ph p(`@ @ @  8  8`pP @P` XX@X 9`pP @P` XX@X 9Q ]8M@Y8`pP @P` XX@X 9`pP @P` XX@X 9 m`P@`XX X {9pWD @ P80$$ @0$$ @(GO! @0*`! @0P G"@ 㾕G@ @ 7*0! @ @78'@$m0  @7+ @7# $c @I @MPA-MPP8`@p4@ht8 @N ? @7 @70 PA@@$ S 0@S @3O @^ @7k *80! @ @ @ЍA7` ? @~7  @{7VWU *! @ @04I @Cm @{ @ЍA^7 @[7#(/ @'  @O7PP( @1* @! @S & "@ЍA:7 P8$ m0D * P0! @*! @ P0J @!7ЍH-M0P@4p b #*! @  5p  @07P  @6 6ЍG-HM@#@P*` P  @8` @4 @p A @*H0 5 TP p lR* T"  QpT$ pT 8#@ nP x (@P$80 @ l(@yp= "@PpHЍ a @/G- Mp@`P p@  aP bP iPT  A T T  p(@; ЍlP= "@p PP  0S0S `p"`!p P0T x (@P0  O-LM4p sP㴐`8  000<0尔,`dDEF$8`<@#`@ P >nP 'Z48 ӓp+lP8`<@p#`@P &nP p'W48 廓pFGI0H ! @Jp4800 p,pK`$` 5LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00E @ @ p`Z P 0 QQ1"2(p8`p#`@@儣P p'W d I(. 0rp 0O-lMP# 8,p#@ @P0  @ ` @ @` `` 5  :/p'WlЍH-8pQ@`#p@ P@ 0F5`'Vp@-8#@ A@@P` `P PP@TRp0 p@A-MPP ( @Kp `p @ <pH PH WK:pW@K0`p 6c s0( @=0 4$j SM0pgM0V02: 8t@00A8p =1@ "86 0p` P p0  P` @ @ @0ЍG-PMP, P@ P @B @4p` A5 @ @/@Hp@p p UP p#pp(@PЍGMx (@P- @ 0P P - @ 0:(@2PЍ0H-X@R+P@ P  ` E+@' e @0@-@R+@+@ `8 @O-AMk ]dpP@@ `@/p@ oPpx (@Pw`P $$rڦ@ @XP PX p"@ @@PMp TP 1P P `Pp@p `@PPk =PS  "PK !  @PD ! @P= ! @P6 ! @P/ !P "@P( ! @P! !  @P ! @P !  @P  r/  @P >  @P sK  @P WpP 7P @@T Wp厒 @`P"@  @P  @ " P i @fP *80! @r  @ P P rڵ @P  @ PgP P $P` @P Y  @PcP `*! @0P "@ P @*! @0r @ Px  "@0Pp   !@0Ph  s @0P` @ $m0P  !@PP PK H@$ T: @^P; @ @V뎒P`"@G pWP@ pk @㟠P'  @t3P* Pbp (@XU C`(@AߍOcvY @ @`m @`ip (@X?` @ kVAߍX `.&4 @ @ 0@ˢ`%4 @ @ 0@¢`w%5 @ @ 0@ṢO-AMk U@p`@ P@/@@ iPp FPx (@P$$0(,实PP`@p P   @(@AߍO o P  b @k @P @ PE  @|P $$0P=  @ p$P9 40,P3 pP @ "@ P( X@ P #@ iP P "@:P  H !@3P  P0 TPH8 LP ,RpP,P4$!P,  06pp 0$4P  ,90$S0Z8##!  8P $$8, $RZ @P "@P ,!㏗ @P P P ,s <%(vP@ @  @P ,  @P   @P - @P   @P `P "@ Py   @Pq  q/ @Pj   @Pb  ! @PZ /r/ @PS P @ > @wPB Ks/ @pP; kPj,0U*  0S! + $$,[$P$$qP @KP^ 8 0( $D`兡P | "@P |NPr| @P |$BP  "@)P   !@"P  s @P | !@P |$ [, @P !R$, @‖P$D0 ؚ!  4$,  P$8 @!1#!  $,  P$,@ h `8\ <$0( 0(4P,REEIB DPT4H 8 0 BL PX\0$$y! h $$,$Pa,@40 <``8\a$4#S#V! H $$,^$PApY @ WpAߍ @6 @1  @s @B| @ $p,wY @6 @ @| P @ (# @ @0A @` @(@O-$MMP @ޱP ^Y <#p`+@ۜP QQ84+@o    /P !@$㔌 @.p P`fV Q$0P 0oQ a` p(P  p  @.`<+@ 4   P !@$U @.v` PpgWП  p$ @1t.` 4   ĕP !@$) @\. P' @. @P.V   .YY㟲$Ѝۍ' @ @B @BG--MPHpϊ @0`x7 @Pt H!h @pd @H+` @Ll@ D  <4,$H@p8`0@(@ PM  ϊϊϊϊ1ލp@-M `@P6 )  ` @@p ' L|p ЍpCO( @ @QB] @LBO-M@`pp PVP pv r !@0P Po  @'PP eP @P ]| @P U  @P PhQ @ puh  @P ohZ 0 S 1 pv P P P @A[  $ Q 1  [sU  ,0(S 1Ǔ0P Y  4Q 1  Y  @AHQ 40L S 1PZ @ hP <1P l 6P 0 S 1@ `p$@ `p p R 2/p 8 Xp ЍC @ @ @m( @^A\ d !@VA\  @PA @ AAK-P! P P pP `@ P PsK-MP @ @P ``p ! p @$P@TЍ   (L p ! @0 `H-M! @PЍ@-M@p ! @QЍH-@PP pPc?`` ` ἒDtH-@PP pP *` ᦒD^:7?`H-M "@P 'Ѝp@-8M@ @PPI S @oP  `+ @+ `L H `+ @+1PS @ `V q 0p@0 P PS @ @D8ЍpP)= @ @"0@0H-MS@ @P PNPU ` '`H @+p Ѝ0M)]9 @ @ 0@Vڛ @?@-H +@@(@H+@@@@A-(MMA.P0 C Lp P(Ѝۍ@)7`C @(P Y P@3+@P$@) @C(P Y P@+׏@P@-M @@P  Hxp @ Ѝ  != @ @"0@^@-MM @@P H WpQ @ Ѝ H!= @ @"0@=p@-M@`aP @ P uPP PP  @P Ѝp \!= @ @"0@  @)?k @ @\! @?@-@ @P  @@  J; @ @"0@0H-M @Pp  | @P | @@Ѝ0  @ @> @>  J; @ @"0@Ṛp@-M@ @P `AV*P P @ 0p  H`PPDXЍp @> @> @>' @>H-Mmxi `LPpS @>pIPl @{>@ pp @m>QQXp!P@`W ))p`W )c'O-4MP#@ `@+@@ T @@`P0⑬p @3>D+@pe @&> `0`V{ T(@o@堲 PpW`VhQ pWQ   @ 0"0 PP1/PQ 1/P @+@P p p `0  ! P<W90`VP0/FeDL`I KCPpp@pp @pp`W P `i0v& Pʏ: ;CPP @`W@`R7"@=p@-M`P@P  ^p4 @ w=&0H-P @!@it@P qPJP 0  J; @ @"0@/ @K=0H-M @P$p  @?P 0  @ @@Ѝ0  @ @)=  J; @ @"0@p@- M@ @P O`P P @ 0_p  ``HP`p Ꟛ` Ѝp @< @< @<p@-(M@ @P)P. Pp$ $ p0  `q ``Q 0$` P `3 @ R@ PD(Ѝp  = @ @"0@f႘0H-M @@P Y PH|p qڸ !0p@0 fpЍ0 != @ @"0@CP0H-M @PP  @kp !@ @@Ѝ0p@-M`PgP  @'p4 @ @<bO%////40(@0 /<0(@0 /D0(@0 /L0(@0 /T(@0 0/0H-@\ (@ PP P00D PaD"P# *\[(P@"?Q: ADPP*@0H-p+@P0@ Q:a@QW@ A@Q=@H-lH/O-M(`  `T (@P P(+ @p@0PPU 8@ T wp`_0 0` p$P( C AP (@; p @; (@1 p @;(@ & p @u;4 (@`V 8v(p@ `V7+@X6+@\8+@kh (@(@Ho `@P@  pVP BWCW NWI8+@PaG QsGP(tDLEFtFFLELEdF=+@PGAW GDLEELELELEELELELEE9+@PwWW/@!  D.+ @Q p lW+@P`WFCWY LWM vWFmWH sWh (@Z (@(@Z;+@P<+@P+:+@Py?/@+@P!  㴏@.+ @Q 6+@P7+@PY>+@PUaW lWQ(@NwW zWJh (@Z (@Cꜧ(@@ᄧ@(@;h(@6<x +@(@P   ?>+0@0S0>=+0@0S97>+0@0S6>+0@0S0?.+ @ R-+ @ R$ $P  ?>+0@0 $0H$ 0(0 P P' @) ! @4:b/@"@ !:$ (`@ pB @:$PP PP PPO @Ey`p` pC @P @T (@P V k) @! @ R ) ; @! @ 0@*ẕ2/^"K-MWPP'" @ @9\k@(`@mĉpLbPp !@ @ `@(@㰐W0 @0  %L (@pW 1/pmP` @  0PPP PP%"T (@ R/0S  /0H-M P@7- @P  !@eP  pp gH > p8 @Ѝ0 %!J; @ @"0@%0H- M3@ @@P Pt P{ ` u*` H @*@ p Ѝ0  &0 @ @ 0@iH @9H-  @H- MP 0 A A0H p Ѝ @9H-M H PЍ' @8H-\ (@PO-MMQ @TPDd- @ @8\`$Pn`<+@Y[  ^<0884@0H,P(X$` hpxp p(@P`XL P[  PJpU P@ ! @ P9 9P+@pP1 :+@P)>+@P" =+@Pp0 LpK p P `P Q #P凶pYH`p T\`(@Q P QD\`D pX NP p{- @1$   @ #  pT-XL *p Q  @z# @T   Lg pQ $ @d# (# p L@P 0 :^: P@ -  @P p E#pP< : ^X P@P p,#pPD (@pW  2/pTP pf@  Lx P @# ` L  p @P, X L䤍p% % @" 7p+@P an"L > $&p R @#@3 @"\嚯 @67+@+@ DP 0\ 3/<+@^o F6+@L PX?S pP@ 8!@"@ ` O" @ "$ ;+@  "X @G @l"4  " @G @\"  "b @G @L"  m0 @C"0"@ ` @" 4" ;+@  "X @G @",  " @G @"(  " @G @! !< (@`VD 1/`T \P(@<`+@V 0 3/`VH`@PP !\`1ߍۍ @W6C @m @, @/ @J6 @E6  @@66+@ @ C @R46H- MP3 @@`,P l `*` D*Dv p L    `*` D*D@3 @ PfE Ѝ0H-MP @Z !P@P%  #  @ @`  c!Ѝ0"S  @!@P@PG! @ @R!Ѝ00H-M P@㛒L poAoЍ0p@-M @!@P5 @P n @P% @P LH+@P>+@+0@ P 0```7L `{ p Ѝpy @5p@-M@P%!@  ?P  @ PP 8T` "P@ EQO "@@P Q  @ ЍpK-M@nP PP(p pP` @$ AV8(L Sp? Pb P @Dp  @ "@Q !@ "@)I  G PJ /` @z 8#@ 0SR2 R "@j 3 P᷑L pm @TT /P @W  #@B @ QRR TG P9 @D < @c7!8"@!@5  mP& u P @ @ p@P`! RQ/    `V UP:Ѝ臠 @4C @ @4 @{4 @$ @t4@-mjPTN+@@@2@L @a4p H(@0Q @㟄@-M@ @PL+@? ?@ Ѝ>%= @ @"0@p@-(MP`MP2 @ @.P L+@P  @$ A8 (LpP @ P L+@(Ѝp @ 3 @3% @ @3 @3H-@ !@P! Ln@+`@p$PF:P P@pO% @ >%= @ @"0@ᚏ0H-M@P? @0P3p@-M@o5 @P" @P:P Ln@+`@ PH+@PuQ(  @Ѝp>&= @ @"0@Wp@-M@9n @pP @P9P Ln@+`@ PP+@Pu Q(  @ЍpA-@ % @AP L@+@p}Po9P P@Dp `>"&= @ @"0@2-! @VH-`P @Pp 0p @AH-M`P p@ P 0P P  0p ` P xu ЍH- P Q   Q 1/pK-M`(P ( p P@p:I"Q P @Ѝ UP1" P , 0 qp `  O-MAT$' Q eP Q ^PPH "@㢾PPHpUpPW Wf Wh W PЍW W8P Q"@ :Ѓ"@PPQ /uP( P $0 @0( DP,pP `P$P( [ ᓜP (QJ VH( ( 0`P$Q? 9`_P`ᢎQp0 :R Ru a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0@xP:iOPP `V  X Q QPP:6"P UW U3>P 0 @AP3Q0 !P-P* P(  R$ %PP !` CRp P`VPP@``P pP L$@P `V  0pP PP `P P@T  PiU P & @ @0`0k @ @& @0A-PU `@pP:P  0p ` v O-M- MPPU͊J @pP%  0`X6/P' P)P `半 aP D  ͊ XP  0}pPPU[ [ !W P P D  ЍЍp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V @pQ *P 0P -PᆉP ၉P `V궍Ѝ @(@Q QQ Q R-0qqqqqq l$P P0 0  0p 4 m  @/p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP .# @p`$@ H-`P@pP p#@PB @0H-@P0P  R$ Q  0H/00Q /  Q /K-p@P`P QpU P `PUP QpA-p@(`jP P#@ @p PA-MpP,`KP @$ ( .$# @ 0 Ppo@ЍO- M0Y$ P 8P J 4Q44 Q Q((8YP Ѝ`P$P Q(`2O- M@40PP*U( `@p HL 0[*  0@  4/PFPYU@A   @ 40 B| |LB! 0 [#*U! @Ap  0`6/P@ LD 0[ *PU, D,L 400 ЍK-R P@`V`V p6/sy P@T p@-@`PP P V  P PT O LH뒋 PpG-FM@ @P @U`P  @ @` lw@(P  R" pF`↊ Ppp ppPƘ JH @pT @/Fߍ @-0H-\N+@@(@Y_dN +@@@Ul^H+P@@Qc0HiK-NMMP8@+@`pF)e(a<KL XW `p/ ) + P*(p) 4`- 14`JO ") 0P ,*0* 0Q,U1 d @ @Nߍۍp 7(@0~ @w}H-I H4p @$-p@-\@(P@tn+`@P p T p νT@ p@@pO-Mp@(Q0 0X / ( @ xQxAo@X; `xPW |P6Z  (@   % V1* / ( @  W B V)*@0 H (@W@0@@`X ` @@p PFP@fP @ @0@Ѝp@-P@QU 0P  (@xQ  (@ 000  @UP ' @@UQ p@ @Upd `@PUpp@- M `P 0 BP B P$P `@P`@Q@JV:Q `  R@P P`  +~‰P ЍpH-p@Pp `$P   HG @+ @+H-M pP`@ᵈ @ЍO-MMMPi Ppg `K/pe @Fᙈ u<u, @"p@XpYI @'P= P9 pp } L $ƽp! !@ !P 8 +@ 0/o004"  3 c~P3P 3 !@% @ @ Y,KMߍۍ @C @ @( @i+H-M`@>p pP# r pp ]} L ip A@+P 1 "@>+@1P ݈/PtЍE @H-<.+ @ RU @HA-Q P`p@~P PP`V@- M  @p n @EP 9 Hq @*ꋈ Ѝ~( @ @*@- M  @mp+ w @P   tP n @ P 9 Hq @*P ЍC( @ @*0H-xN0+@@(@[aN+@@@W^t+P@@Se0Hk@-M@ p QP (P @@ @ Ѝp #(@0 @zH-P`@PM @sP  @p0P (@U @9*:L Ep@-M@6 @ᬶP  HpЍ @ *. v-= @ @"0@N@-M  "@@PP  lpЍ5 @*. ,-= @ @"0@Mׅ@-Mg @@1P IMpЍZ @). P-= @ @"0@Aḅ@-(MP@  0 A  BW "@p L p(Ѝ @), @ @)0H- M @@P Y PHp  p Ѝ0 @). -= @ @"0@qe @)K-MA @<pp v` `Hp\PX P k @Hf#EP@  @ ?nPXp (@ :Q0@\Q@"p@0 :P3 @` TP  @+) 0@$P AAqX\PH 8H q @ )갆ݍ- @ @( 0@-0M/ @0@Gp P  Hp0ЍG @( - @ @ @(p@-N+@@(@P`(@N+@@@^ +P@@yn  +`@@w~p@O-M-MXP@Pϊ$ P8(LxP{p` h` dp@ⰰ ϊ 4P  PPLϊ ϊ NPPyp !R* @yVpL+  Dp P & @7+@P 0 @ .p P 9 @7+@P C @  p ) QN @7+@P V @I p ) Q\ @7+@P e @{P4 y A8pL  J IpP , Lp^ x @\PS  @UQl @QPJ` ᐋ(f@px ĀXQ@ppP? (0@0   :R P  @lPt @pmP `@U ,Kq PEoP !@ @PL mp( , Lfp! @#@ K_P  @Q  @ Q  @ލЍ @^ @D' 0/p (@0 @wH-M P0 CHpЍG @*'H-8MP  A( A8Hp8Ѝ @'O-UMM8 L@p+ ] " |p&P [PJ+㓷PJnP PiP +ㄷPZ  @iᘷg  @c,  @^ P?n A0Lapڴ(Z:@ p!0(  P .PP`@pG'W& :s"* @ 0@Qi"@ @0W: { `@ @ 0@  p@((Z:`Sせn⬁@#P@ @(@!0!     30AS9Q 9Qg)  00  0d#A, ,L",@Q  0ppS0Q +@p@ 0+@EPPP0IPPPcP+@PCPPPP+ P SP @P@BP0PA P  0 p (@ "W7~4` `Z @+p@. 4,!)PPa4P 0 @pV  @ @0a1Pe*P8 0P>!@ @@TP   @M  @G`D@ pT ׺8P @"@ 7멺PEp @UaF଑@@FPU% ` @/ @P P /"@P+ @* @ + @p ! @8"@ `F@ @VK@[:  @>7~+p@2Pm P@T:@P!@ @P   @N  @ D pP jJ8T `@ @@"P@,9 Kp[@,II@P [,` P@ @㬑@$  @P !@P "@P+ @* @p ! @8"@`F@ @V,K$@Q' cP\  @ @@!@{k㩚T!@ `@ @ DP!@ 0  iQ@T"@>)㬑@`Sk#P@ `@5P k  @7P x @0  @`F J@@TPUUP  @50 @  @.@TP>P ` W @P   @Q PB@QN$hhhhhhhhhhhhhhh ,8DP\  @T:@PP2 P !@ @P $  @|Py  @s@Qi  @|hؠ  @bP^ PY  @[㬑@{P*!@ @PQ I  @`Z@!P@ 0p"" 0  p@T>W7~P `+p@㬑@,  @%  @"  @  @  @  @  @  @  @  @  @  @  @  @ JZ 4`0J`'ZP*3Q  , f6/O3s2"0r R 00 , C,L%"^#Aq, !ɠW%#Q:A, A,L"KUߍ؍{ @# @#@- M P@ 0 C@@@!H @Asp  @@ ЍO-MY ppS   A^Q0S  l` V..@ЍOs  @ l`W JP:PJ@` @  `V*E@UPH-`@!@Pls`<rpfoWpfU W `ET P@oV `FpWP-X>HU ` Pp !@/ #@/ @+@` Pp !@/8#@/@-M @@P  WЍ. ,= @ @"0@~@-M: @@ȮP  ?Ѝ. ,= @ @"0@~0H- MY PH@p  @ᨮP  q  @> Ѝ0 @". ,= @ @"0@~O-dMܳp` @%n"@ypx @ @`zP mdp P < cPp <Q  @ @dP (@@ @  a p@ P @ 0P@ p`R @ 0``H @ B4 00,( (@ $P`n 㾲<@P P @<` ޲ܲڲ X `T\T0\`4jp Q+@(@Q 1/dЍ @  zq @zPvA  @@ճl+  @1 ! P @p  !@@ 0@C  A-hM:P+@(P 0P @ D@(@ 0ip( @ @@P(  @T@3 /cp5 @Pd ~㒀 P(p@o @ lOp PP8 P5(* Q%P Q Q% ( ~ ~1 @ >OP( ~ ~ @hЍ` @PQ P PX@d`\X @O @@PP @PX A @ @& @ P0pB !@@   @iT4 Mp@-M,Q, @P`A o``` `~~QЍp@ Ѝ/H-+@ R00@-@h @-PT(@// Mp@-M@Q P`A?Q:\~P"1QЍp@ Ѝ/ MH-M   G7ЍH Ѝ/@-M@+@P 0hp @ @Ѝ@-@Kp#@p pG  @ቲ5  @Ⴒ MH-M    ЍH Ѝ/ MH-M    SЍH Ѝ/O-Mph Q @`@ P@/@ fPl@ Q! 砰,P xFP RPR? Ph ` gPf#Q  P 7P&  #Q  P y6P  P 9  tP  @*px [(@6 +@P\ ~H+p@㬓 P嘳 !@@ @ @U+@`P xP q q  P `XP PpGPG U*㗰@ᕰQ @pP cP bP  XUp*^ GP*U8p|  |  P|P! UZ*@+@[+@+@XxP X Pp ZpP P  !`  @  6/ R Y@ U@PW  0:꺯p3z|PdPa ҰP `( `W H`L !(   ᭰V  0 Q P ᵯꆯp4ڸ qr ᧯ps  @Ѝ  @ . l@  @w  (@uM  @i*  @d!@ g   @Y!@T0H-{@p (@P  @}   @ 0n}  @ r WH-M 0(@ ZfP  +@R  0(@HfP +@Ѝy!@@@-P@@O tP ^  60S4#0@4#0@4#0@0H-M  @0(@WPЍIwP 4Qqs0#4 S 4#@#0@ Q 014#0@0/H-P P&@ #Q \:4#@#0@\01P Qq0 0 S:4 #0@ @ ^14 0@ Q 014#0@0H-P0S\ 4#@#0@\04#0@0P S \ :4#0@#@\1#@/@-P@O0$S@q Q :#@#@#@P   #Q\ :4#@#0@\014#0@0/P   #Q\ :4#@#0@\014#0@0/O-qMMp0T  #@` P@/@ 0@ cPd@P甽DDDDDDDDDDDԽD(ܽ̽+@&AP 0 aP# 0@@+@@@ 0P BZ  0pzx (@GPY Pj PoY d$P |  P `p@@ @`(uP  uP  uP P "@P P4b @uPP(N   P+ 0  000 000P` P `Z @fP !@Z'4PAU `Pa`P `PW`P p @uP @~uP  @xuPpb @quP U =P(8P( pP ` U +`P(%`P( ȀpVP b P @ BuP p P`  uP   A   ~(P @PPl( P(P@T`gNpp$IyP}'P+d/mPPkP q Qr'P)pp, ^z+P@D ᖭP e(D ፭(Py kPaP:a@P !Pl#@QPPU#@ 4 0 0`qߍۍ=  @13 !@2  @  @)  @ @  m @0H-MP0@U {  @ KЍ0H-Mx p  (@ @0#G-P@pnQoQ Pp*Q"@P Q@"@nQ`oQ ``;P @PVK-MPPp`DȜtP tP p`VЍO-AMM  p@2P $ ,(IQ $uT  @TJ $f  @5PPP/P@ 0 PC `P) @P9 `ȼT P@p  ȀZ  PY   PW @TP p  @3$@$  "@7Pp $!@   $@ $@ Z$"@f#`@ZN =pᨠ@yP  @ V P $L @P % @%/! @B 0 "@$L fs@( TB45 Q"@` HP. Q㘎ゾ@p@P"@ @EWM`PP -P =Ai@T pA @Pppp P`4+@`+@o 0S0P $ @w VC`p"@@pV [ (p* @B[pJ @P $ P [P- , 8i v^[`F( Pc P(`FP ةPVP(  ̩P[p (@XY Fp P PQdV  @$ P @`Aߍۍ/QP#`[P <p ^`+@P   @ 0 @pSp  @Pi   @lP[ ( 傩〩, Ip= @G@:aN㉎#@`^ B~"0@"@@ @ p7MvP  +0SBvPB] @0ỪO-,MM`ᨀp@{ @ 0PG !@OXU @+@6 Ԅ$(`8d#@"`@@p Q Q Z PU f P:U # E!@ @  Z  @0(`$@pP  Z  @⊺P !@ !@PI ' Z  @P> Z!@ X`Php  @|  @vP4  0@,0 0  @ FP ,P , gP,  @S  !@ԃ,Ѝۍ F @ @Z!@,ЍۍOA0H-Q  Q @P(qP Q+@ +@0p@-@P5 nQoQ2 8P# P ,R R\P @P,gPP ``,gPP  "@@@p+@ 0H-P@0H-MM @  P0 $(* @0ᬨp,  0 @D @ @(|# @J.EO-Mp`P@s /@ x (@PX |‰ P@/@  TPe@ Q$LHHHHHHHH0GP MP4xUPgt  0#@PI px (@FQ: `V X  X  V `p!|ZYppᇨp Y4tZ8xV V Ѝ !  @rj!@ lH-s p (@ @s0H-MP @ RQ pЍ0  @ 0@@-@ᘶP  @@@-@MPA !@@@-M @Q QpЍ  @ 0H-P@r.P /P0  @+  @0H  @ 0H-P@90H-M @ P0 ) "@0Gp sP P   P @ @? @xsV ( 0 @O-MP,px ((@]h/@@ @/@#`@ |oP 0P px (@EQ A O!  @H-s p (@ @0H-P@-P /P0  @ +  @0H  @ e0H-P@0H-M P 0AN ( "@0ᨦp rP P   P @ @K? @r  A> @!O-MP,px ((@]pj/@@ @/@#`@ oP 0.P "px (@EQ A O!  @H-tr p (@ @ 0H-P@3-P /P0  @k+  @0Hf  @ H-0H-M@A 0P" D @0p  @O-M,](Pl@pP @/@#`@ foP 0P px (@DQ @A +]ЍO!  @oH-p 3(@0  @ds0H-P@,P /P0  @+  @0H  @ H0H-P@{0H-MA>@ P +$ @0ሥp,  0 @ @ @.# @' ,<\!) @@O-MPp @0pxj  `@/@ LPg@Q!DTlt9P GP9||||MP( UPw| |||` #@0Pc || ppx (@QB0Z S  S Z `PY`[ dp( [<pY@tZ(Z PP*$||Ѝ !  @?j!@ 9H-p p (@e @[@0H-MP @ RQ pЍ0  @ 0 @-@eP  @@@-@PA !@@@-M @Q QpЍ  @ 0H-P@?+P /P0  @w+  @0Hr  @ 0H-P@0G-JMM4P 00@ 0 H!@0pTk4@Pp+@!`@PpKPVP S QP0 P U0 0p 2@G Pʎ!# @8P  p< 0 04pKeP Ii @ <0  @`p @D L0 T T @Xp\`t@T$@p `Jލڍ,  0 @IYp@-@ P PP p@ĺ_+P@`n`p "@)9O- Mp`H@0n(@H !d˺ TP @+@+@ @P@A@7P8Hp$<L\x 2PJ 3PQPeD/@h@ I/@^( R/@P(@ (@}a/@;8 sL+@mi eg/@#P_4P Y@UQ /@0#@P P L+@   @B P  P  @ (@    @      "@X + @  >"@ $   @      @ $   @ <    @ 8    @ @  !  @ , '  @x0 r/@X$t/@J, w/@= ux/@30kP bpx (@GQQ0`+Y4D  Ѝ!  @SH-/  @B0H-M@ PQPЍ0K  @ 0-H-Mm = @= 0@ p (@ @Z <  @ @ 0@ J/0H-P@p(P /P0  @㨽+  @0H製  @ H- RRk  @A-M`PPJ ֡pPJ@@ RR0 㤡 ᆠP 0vpЍk  @H-M` Pp0@ 0@RQ 0ЍK-M`p@PHp? 0 4pP< H$0+@0p4O76oB048 AB<0<" A@`@IH@~p P 1Q 2/R  @ @mHЍ @H-BM@o^% 02/ 14 10>p p0@ 00 P l帿  @ @lH<Ͽ BߍA-MP@` p$l UPH +@2/R1QP5_U @4Ol@l0  @ @ lЍ2P(0/O-Mp }렆P `@@ p{P`DH @0@3/pBrlP=p@\WP ` p@y+  @0 3/ qZ㋐r :P P TYR*  @ @03l<ЍO-MP`+@[ W@^P @:`Pt @0 PPP0 A,p C!@ 0UeP 0e ( @壶` PB`t@ $T`P@pp P/   p8 j f^p P p! 0x5` D 0tp PQ 1 UT+@P,` PkQ p @㔻P/\+@TtX +@Qyqp +@UD\ +@000  PߍO-M-MpPP$ A`0@/@ KK  @ F/@ 0@00@ x" Ӛ( @ @ eg@Qo`XXXXXx,PXXXxXp p#@ 0P @s @ P x  @ P pn  @ }G 0SPk@ e @ oG 0SPf@ ]I Z  px (@EQ$A+SV@  p9 0<S p@ p(00Qp0 ЍЍ' X @!  @  } @ W @, @ @   @    @  BH-Tj p (@  @0H-8MMNA. 0P$ ( ] @0 p4 @-  @P@  @  @(P  @(( @0, P  @,( @00 @8Ѝۍ0  @p 0H-P@0H--M  @0@GP     Ѝ  @G 0H-MP @ RQ pЍ0  @ 0' @-@P  @@@-@4PA !@@@-M @Q QpЍ  @  0H-P@Y$P /P0  @㑹+  @0H茹  @  O-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4qJ"X32/\c3?s6o7"X3\csJJ0 J ??h J p J p J, p J$ 0p J(0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,eJ@ 8p |J< Hp uJD`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@PZJ UJ!PJ!KJ0A-P 6J$`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `PI!I"I"D`6oD`I#@`6o@`I#H`6oH`IL`XLL02/3?6o8<\1L` X`\p `` @p\8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x SIU @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,M0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+[PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUOH ۍK-M,(@ p@QpPp  PY`f VLB Dl# 5_ P vHP PO'a` 0 p Ѝ Q 0P #:r/ Q 0P #:r/O-MM(p[/+@@xfw @㸱,P+@ PP v @[bPpGPP {` @Q `@`840,( B@4Q  $ $ $ t $ 4 $ $ $ $   $ $ $   $ D $ $ $  $ $ $ $ $ $  d $ 0 $   4  $ $ $    p L $ p $   /@!@@aP  @aP /@@ᕪPe m!/@  Y @0p+@@/@@ %8P !/@   @0U+@g/@@P? !(@+ @0oP c h!/@   @03D+@E(/@ *B @0#+@5/@+@/4 >(/@  % !@0 +@c /@  ^ @0 (@ A /@!@@XaP   @RaPB$+@ 8+@ q l/@@P $P !/@  ; @0H+@!/@  4 @0((@p >(@0  @@W4+@@ /@ @!@`P<+@@  @0 (@ 0  /@  " @0k @/@@(0 @,[@+@@ | !/@  Q @0FL+@X:/@@+@@EWPf/@WPaP +@W/@!y0J 0 @ 1P!+ @ A (@o fy, 4 !@q`P.  "@k`P +@'$+@"   @0$(@ 0+@ (@f 1y( +@   @pIx (@(@@P#$+@P   @  @  @  @!  @ @- @*pPt[oQYc+@B AG@P' T@P# Lb! 1 "@ @ 0@n @ h@  xw [? @×p0 H @^z!ccp* P@Q+P@P T0P8A+@+@@ p R! pnm  @3@ pZ t @;z P"z? @ PA p+@@$ zp)pxP!P+@@*@z PX!+ @; PJpzp @X!+ @@Pa+@+`@ ?]@P@[ot"  pz ޗpb @v@!+ @ ?]@PP+@@t6  @ P  P * [ @0Y$p<4P$pJAQ+@@+P@ $RQ! +@PP`+@, zPp}yP+pP*(@p+@R x  P& @P$S@+@ ?!#$pP+@ @ $@(p  @Z8+@$PX+@ ԕp$# @BLP 8P  @ paP@!+@+ @ b7 'P  @ 0Py$@V U   {`Vp V ~p\+ Q +@P a+`@P  R>  @+pP  Q * @fa+`@P(PH+@[oQ (@P Q+P@P   $ @ @ @0@D+@Q!( @0 R01, ( 80F@w W Cy ?PU B!^FP @p4w @㳴 ꓖ% 0B @d뤕!"@@P+@+@\%+ @ p @ Btxw [? @㥕paU% B @d0 \@pfs@ȀB_<`  'p1 ]PZ  P P  1p% P<PP  B/0 @pP;P @0  @p B/ @X @@ @ 'PT)`[Y p OK @0 PrG@.]Pz  )]Pu `F[Vy pPPp,([o+@+@+@A+@@ ?R X+@  kp#@X!+ @@+@X5 Q+0@RQ  @w @PPs  @( @d  @ 'P  +@ 0Q +@Qf[os@ PK X!;#@+ @0@ X! @+ @ 09[oP[o4 X!;#@+ @0@A-,Q+P@@`TpH (@@ : @ 0@Nk @J@ @ 0p]S刋`@P#@P` 3pPWO-$M p`` `  @Pp0S$ P PaSKC P 0t& T& p& T& T& T& T& T& & l& kC P0t& T& p& T& T& T& T& T& & l& \PBSP GSbSP gS   @0(P`\ ` hJ` 0Xx 4 hpScQ7VQSVQ"R. ! *@PW 4+@P-   @ p` HL Q 4!+ @ R! 8  @ p`$Ѝ  0 @W  @ 0P @p` 8 p @`  0>O-M-]MM1",P+@+@P? 8+@P:@+@\+@T =D`AP@` 0P P`{<p p 0P P`p<p D 0^<pp Wp  deP+`@| @^ hP+@q ^pl+@ 1(@+@+0@P 0P o %x ,< (%(,$((@(@Q   @%4+@Pe @P   @4+@P[ @Q+P@+@ B0 4 F  @4+@P1 @4A o @4+@P' @4@+@ Q @4+@P @0 Q * @4+@P @0Q ( @4+@P @04 Q @4+@P +@@TU3UE3CD @ @ P*0\PB\C0\@+@PXP$(U+@ XQZ  @X80PP$0 4`@BRFPfLP_ȟpbHpP@0pS0PVT0QTR@P`@80pS0 P`1r @@4+@P d+@4`a  0Pp8p@+@$ϊ`V @ T  @ P㰁+@Ѐ pdY4 TQ?Q8T'QQY!Q (@TYAd@Q3R: @4+@PA d+@@+@4U$8$`<4 0pT @1<0\@'D00LPx |`!$ 0X 0p!( '᧑x 1\Uta F? ;X 0A0E HP? /XE_( P $`@]F $   y9!@P R!1R@dE+@@ @4+@P L+@P x`8@XP8<@P"H+@xpT` 8q0 0a2!# 0Q0#Q0Sr<8 # @P0WPao 0A@ԁBP 0 0PP*!0WPP0Aaq.W:`AyXtP@0 $Q!1Q 0o.0!^ `Ñ!~1AQ1`  0R\b>B boQ"\#Q 0O.@0!.` ` 00 pP0pU0p0 AB0AQAPaqQ!ȁ!!! 0`A PQY# W1I 0.W!0B@0'WW` p0qAPD\@@ !?>1``PTf_nQQ 1 0 `1 S@1 AR> V 07A@ \` 1aT܁/ !R!!܁P!! @54+@Pd+@p @8<$x`I`p!善e0{WP18 X? $Um?H$U,0To`P`1p`(0@`0L S|尐4? @ 0@ @8tedU+`@p+P@ 4[ |+@pD+@+@+@x5+0@PpH54`+0@L 5 +0@pp(@@u<VPD QTD!h A? ABXD@HE *`0 ,p B<4q 841 S!` 0PY2 `ɯQPYSQ@!8@p@!U D0QP@SppD? Æ $O0܁PSSP0S4qP DTD40t(@Q H( p0 $T+@(@+@P ^  FK P1A Q dZ0 pa `Q 9w0 qSvQ @ ! P `0+SdU+P@@ 8   !  b!+S,pk @`0,+@  P05R+0@\%5+0@R| d@P 0+@@ @P7p+@e+`@+@P  0@ @P7p+@ +@Z8+@P{PA+@@ r 0 @4+@P +@0R@!+ @ `H#@pJPHE@T`VA  +@P !+@1L@+@ +0d+@,`+@|>@+@@ dQ+@  L+0; P LY@+@ +0@+@V.PN0+@P @ PJ+@ fYP) @hP#aTiA, 0A/r"\uW A0 0d/ 0`13 0P#QSS  @pX (P@z/PhD㇎8!+ @0 QPPPSppGRpSq,@,@ UT+@ `XMp@8<$唦Ϡ\ P0QPPT AX !  @Vaȑ de+`@4 `@ TAX !/@ de+`@QhE+@@X EUR P@ P$aQq`0p(@P tx R !x  PJ,@P TX\`$%R? 0+@Q@h$l` R/dP + @g4+@P d+@  Pq W deP+`@U @ P`$P 0l(@QBd1TU" @QTT! !U" @QPeXPeVd ! ! !T@pTta!q! hE+@@TSde+`@8P Z:aUR P@ q0R\  /0 A d+@8@% @4  4 d F+@8pV*@ 0Q"`P1 !`$$de+`@8pde+`@Pf`7 P`h$P 0l(@Q?d|SQTT! !QPEXPETd ! ! !S`PUSVa!UR P@! de+`@SGShE+@@8pPQ AT㐥@+@44W* P`!p$W$:T㐥@+@$Q+pQ( &p0P `  R $ER A@A @PTp@p`pUhE+@@:deR+`@ $5R 101|5%+0@+ @ a AQ.0+@Q U4 +P@s I @e4hE+@+@@Px pU+P@xu4 +p@d0|%+ @4V0P   UZK0+@P  G0x S00# !T P`\u}&Wl`P\d@T+@ a/6'\%1T9AR !0p`%d+ @P0 p` 5w pPSQNdܡ+@P\PV`x 82LRPN`+@0p @Na吕E+@F+@@ `/&lP`Pda+@AT@AATIA&6#\Q @ 0`08d  h `X9"HFQRܡ V 0SapV(A+@@Pd㐥+@+@ȑa\dȑ吥P+@+@8a+@PS YJ.BIYBj!Y!`@\uƒ2#"@aTiAW P`p0pd ? p`2w0 pP7QWS! @N PaP, 8+@PF `,Vu:Y 8+@PK sU,+@(@ R P  0 0AP; `I ;A᳊P(@ RA<,(@(@ G@!P4Q@`PLP `@D5Lp0? d?~`A | `_p`l  A,(@GE  @*@E @UP!4@'!  d+@@5DuL`0pdP04k4qa`0 0e03 0UQS4 <  0p 09SY` pp@ h 급P$+@0 ,A0A+@@ 00aqp`X  7`p !@TP` IX 0X64 0 XPX#,Qp 6`pTI ␥@@+@`eTd+@\%R+!?0OQ? 9d\Tt0` X P tPLf @DuL / 噉8L d9!1+ Qo` A;*A0 AtC!4 @ @DuL +4 dpld @ b4 RQS <a O 0CAc`p@#P ,+@PP儕+@40(@Q?.; b*c "At4 +@@A*P`V.HVDVS0+@P <P+@P8A\d+@` PJ S@+@ ?N 00dE+@+@@P 4 5dE0+@@dpHd g4 L6 WQSr|0+@P0+@P 4 0xu+p@4 dV+@先4ဈ(KЍ !@ @qb&%( }z'wt  @S  @Ngda^[XUROL Ip@-M@8+@P",`+@P @\+@+@  9@P+@Ā"p+@$! XPЍpS勦 @ 0u$M-MM@8+@PZTX +@pW d5+@+0@0 42'p@ +@PP+@ P=d+@T P*0/#@ q`V 7Q  QW_`O`F+@p 0KMi{*0`KH-M@,+@`P 8+@P! KR'@p+@$%l+@ T! P Sy @ 0"x@\+@+@ !#9Ѝ`0S [ \ <\ X\ 0/p  (@ @ n0B0B/01//p@-` +@KPPBQ(@PC/DBpO-MdU+P@hE+@@0d` p f7 VQSc0+@P vU @ QRQU QM dp( +@ 0P( @ S` `` o b @R9rUqŏQUtQR ^ 8^ X^ t^ `@1 4G``@Q,`aQ%Q ! @hd+@+@8 _Y0 @ @ @`P Ѝ Sh`+@R D_ p_ _ _  01 @ G 0G !0dE+@@`$P0l a>Gp `@t%+ @  @P@  ?  0 (@PLd ` 0P9QS?L QTT! B! QPuXPuW&d 0P  ` 9QS?K먠 b 0? h+@K !?KA0 P; 4p8@0 H  8 A ? $ $8A4  4 d+@`8P `?@>p T`@`A0o~ B0"  d%+ @`8 P0+@P  d+@`dp g 00o `WQSHO- Md+@hE+@@`0dP p e7 UQS0+@P UrP p@ Q  @L_4+@P Ao"R \ A !. 0P 0dP p e7 UQS@t%+ @ P@,Z :O @04+@P @؋ 0 O5y?`#"1T9A)%\%R !`Ž?#p2!P`xK0 d`@ 0d `T036QSp 0ke0s+`@ [0QS :dET)+@@ @\Q(x 0p50+@SQG `(!1pG2/ w( X `1qA3? qX0/x 040+@TQ% @p`p1!p`X`p@1!p@W   {D:l ,sD2dE `+@@P 00 ЍO"i fp@-aP(`@@P OD0+@P 0PppO-M@R P;Pu @ ꨠ D }P pP e D )pf (0 c0< C0 $ D8(%@Pp `P @ @ E F2~ @c~ @^~ @ Y~( @ T~hP 'pY? z D p8e D ۃp4 Nᰃp) 0( PU!*`bU  0 GOP  @%0 *@@  :ߍ @ K-8MM8 P;pP`p @0 P9p#W ` 2!8Ѝۍ0H-P@ P /P0  @+  @0H  @ CO-M(`@,P 03V` 0p|3P @h`0P " Z W0P`pUЍA-M`p@M,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8P  @A  @<&  @7  @2 @i @ @ @M @ @@-+@L(ƞP d Q:Q0 @S RT 0Ad!SRT\  H-MP+@Pp+@` +@%G!  0PЍ % @ @G-M@+@PU TSP,P@pWi+`@pp嬅+@P?`+@V8 +@+@P P+0+#@ q`V 7Q  QW@? D+@0ۍGS?+0~ۍH-MP+@p` +@%G!  ᴜPЍ # @ @\G- +@`+`@p CW @ ` p+`@P @  M8PUB@D`Rq@ 98 K-ș+@`0FQR vWO:PK P 0@  T 0 Q0pW S Q @pa0 pW}`! 0F'6&0h0 A0 @ ` * @" @O-Mȹ@+@VpP| W@%:( >@0Qu   0`&q06&0 00A@(`WN*@W P0'p&!& $&T0f?'#0( 0 hx0" X pSQ $&?'T@(@ᒐ(L%P \7 P ((||||||& d 0@ ЍOǍ  @z  @ 3  @\ A @.%  @O-M@R P,Pu @ ꨠ D vpP pP e D wpf (0 c0< C0 $ D8(%@Pp `P @ @ E F#q @Tq @Oq @ Jq( @ EqhP pY? z D vp8e D vp4 qAvp) 0( PU!*`SU  0 8BP  @0 *@@  -ߍ @ rK-8MM8 P;pP`p @0 P9puW ` 2!8ЍۍO-MMAn@Ph<A0X@#@  @@5Q=H Ԣ 4 H ȡ ( P $ L ` \ x أ l  /@@38/@0@/B7 /@ 0@ yD4t8/@0@/lp/@pup `)6 /@ 0@ T@~56 /@ 0@ JHtt6 /@ 0@ @Wj6 /@ 0@ 6pXp]/@X /@ @ O/@U(IE6 /@ 0@/?/@L:W6 /@ 0@/0; /@ 0@/&; /@ 0@/6 /@ 0@/6 /@ 0@ p,p/@0/@8c6 /@ 0@ pVpJ3 /@ 0@ `@ Ip`'&@`pP @| ͏`|P3 P0p@P+`p%x (@Q*Q/@2P  @@& > @ 0@g@P A.xЍۍ| @ H-MPp_@ ဏ@`V@P?V=JP5 Q6G@ Qg@ P0( t t t 8 H t t t t X ( t t t 8 H t t t t X $aO $kE $fJkDЍ @ 0^ @H-@`pP@ P  V  @ 0CH-? p (@@ @m  @ 02`yX `#p@ P@!p0\`Fv>O-M@R P5Pu @ ꨠ D mP pP e D #tpf (0 c0< C0 $ D8(%@Pp `P @ @ E F,n @]n @Xn @ Sn( @ NnhP !~pY? z D sp8e D sp4 z>sp) 0( PU!*`\U  0 A?P  @0 *@@  *ߍ @ {K-8MM8 P;pP`p @0 P9prW ` 2!8ЍۍO-M-MM`P0FpxQlp'q#$dP{`(@t{ppdp1#upo`oo4PrQbpb`oo@bpP``oobp00U53sU5E3sC00E`#10@d#2`0qq@p#<0$0⃀pqppQtpp\0o`04r0pJppH0p}|0ppG003pp0p80 100tpXp00\p ph00< 02R  1 p夀U PT 0 P*P $aYi/AKWqp !17#@ 'qP 0A7 $a>qp J @rPYA0AP P @ P Q耍[ rPXv@  @P``Do9PN 9PI pPUXv@p耝$a0  @oX    06+$WPU tj@#`@9P D@T"LHD804X`P)0L PX 4 R$ H(R`D QPQ`88S<@,0P $A/ 32P@0S  (@000D B0SR @D@rT`QU HPDP @LaQ:`PPV?p耍P @☠蠝$?  gp t04w8@  qp@ p/ KᘠUY: Y P?*H?W?p#PWHp2 DPX7 XDC*pV耝@  0X7`DP p P P  P *1%?SP0:W QT` P`@V !P   @ 1P` V`V_ T\0㘠saP:a !PȰ P pP pPpPp吐 !PȰkpP ipPB P wX @PP@PP@P P?*Q@:QD `7 P   1P Q P *P@P PX@PPP[B /.P @ M~+  @ 0.@PT r#h"""B{"Bp@{"B""p@{p{*c!`r#h"2"B;"Bp@0@;"B""0@;0;*b!`r#h"""B+"B0@  @+"B""  @+  +*a`ph  " "  @ @ " @@Q A  ip P  Z+ $ @$e $ @,^ , @ ).   ,@/O-M-MpD`C jp,@ jp,@  @ip @yj&jp  @N 8 @@/@ ᧙C@4Q(  p 4 \   H l @ L T ,@<5{X<,@ P9@ 4,@/@  H  @, @P</P@ .<PzڼZ  ,@ ,@mx (@@8 },@P</P@ <QP,@>P</P@z(<,@ P@  ` U,@{@4/@,@P</P@ _<P X 9:P</P@ ʣ<Qp0,@ ',@K,@F,@A,@<,@7,@2,@@0+,@/@ + 8 y @, @0 P</P@ 傣<QPPC ,@,@   @pS(@,@@,@ @ Pm a  P hPp a ZhPr0,@PhPo Q!@P0 AP ` x-@@ -@ `  PP @,@@P @ ,@ Q8! QJx G(@PG   @'  @#  @<  @ ? @+SX @.`RMb@A  @ u @{Gz?eA  @-  @  @I  @ x  @GQ`` p0 ,`@!@,0@ 0PPZP H f,@ @p,@@!z8,@[Z``Z` P,@P@q,@@,p@`yP,@  @ @  V),@D``Z!4@,@@0Sp (@X<(  @ V=r,@0J-@-f D0wB@kKv"P"\P _ @!,@@`p- @,`@ D0 Rhp @P,P@ D0 Ahp @ D0 2hp @ D0 #hp @סA,@-@@-@   0 '  ` , @0  0 (  'cQ,@-P@@(<-@,(D0p pgp'  @H , @8@,@@  ,@CPp )0U"  p   0 p  0 gpʪ  @ (@ 00 * 00SQ# !Q!H@ 8 400 (,00 0`,Pb 0 `PbB 0< @ 4$;P,@Q!@, @D `0aS0`P`,@ @ U D,@D` @@`PU    ,@HH0 GgpC  @oU ,@C0 5gpd  @]`,@,`@ 0 gpʅ  @H`,@٧ ,@p0 @,@KP(@@ 0Pgp P  @';(0@ f  @Y2P-@HP!" @O @-@ @@$ P P\H@2@2yP A-@@f~PU A-Pp G!P@|?`P T ,@ mPP }P QTP A /@媙 0 @   @ H-82 p (@, @ᶽH- -@Q@-@Q  @1-@,@ R1H--@ eph  @z O-M- M-@-@$㐑 A-@0%"p,@-@@,@=tA P<,P@< @ _`0 `+0; "8r 0"( # fp]p!, @<  0pdp * @㴟0 pepE-@e  <  hD @ -b A0DQA#1H  @ @(0P4  @ @(0P*  @ @(0uP   @ @.p 4f @% @! @#-@I /10 @  @ @ @   @-@@pp Y:Q Q Q$W] @pQ Q@PIT** P pI@WT@T"* p W,ߢ H 0  p pb @㮻mW*D@fW [ @A``D-@Vh-@ PZ `-@ `h-@$"aW [-`@ @&X @ A @}jIp T6:@`P@`XXX 㼼 U@DI T ^KI T* p p`P@`XXX 㚼 3@DI TIYK a[-`@ I @3DH W `P@` XX ",@-@X kX,@-@,!@-@R-P@pPqP,@  j@M ` R P`"1 A- @  B* 0 h-@+( @-@a-`@+ p+!xb -@ C(@CM(-@ `Ͷ @/0 RU *@- @-@ -@Ww ,@ˡ H 0  p -@ BP (P -@PX,@ -@[ @I -@P E,@ 7  @s9? @L @E @B  @?p( @=M @6a @3y @0 @- @* @' @$ @! @ @- @ -@ @8PUp  (@@ODqPU , @  p Dqp0 @,@KU S(@S@Q,@P,' H 0  p p,@p QX,@S,@,@` G@D PC !WP, @ PDPPWPZ, H 0  p !,@, @`0ED  @㳹a,@pP,@-`@U!@㣹 @㟹P,@a-`@ p|  @   @A-@+Dr-p@ph (`@QH"L- @-@P0P.P`p P0@P`0X X PX.㷺Q qH"L- @-@P0PPC`p P0@P`0X X PX㖺pT HB-@@P `P@`XX X |L-@X<:-@ `P-@ @H+@-@*D@-@P@᥶ K--@@`pu,@)w  @ 0(PX  @  @@   h @0+Sڸ  Xp (@K{@@A--0M@<T  p @,@㽸B -@@ @巸@R -P@ @屸j-`@Q  @㩸P P @㠸 @ ` 1 @ 0+S쓸 WQr p",p@ @k   -@* R +`-@+`;Kq+t++ (@ R;(-@ `;c3+SKD  ;d @b; Z; -@H  "- @P`Z 2 B* 1 A졛00-@  *- @P`F  B* 1 A졋0@| @@ +`` 0+S0ЍY@@@eA-C6?H-M0P0 -@ @!@ЍH-@,@,DH"-@- @ 0#J0b0-`@  P-@R  B* 1 A pa  a L-@P@dtH<eA?333333?G-`,@P@p @( Q#<Qʐ-@QW-@Z @ @G> * @- @ሷH-@`,@@p P\U U U 0/Q 1 @ Q   /r @H\/pr  @0/r 1 @HF0H-M@,@ [P PU(  @-@0ڶЍ0I(0 ! @-@Ѝ0HͶO-M@  @ Qᾐ`p7`  * @ 0៖ @  @ 0 @ @V: pPW *Da @@߶V`FW:ЍO- M`p(@-QP@ @$P -@   @$P -@[ P@@ l@Q 4 T  T   T T T T  T  T  dP -@P px (@P- qWm`` P` `PmW P p W@\PZ T?[`P[mP`l `@ -@PP  @ S{! @%6{ !@ [C @ -@P  @ 6{. @C  @ .{XyS @ +{b{ iZ p@"`@!P@ { 0{YZ''''' ' [pd  @Z[p'PYZ Zp @T  Zp'P @ q @ @w  [ @㱕'@Z p @Pz80"@  @  @ 0z@--@J"@!@@Q@' p (@ @0& O-MMP?` @pP @P@@< -@ @U-P !| LI8\, p@/@!@@-P@-@  ᙊ MP!bBP4 x ` P ` ` ` ` \ ` ` ` ` h ` 0Sn DR MR޵P/P-@ $ -@NR@ RR -@ A=@,- @QP (@  -@ -@ -@ (@A +( @QPD -@ -@}( -@y lP plP6  @( P @`bAP P- OkP -ׁQ Z-@rP  @  @ s @ @v9x (@@(-@QtPD-@ @& PP& @pF &P&pH (@@┋H-@  @FcW p(@)qPOrPe tP xP O4ㄻ@-@ @+T)P %` (@P ]& 0!pWC  -@P _ 9 @Q  @i  @c  @^Z pRP[ iP  EQ@arqP -@  -@RIP . X0 @ ~ @} L -@P I X0 @ m @0"@ DCc Z@ P@++(  0PpWOL @@r% 5 ?P b X0 @ 44  -@P y X0 @ % @0"@p @ Z    -@P  -@P X0 @  @0"@Q @pİ0H-:%@p (@P  @ѳ   @ ̳c  @ dz  @ ³  @ έᢰO-MMN @ @  L @  @  @ "@p ′ Ё`(@p @-@`-@oJ^P@ P LL̵0 @-@@ -@ P ,P C-@@ Q/R;D$ `sP @-`@-p@  @S   t  Q J^P@BH@P Q Q @ԌQ: " `-@ @ pa.؀ >@" @ @@ 0ῲp2, J>P @ u u u "@!@  pဲ @`, 뀂 p @`"  @   @  @ 0 J^P  ,@  P La@QDЁ-@4 t <   t t P t t t ` t t t  l t  t t   L @ "@P+'P %@J4 -@ (@P 0$ @  0 뀲 @Ё?P-@c DPP~S  @P\-P@P Y  @r@k "@P& *P J. @Q@Tq !@|PlPz  @ ;P>7 @fPV = -@P 0 -@@@& !@NP>% @/ N @0 $t @ @( @ 0@, @0 @4 @8  @<1 @M @m @ @  @ @ @ @  @߱O@  @ P] P[ P -@P -@ @1K  -@PPD JN P P @ `P BhP J^ `Pn @ %@ h@ᓱ3'" @0ჰP Plf o `\P` -@P -@ @1  -@PP P"@P !@P PP\0  P   @ B +!  `Ph P@2 !@ZPJPL @@ !@6@E  @?P/ wP " @2P"\-P@P) "  @ 0 @`@N  @P T@ !@Pr  հE  @ 0>4  @Jc}6( @, .m  @ 0$ؐ }`@ PP"  [  @ 0sP` 뀒 ЁV @-@c l@: 0@_hV`T0 L XPPH@0P ` S` ^ P0T 0003S@ PH 10Y :/oHL2/oP`PT"X@\ -P@ "0$ 0S|@ QL LL4 Q0 Q  ' rl{l 0@xQQT@t@pPPx`xdpPm 㘶 -@Q  x @ d PQ A  QC PA   APQ A  Q. P,   |P#* PtP*t@AP @PѸ ڰP;@TpPX1. q[倲 Ё @P-@ @P:@D qqk`@0` (ЍۍK-P P& l|㰐-`@-p@-@@QQ Q  0B01z P ؁p-@0 0 p0H-P @P -@Q  - @0 A!2 -@QP @ P0G-"@`PDP  @ 5P /P.. pPR* { Q 0/S/Q Q P/R@P7 I@!@ P  B0QS/SrpD0.S `FQ P@@ET@EPP/Q@@B{@ QA9{Ppp #(@0  @uH-, -@iP-@P @*#Pb-@pA-@ R R p Oc , (@P `@ @!R"R'Rp?oQQ2 QQop2S LR R R  \RpQ  " 0NA-P@   pW / -@( @`?0V`p`p 0`pW@-@ Q -@ @1 _ P* ^ Rd* * * * d* * * * * * * * * * *  P /= # p  (@ @̭ @%5A-Mp-@B`+( @P 0  p -@@(@P z, @Q @X? X @ 0p嚭UPЍK-pM (@B@-@` 0! &P, -@iP -@PF 㐐(@P # @d`PaY  0 1 -@P, p  (@ @X W$Z P p P  0" P  0 PYT@pЍ@- B-@;(0@@0 1 P  R  T@O-M\p -P@(@P  X0 @  pP-p@# @P  X0 @ 尐P-@`A 1 0"   V@-@P8:X`# @P-@-@ @ P$ p-@E 0P V ᯬP  $ppWP@U:ЍO- M-@PBa @T6P `P/ @ pVPpp z `P PP P`PV W aJ  -@P  p (@G X @MJP@0  P P PU1 l4 2 2 x2 h1 2 3 <4 <4 41 1 41 h1 41 1 ;p (@-@ , @0W  QD  @@P * `V p  (@ @ Zu B -@pQ  -@Pi G|-@@I Dppp"@  p @@p (@X-@pQ G|-@@I DPPP| NDFD@"@ P@p (@ XWD z  0d @ZN-@pQ IP5 0p (@x @ ipxy -@I @Z 04 @ZLI  @pp\Zp -@PP @ 0 @-@pQ> ?fp -@(@  X @. C  -@ 0`$ @ 0 @-@pQ 6p (@-@X k @0 Ѝ0H-PG|-@@I D | NEAE@ | NDFD@ "@ @0"@ @0O-M -@Pp (@ X0d @ 븠-@P4:p ~ (@X`@P-@ @PQP@U: E-@ 1 pW P P  pqZ p-@PU& p l~ 㜕 (@X@-`@ @ @ pW PP  sP  GH1 p$PUЍH- -@P p (@X0  @IW-P@@T `p P $p$ `@TV-@@TU P@/$@TO-M,  -@-@RQ P p "(@X0  @P p (@X0  @0 -@ t 븰X-@-@P` Rf*0 & -@6 @p (@@ @P` U *pP  0=X  ᱩ %0&  pPn @% @  1>M  @ 0ၩ~0 -@P 0 -@ R:ЍO-M -@P p (@X0  @x X-@Y`-@PPkpM@`GP \pP P:0\p (@-P@0  P  *`mZ:gS*P* P Yq R0  RM/d `@ T *P}  6 @@ T$(P:P[ v Q@` p P`@   p P t*ЍG-MMlpX P-`@(P@ @P  X0 @  +2@TP  X0 @  븠-@P':P sP `pV  t@T@ `PU:ЍۍA- -@P p (@X0  @T 븀-@P8f @P `@3P p RFP @pWP@U:H-P`ptP! @o"@/o"PPoR   @0|RPP -  @p  (@ @ PO-cM@ -@P p (@X0F  @ <|-@-p@e' 0 @ (@㺦,l-`@ rP  (@@ϧ[0r' (P@ @㤦Jp  @P-@ T( ' 0 @(@㍦ rP (@@㤧O0' (@@ @yp  @wP-@ X| -p@ @P @$/   PJ (8-@ -@|a`PG @@/0i(-@-@0aS0+ $ C  4<D  -@p]ύJ`8 @h (A-@,QX8H, PUTH% @ @ @D $-@0P(-@ [eP  P:N-@ @ P H  P P"+P-@ S1k p (@ @Ц-@P P(@SPcߍ @cߍOC (@(@ @ @ @+( @} @/( @vO-CM@ -@PP' UP`p㰐Y A&p-@P y r  px@T:cUa p p(@X`-@-@ pP 0 -@PP P `[:P-P  @ 0S  P  @ 0H  0SP   @P h Z:P CߍH-(- @0S  P(@,A-@ h$-`@p (X-@ P-P@ -@ 0a P  pptp (@H-Mf @'AP <  -@; @ @p (@ 0@ⶥᛢ@- (@@(Jp ` D\P p@`0JЀ@-XL-@@   PO- MM`@P/0( -@qW !  p0 01/ Ѝۍ0 01/P 3'" @ 0W e -@P _p @P(@ "@P 8 @ Ew@T !@wP ` @ 4f@` 0pT @ఐ`0 P  @  $ 00 x 9`@ 0D@T`p@-M@P` 03@P `Fvp # (@ @ ݤ ?e`V +BIЍpO-MP `p (@㰠-@Q ++IP/Q!!R 0KS p@T"@P$ -@T:P  @ ᏤpP  @ㄤ pP   @ 0pЍO- MM@ qD/Q "@EdPp@PC ӽ(<`PbA/-0@-@"@ !R`P/ # "  GDPoP pU dP apP  PdP @(</P-0@p ЍۍH-P /0`@,( -@qW !  p@G@ @-@H@Q`O-Mp -@pH (@@P  X0 @& ,l-`@ rP <,-@- @0' (@ @¢(@#P, @IB 0 @) (@ @ϣP-@ `H0 P` @@(p p(@@  xPU T T_xP#ZP@@0T e@  @ $sxPiPZV P@N $ 4 -@PFZ ( -@P9p lP %Hh %Hx0ST @ U* @ @ 05  $0 @   S P8 -@P h0t  !@t G0` x@o  @(@_p (@0  @TW_ЍiGg@l @w / @( @B ) @ 0ЍO  @(@3  @  @(@*  @ P 0  @ 0K-MMP@`/0p( -@P # " n  @0P&p!Gp*H-@@ iG@PT(`-@ Tp{ Fp& P Fp0 KTGFp  (@@ @ ef @[ЍۍX  -@ @ Pp (@@Kf @X  -@ @ Pp (@@8f @0p@-/0@P`H( -@P # " `Vp@-x (@#P O (@@0&lG (@#PK (@@0l@Gp@-`@ P-@V* -@ ? -@P # " $@pp@-P` -@U:  @0K -@ ? -@0P  " , $P 0@0#@$0$0 $  p  @0p@G-M@-@PP/: -@P ? -@qW!   $p P@`@`TV/VPW P pV pWPۍO-M0P-0@ Ѐ;K-@-0@-@@ `@p/@DX:? ^P " $ U d P-@ T2  @ЍO-M(-p@@PTH-@@W`PI @@@(@V($@@Q`(@A$P $ A BZP `/n ` @( D  P @Z 7( '-@P%: -@ ? -@P " $ PP @2 @k  @('@ QЍA-/@/P PpPP `P   @PPO-MP- @ uԟ q-@`PH-@V@P7 @  BT0aPU@ ЍOlH-`@p -@V:  @0 -@ ?O -@-@`1Q$0A$@T ,_ P@! 8$@Tp@-@P   @+P P   @! P   @` " PP  @ U U PUP` R    @P-@ /P- @0@$0p R /R  R/; @@-@-@ @p@-@P`P  @V  ` @/`P-@P ` o pO-tM@ -@PP p (@X0R  @x( -@PtЍ @PiP c p (@l @Em  @-@@`P @`8P p 0@ Ap@W-@P`[*P; H `  P* p |||| 0 Qd QH` \  Qh$Ql(pW-@`P V *P`̻-@0 P{D@`-p@0  0QD`V -@0`P@|-@-p@P-@@@ 0p0 `P8p@ b p (@ @㉞ @  tЍOtK-MP -@p (@P X0 @ Ua  B`p bm @`   @HDp b+ @O5  @x0p@oX@PW @ ᠐BPJ0 Bp ʬb @+  @PB, -@RQ0 rQEP,- @ `!P `@ Pw 0 @v -@0)-@+XP-@ @ "@0ЍPl-`@ -@-@ X Q-@ O @Z `-`@  (A -@0{ C-p@RqWqqq R( R*0pS`1pp100qSq1p10 0S11 0$0S11$0(  0 @ y0H-MP\#@@ @aP P@0H-@@ -@-@1Q-0@  M`px -`@(p@:pHP P-@@P)Ck @ PO @ @gPaP\ O* 0 @ @Bi"@ @TP -@P-@Hia\ i!0 @" @%p@-S@(P@@ -@@Qpe-`@P wYSP @pp &(@0p  @ G-M-@P p (@X0  @A-@@-@P -@ p(@[9a0p (@[!"@- @P (@0 -@@\ -@-P@ء-@ 00/Q-@0 `%`V P %(@A P"%-@ P p (@ @X⍜L-@@P\-@-P@5p-0@ A ` B-@  F P p &(@0  @P  k*-@-@Q!T)A  1  R) @BP, -@tP =P|-p@ - @"@Bp?ڈ  B? P(@ B? PBL-@@P -@P p -@(@ @X @a @ZP.-@@-@@ -@PЍ-@ s@p N` p (@ @p (@ @p !(@0 @"p (@0 @R 0` p (@5 @ϛ Jp (@j9 @ 0@ěp (@0 @ ᠘H-M (@P) 0-@Q$-@Q!@-@ P  ЍH~(@H Ap _ p (@ @㇛Ѝp )(@0 @bO-LMM@(}⟀9 -@<P' LP PP- d`k Vx L8X h04(P堐t`PT$\lPTAP( P" p`-@,pP 8`808h>8 2/ 0`3?A6o5_7<ϿL  h0p P4آ2/3?70<` 06o؄ 89<`##,8|Ѐ0<i1xS6o7 5_02/ |i3?xS 8`0(@X@ @  ∻ (# @O @P3s8 p@@E@P `0E @ E @8\-P@@T6  `= @@  R (# @N @٘8@0F Q_00Fp @p͘~ F @Ș0 @ @Ѝ @ጬO-MMX,- @\ p o(@@p @-P@TA @-`@-@P P P #3"#AP+ @  L h  P `P Q YP #3"#  @ ;  @ 0lXpH X  g-@ J A,L 尢T4p<0( hP 048p<0@DPH   @X,-@- @  @X-@P RT @ЍۍO- M\X-P@@-@ ( P @~ TAP  @v -@PT N` @ @ oR 0`  PPQ pP Q:pUAW k Q*QW P 3 0PP  -@0@!0 $ P @  -@wP0 ЍO-,MM0<QP-0@-P@  -@)- @PP  @ 0<-0@@P -@Pp 㗑Ƞ(@P( @-@`, -@ rP@TeX -@PP % @ 0Ry@-p@P  @ 0`E:*@0 "@ 0,*@` V Y @ % @0C @ @ @ 0@X( @ 0  0Z kX ( Q P]`P0<@-0@TU B @ ؖ* @ 0! @- @̖/ @X 6!@ 1P9 ( P q-p@Pc`@-@P -@ -@ ;p(@?! @- @㔖0<-@-0@P8 p)- @,Ѝۍ0<Q-0@-P@@@@ -@-@(p P(@+ 44 S>p(-p@ `"p!pPl-`@@ p'`$p1 $廸@ @D-@㲸 @< -@P X-@ @ @/O0 @ D0<-0@f @ 0L-@-@@-@` V 0-@ X @(P-X -@P0 -@Ps  @w o(P  PP(@xPEUʰ -@b$ -@QV  -@ˊ`Z$ V-@pG V@Q  :@!0@T0 @ ᲕTPG(@APEUʩ-@P`P(@3PEUʛ(@P/A-@Q :p@-iX\-`@-P@P QP l| @ @ǔ@ @F- @ @@P P@p -@eO- MA-@-@@pe-`@Q 00@p -@(@P-@XQ0 U0SOW-@@u-@P  (@ 9Q [Xڦ R[ -@Q 0S @ /[Q[ Qz  pGW{Pp (@p @0X -@P P P @X -@ @P  X -@ @ ؔ @ 0 -@P @t Pu  ^-@P  P Z](@? pR [+ -@P 0  @ P10P-@P pA-@@Q=.-@Q 5p @〔+!- @+%-@- @0 Ѝ %p @-@+X @Q6O-MX-@4@0p $,PLPP(`P<8H`@0P@ @(p 0, 0D&9pP  @  P`@x d d d ȓ d d 8  -@P p E(@ @X ( -@PgD P-@P 9 Z?+9p  88Z @H X @ @   0 @t -@P p (@ @X ̓( -@P*D -@P 9t8pn  88Z P@H X @ @   0@ Pdp (@ @ 0\ (@P P   @  -@P p (@ @X xD -@P =9( -@P-7p-@ $ -@-@PP@ -@1/_ -P@ ` 8 p8 OX & @L @ @ @|Z 0$ -@P [  -@2/P pp T(@X@ P@`0 pW( `-@P_ @-P@P 7878 -@P @!@0 @O-@@-@ X  @ @ @P[ D @-@P 8 -@ `PU 8  77Z 0|8 -@P p"@ 0 -@P p (@ @X ᜒH @ `c -@P p (@ @X ᇒ ЍO `-@PL p (@ @X uDV0p (@^ @0H @ P ዇8ሇ8 -@PO 6"@"@ Up@AV0p (@ @V0p (@ @ 7H @ l`Ѝ766H @ WU D8A8 -@P p @@ 0o6kX -@H @ 4p@-Mxo@-`@t-@ P *P |-@INHP|-@UP @|-@PXP-@P p (@P g73 @ 0@ PƑЍpO-,MML -@@A"A `Phpb @/TAP  @'i-`@P A" PA 0" p p(@XP`P Q (@ QHQ A (2/pA P(@P&Q A (2/pA q A"@9/pA"@9/pA  pAAA P0 pA OPPPA 0"p `PV |.Q A (2/pA"9/p@Q -@Q   @ڐQ Q f ERPNPA PP9  -@P X -@-@0P @寐PX -@PD @,y-p@Py P P`+Q -@ -@kP ,ЍۍH-M/0- @ P -@ЍH]]X-@P p (@0: @-0@cHH-to@x-`@-@PpW~ @p| -@pH-X ,-@ @P p (@<!O-EM-@@P Pp (@ X @ 'T p 8(@K `Xp@@P PPz 0 P (@0`! @X X) X 0B  B   0,5#% @& 0B  B   05C% @ 0B  B   042% @p  -@P T @㳏P d @ P  @ P P  @ 0 Yw:bX X& Xf "Ew% @$X( X1 XV Ew% @/  D% @   D% @pP   D% @   D% @p -@P  %!@Y @  @0P p (@X #QEߍ/p@-MP$ -@@P -@ 0-@3/( -@P-@ ]3p ЍpX -@@P`wUSp (@ @ 0`֋p@-M@$ -@P  -@0-@3/( -@P -@ 0p ЍpX -@@P`@Sp (@ @ 0`庎់H-\XlHE -P@-`@p @@PP p MH-M p (@  偏ЍH Ѝ/  tD{b{u}(}|0H-Mp-@Q  13?  Q P *b Qb` 0 @R X -@ @@Pp (@0]Ѝ0K-M/@/2P Pp/P Pp`P 0`PЍ0H-PP  @L@( -@P3p  -@P0p (@ @X 0H@cR0p (@ @ 0H0H-M@  x @  PZ>a-@m}ۍ00H-@p (@P  @ҍs @ˍl @čP c @ọ P Z @᲍P Q @ᩍ$P H @᠍<' @Q @.  @ᕍ > @ᐍ-@Q @0H p@-MP@P`P ``PPP @O+;-@@  @ 0@`ZЍp0H-MP( -@@P2p -@P p (@ @X 0Ѝ0HCQp (@ @ 07Ѝ0@-@P ! @O P 8 @H @( -@PC2p  -@Pp X(@ @X @_Q0p (@ @ @@-@P h @ @( -@P2p  -@Pp (@ @X @֌O-Q0p (@ @ @ʌH-M`@PR( -@P`1p2Qp (@ @.V( -@Pb1p p-@P  &- @ @V p (@ @X0P双  @ Pp (@ @ 0}pЍ MH-M p (@  V -@P}"@P ЍH Ѝ/~ @PA<0H-P( -@P 0@|1p  @-@P p S(@ @X 8 P0p (@+ @ ,0@-@P g @D @( -@P0p  -@Pp (@ @X @}[P0p (@ @ @p@-`@-`@PU *PQP@ p0H-PP@:PQPU@u: @P0p@-PC|-@@ID``` "@ `@  "@ @ "@ @ | EE | EDP@ "@ @p0H-@PPP p g(@ @ b0 @-@0P 1A-@p 㘁p(@P @-p@ GQ A  wp` V Q A  h P   nV yVG-MP480@`p.P-@P/P 0 @  @ 0Fp`@YF 0 @ J!@@0QO @ "@@  @ ފQO"@@  @ ՊQO"@@  @ ̊QO"@@  @ ÊQO"@@  @ ẊQO"@@  @ ᱊ L@Ѝ @yA-MgP-`@  @뜇-@P -@  !@ @mP ~/@P-@ P| P@@UP0 Q / 0( @  qpW`Jpp_Q-QY0Q0_/ @ -@ %dgP-`@FU;J@ *-@ Q% r  0p p/p @  P@  0p/PJP 0p p/@ 0p/ 0p/PЍh @pK "@ϝ7 @R @ἝH- @ᶝA-BM`P@. @0Ո-@ BߍH-P-@@p` .pWHS@-G-@@P!@ @ H- MP.0@ @㙈 @ PP w`-p@ E.P`U ЍA- M`@. @0tW-P@p - - "@ ЍAA-BM`@PYE@Q*RV  @{@@FQ -@ APkBލ@BPP Q@~ @;@-XM@/0 @PO @ HXЍQC/Ap@-BM@ /0 @ @ 4BߍpA-MQw`P-p@@ n-P Q `F@V @D @@ЍH-P  @EJ6 p (@\= @#0@͈ᲅO-LMP\mħw@P#`@-@-p@ ]]cPRPSP TPn@Q\ п -@LP"-@fP dP-@-@-@-@-@-@pmx (@`g.܇-@-@-@P i"@ , " . 0)-p "@gpFPE@TP Y@ QX -@P   S<NB IB$DB(?B`,:B@05Bp40BX-@8  RZ VT WP+ @Ί-@P   pLЍ)P /P  -@-@7-0@ 0   p -@00 gP h,U-@j!`@p ` P``E@-P5 -@   P @P@-@Pi$@&"@ @ @"@P@-@Pi&"@ @ @H`F@PO0@3S `pBI( , , 4 , @  , l ,    , ,  $ , ,  8 @ |     ,  , , , , ,   , , pRG 0A@ S3h 4 H \ p  -@< 0 p@I @< 0Ip@` 0 Ip@ Q Q -@o|ypR < 0 pR  0pR  0'- @LpR  0 pR  0  (@ 6 (@ 0-@-@ +pR  0 `-@f'pR  Z (@ "'- @G `8 -@@ -@0 -@8  -@  -@( -@@PHW-@@`-P@-@P0``` XS-P@`   PJF!`Wxj!`@ ``-@% aQ% -@-@PQ! Qo/op0"X0Wp-@`$p mPP@hP aT gTb cT+- @-@P(-@P  PP-@ / (@AP @R p-@ `Q  PQU1A?U0u QU  -@Px$ `x@@Ppp -@P p-@P @-@Pp  @P @@ -@P -@P @-@PW-P@( @P @@ W-@-P@P -@P( @-@ , @P @@ -@P -@P,, @-@ 4 @P @@ -@P -@P4= @{-@  0 @P @@ -@P -@P0J @]-@-@ `KQ` P-@P p( ( @`P@`XX X Q p-@@P  (p7P P `7P P @P`- @ ` @ @H @E3P-@P np@P-@P p@P <P RfgPD -@P?Pu [( @! @P 0 "@㕃P  @㎃X3$-@P TU 7U U @$j @r 6  @ @wH!@c z@$x@(v@,t@0r@4p@8n@ `p@#1 "@җ[ @} @἗ @ᷗ 0H-S@(P@P S(P@PP0 O-4Mܗp-@`P-@@P,Po(,0!  `00 P BP $Pp0P F:P P00 p0Է-@P  @aP  @ւ0pPz U^*` P, R  PyP-@P `V:@x  'p7P 2QH -@ PP Q-@ / @ㅂ0-@ @P    @uJ"@?P 7P P @ @ @lG @|Dp4Ѝ @r @ז@Җ @͖"O-\MM@-@P Q ,@ 0 h #@ @ @\ЍۍO ; @A @@P      \ 0n @\P .# @㋂p (@X` @(}#p@ y @Ձ  l x@^ @Á=!#0@\P/Y,/#@P# @0P Op (@Xm  !} @㥁Q3 Q5f @0J* @! @㗁\P.# @,p (@XJ\Ѝۍ} @dAP< x   @ @kah @g]h @c @  @  @@V  @Q Q @\ЍۍO8j@Q:g@P3;89 :0?@ABDPE @X @$P(p4jP8 G @ \ЍۍOɀ @  @ O-DMMQ ` @P@/# @P儁px (p@X`P@`XX  &p5 0W 0W a z0BR000`p WКWsA-@-P@"p@ aVC [X Z Z/C^hXxW !p@-P@*4g s0 ."p@A~hXWs "p@-P@  .0O(0 .! @ f [pH (@@`P@`XX X 㧁XlDЍۍO-M@-@p`V(@` `-@  GQ T x W W` ` @`P; V? "VA \ Pp 0`B V0 a0BSWBA0BS7B0R00S`P  x x t t "Pp p P@ P:2WW``/ b* Y /WP3 W1`-@P ᑦp"`W -@0`Up @`Ѝp 0  zЍOA/`P W-@P Zp5P YKP   f`P9`W  > @* @ ϓp@-@`)P-@ R-@!PU e0 Eop @ᡓ @ ᛓH-P-@0000 P<P<OP<P<3?>0 0ASR   7S86S80 S :S40 S44 ? O00H-P@U U e W @Gb e @~0s @ ~p (@X0HO-dM p4"0<0(8P, $$0p5p<P 5P <0$ $pl<@ @Tn@ p@Q^WyQZY Wy(@Q (@{7% @  @ 0@  @C~ xp2 0`CS`0``p01 P@pP% H0 ``bD 0`\k [@ @ ~p( ( @`P@`XX X Y@ T:;l @dЍr @{ @vH-M% @ 7 @  @ 0@  }ЍP P Q  @ @ @ @}  @}0H-P@Q  _0t @ 0H}!@0H} @ 0H}p@-M@ -@PQk-`@P  .-@P  -@,IP `V VO  -@@,7Ѝp@q )(-@ @ -@0 } -@Ѝp@-M@T T Ѝ@Uq @(-@ @ -@0| -@ЍH-(M0#@ 000S  Q:! @'}(Ѝp@-MP  ;IP @P.P `-@P@T$d@J @@\-P@,Ѝp@-Q R  RR@`@|` RL0d(-@@ @|p@--@Q @J8  A 0@.@R$B@@@@@P`@ BU: -@p0H-M@Q P5_5Uo P`P4O T ,2PQ U  :(P$<-@ @$ @ ,-@XUPT7( $<-@ @TT$<U4(! -@ @t % 1(-@ @| -@Ѝ0H-M00ЍH-M  0ЍO-M`P!,{H@ @@Pp-Q#P P PZPP@GQ *{H @@P(PP@Ѝp@@-M@ 0 0 0?=  0@ Ѝ@nO- MP@t"PXh  ~$ `@-@-@-p@-@ SQb@Q! $   , < D /@-@DP*-@-@ -@-@-@-@-@@ @'p x (@P=-0@-@0 SQR> -0@ >-0@0S >-0@0S  @=SQ -@"@ Q"@R @=B [ @\@PB0" - @0008" - @@T' k @GPP %{-@` pGW:PV `@` `@T %-@0 -@ ( -@6  @ P[ +P= (@ `0r >A-p@@08 -@, @{@B P-@@ 1P  @ -@PLWPH pM @?}x @(p@PpQJ :PP@PP  @H $iPv@ Pz     \  @  Qk@R@>e  "@ ?v  @z/x%np -`@@s(@PF <PP Q UP:P@Q% -@<d TO !@@!@ !@!@zi8" - @ r 0r -p@Pq @ᮎH-@ p (@ @zwpC-0B P-@@ЀKx2ЀP Pp`@H#`@p#@ @X`@T @ 0P IEUPKpP`0H-I @@a p] P@m/P0H&" @@8 -@   !@ %^-P@s 0HG-MM`D -@PHr -p@Q @I)O9 @ 0@Ay @"vP @@ -@)0 vpp @!@  @4zYV8 -@㞜 @(z%]O9 @ 0@>:<V v<&3 0@ @0*z W ! @  @ 0( -@ R %-@0L -@nPP @㩑Fw@ᤑЍۍH-XM~ n-p@-`@P CJ @@P-@Q K @@PI @"@@P@@ 0-@ @0%-@ .> D  @-@Pj  @y-@P   @m/PJ @P'LT *-P@ @Q0xP  @X[G  @OPQ CP*P @ @=  JJ-@ @ @@@ QU @ C  -@ @QX @$-@Q[ @-@Q^ @-@Q @-@Q @ -- @ R   @ aP @ =Pv  @|XH--@P  @uH-L -@nH-  @r:O-DMkp㐵㔥@P `@/p@(@(@ Mh@ Q ` p p HPXx (@EQHQ @ P PT 8$>-P@" @ 0@ w)p3  P@ $#FD p&yB p P* C H{pX XPP@ D!@ G "@B @= @8 @3H- p (@ @Ux:uO-DMP@Wpl д t ܄ `@-@-@-p@-@-@ L`P a@P l d    d d d d d d d  d d  l d d d d   AP( MP, -@% -@" -@(@!@$ /@- @ -@px (@PP~  -@-@pQt $ -@4 - @-0@ ` E XV p-@pPp (@(@X -@ -@+K.PQ PW " 0@q>V)  @wP@ $ - @0@HP d p-`@P  3 0HpPg X X ap@ pGW -@@T@DЍ  @+ -@!@ #H-(M a !@N$# D9!@X!0@ !@!@p (@9!@!0@  1wtO-TMMD -@@<04 *PH 0-@@D"U,@`LceH P[ 㤠L}LP`!@"@"@@V 00 `[4xdZ8(W zV!p@ 8@5D8$(0@TH0" @0,"0@T L0" @ <-@P(@Zf -@P(@Z+ D -@@P[ XQ( 8PV XP: -@P  @-@uXQu !@k[ ꘥<(@V|T) [pW/@[= P;8E> (rp2 PP/  -@-@e  -@P`  @ -@uZ -@PT   @-@uU`V 8 <(0   -@-@6/>PKQ:    H   ( 8`  8@-@T P 4@,P `p@0   pz2  P@,`pP  ( @-@- @MuKP s"@ p D P \ h  @ @;u#  @3u @ [ @b @g @n @  @!u@  @u 〿P-@@p@pH -@@!@,s @,Q @"p@ppP X -P@,| @,Q @"p@< X -P@, @,|Q@"p@  X -P@,q @,lQ@@"p@  X -P@,_ @,Z Q@@"p@  X -P@,M @,H Q@@"p@  X -P@,; @,6Q@@"p@  X -P@,) @,$Q@@"p@  X -P@,(  @, Q@@"p@  X -P@, @, Q@@"p@  X -P@, @,Q@@"p@ X -P@,"@,Q@@"p@T @P% @ 0sH -@@,, ( @- @ $tHQ  @t(  @t sX(@ 8E>@@@py  @ -@ 0L8`@@(p E>PP PPpP P4 -@  Pm8P@ (E>@@@pP  @ -@ 0#-+@P8(G E>   |p< P$ -@0I(@ 8E>@@@kp+  @ -@ 0@a0  @sPYW_ 8 `  PP*P @E> @pY:F(@$ @- @ P= c  4  ( -0@7 q ' P +P  ,QMQuA `( XĔ -@UPQ`0 `up   -@-@e@P#@!!@J3 !@qF%z ! @"@ $!@P   X`(pQ(@ X`(pQ(@ QQ % Q! @ @ 7!@DT QTQTQ2T/Qz!@!@ AP% x' ' (( <( ` /PP P U!@ X= p P P. PD -@@ 00 0*V MP D -@@ 0 0D -@@( 0X 0@, @!@ !@ }!@-DpT T*!@ t/ <$\RX PPA !@L!@SE` .PP P v!@4!@1@PJUETC TP@PU*% o$ X\ PP$PPXP!@j-_2 -@!@!@!@)!@F  @-@M0H-M0@P00l0 P0P0AAЍ0HЍ/K-GMP AN `XfpF 0 `@p`PV`v  XQ: *X`Gލ Q( Q6$`O-$MT (@-P@P -@/dP T F `-P@ -@@/pF  Y a:yPᰰJ`P -@$ЍOP:O-\M@ -@`c]0q P@#p@X: x2P  -@ 0>P P /!  P@*Xp\Ѝ`@0 E @`@0 E @ 0 Mp@-Me@(`@Pj @m -@ R  -@!@0l  m -@Ѝp@ Ѝ/@-@P `@Q 0"@   -@-@& N,1 -@!@@P   -@-@ :1 [-@"@T -@PiA-M` -@P  P-@(p  -@@0 WЍRWP'  -@XW kЍAp (@X0 ЍA`P P& PP  OX7 W W @k(@ 8"@k 7X  C!@k+ *X  J 0!@k     0  @     !@ ` @sk @+ "@kkW@ЍAdk ЍA&kK-` -@P @-@ p  -@P0 WRWP2 -@PW kK?p (@X0 KP( U+edPE!@ `@P !kQ P kU PE@W W @ k(@ 8"@k @ jW@Kj KjA-P -@P  D -@-@@p  $ `- @ 0 V PVR6 PV jA  -@-@m !@-@A_p (@X0 AW@3@#Td `@j@TW:!@j AfjV V @j(@ 8"@j0H- MP0@ 0/p P%  -@-@  0z8 -@P  @dj 0 P!@PZj Ѝ0!@ ~A-M @ -@-@]  -@PX0PP   -@-@ ( 0 p pW4 R  !@-@6@P26 47 \7 \7 \7 @7 \7 L7 &!@#_!P `0 pp R -@0 ' R!@|!@!@Ѝ&0H-(MP8@  0p P1  -@-@ 00   0 -@P P(@@׌0 "@ i!@ !@i(Ѝ0!@ ~0H-MP(@  07p P.  -@-@  0@D -@@P(@ 8"@iiP*ޠP  0!@YiЍ0!@ }O-LMp@(X -@P @HH !@0PP@p@pap(`@pH` P Pw ( D0D`px @HpD (A$PRvp% $PP P0 A$ C P0P @p`@(@ GJg`V(rjap*C Lp PC$ (T `-@-P@Y ,(0*I(@ @h F ( 0 -@P  @hpF 0P!@ P0 0 PhT -P@@p (`Y$ol%LЍ( !@}O-M⼀` `&pW !@0㗸PA@@P P0 @p Rm@W P  0]XWR -@P PI `㩊vp@P(@ @ 0g 0P7`Y-  -@-@ 0&  -@P  @hP%cG@!`@ @pT h h@pT g %Ѝ!@ s|O-M̤ -@`PPV. x x0 pF p7a@ T p` { P8 A!@ XPtOe` 0 `Tp V -@P` T -@-P@㬐  V 0&/!@)GoNC `@xp|x95p^#! @d0g0V V#   0`x@|x 5@^#! @d 0f0  ЍA-M(p`P 0 p8 >{P1 0 p)  -@P(@ 8"@g `V  Sp@!@!P@2 pf G` p @V: f$Ѝh!@r{0H-(MP8@ 0p P,  -@-@  0 -@P  @f  :!@@ 1+S*A;B++ +f(Ѝ0!@ #{O-$MM -@@PP? T9 ᪁P `@Q"@?4P+ PQ_@p"P@ ;'pl Wo QlPp*`!4pPP`@H 0p V -@P? t -@-p@L V00 *9o(@0V  4#V   *0 @0  #$Ѝٍ."PW!@P!@ oz#!@! @qzA- Mt @-p@`PPV #  @P  4 R PP !@ YP^Pc``8 0`Np V -@PCT t -P@V-p@Q<Q  0oM+1  "'  @ 0V PP  0n!!'  @ 0 ЍH- (@  0 @000@0@0^S @CSG-M|ד`Pp@!@@`0 T  0 p ,"@`VT !@'@P Ѝ!@#! @y!@O-dM`@PP >T5  p @(@ |S$ J ! @0d0  d  00 .[<HP pT P <X!@dЍOd0H-P @P8PU04P 4`P8U:!XP0P4PQ8P:!XP00 -@Q -@/$ (@- @!@O-MMP`@!@bPy㔙  @I !p@-@-@@/@ 9TP0U@%PHN P P P P P P P P P P P O P N 4O P TO N N P P N N LO O O dO N P O O P P P P P O PAP DPcPP@Pw PoPi -@P` PZPT -@ -@ -@~ -@z -@P9"@Pn -@j -@fP'`p"pW x (@ FP P:   -@W`-@V -@P -@P 2X WWP @P !@{P "@uPWGPA8Q HR S |R S S S R -@PtOWڀWS  Wb  WFW["@@!P@gqPy `JP EP  !@Mc WD @W ) -@- @0 00  FWp A-@ pf A X]P1!@ w -@P-OQ -@ ) -@- @0 00  s=  p !@C<P)` rH !@g  !@b*W@ !@bT 0 & P$ !@bKb`K-f y @P `@-p@/@ 8tPPHaPp-x (@E Q% Q"i P@A-`@eP( P@:,`Q@T P @wP !@qP@p (@P !@&c+!@ !c`0H-z@p (@P9 !@cv!@ c!@ c!@ c!@ b!@ b!@ b!@ b:!@ b_H-MM@P  V\P/  P*J A !@=$ f !@6$i y -`@-p@PP PP `-@P   `pʜ!@B`Ѝۍ_0H-M@  \P P-@P  -@ pʜ!@APۍ0O-mMM @#@0@@ұP  #@0@ ıP "@g/P P`堐 ;Bbp |L  6p @ $PM P*P @x| L ppe D PoPl @P$->a" @ 0@PaX -@P {!p@_P 7{!p@Zp >a@T:>P2  @#P8$p>" @ 0@`P -@ {P!p@ , a$аX:7{P!p@ pP >"@.PPP mߍۍO-MMnP^`p (@WKv !@@"p@PP P ZP P Y  !@@  PY Z !@P 6p -@pd !@P ` -@P P @}Pi ,P P {`, p-8  ` zP @opB6 {`V P Y &@;" @!0@``.P !@t"/n !@p"c) !@Z@$);" @!0@_@p -@PU P @o!@o WKv!@@"p@#n`PDNY @P# U !@ 0`P U 7 !@ _ !@ 0`WKv!@@"p@ V  !@ 0`WKv!@@"p@P [.P ' !@!PP \]Y] @8t@-@ -@P @P   `p  !@ _ !@?O-M-hMpPH (0@CP#`PT   $6pR@V !@ !`U U U 㾆d @!@[ !@Ȇd @!@҆d @!@P 㫃d  @!@P P(V oPL#T $` p[B~`F1V v'!@ @P0pw!@ - p@ !@! @ p _T$@ˋ `  0P ,XHpP  L?PP 4PP8D0< @D ;_!@$E P]p $;Z ]p G UP$;z]p _P0 !@ ^z% Z!@  ` ^@< D084P,8d ?!P0 !@ ^dPʏ 00 G 0Dz  0!@p2!p@`\C!@ pTR 0 8 9aV!@0pU0R0z&$T T "  ! @BP P -  ! @AP PP o4T.@AލO-tM @R(@1 Q+ p` S@ Q T@:R @ @R ` (p@ A` R @S+ i/. @0S Q: 0Q Xo@.`@S 0pW Q P CPQP* @\A P  @ A 0S9 zoP,.`@P$P \P P ,1Q:pS `P`P0S1 AQ0SPUPQ0pS`Pz#,. @ `iZQ]\Qr [Q|$PPp 0P 1@P,P ]Pj  $P Pp+Q\QP$Q 0 0P 1@PP PQpU pWڅ,Q]Q? Qw P FPyPU PQmP$QP000 0P, R7  QTQ  FQJQH  FPD upE \P P3 ]PpPp1@P P!pR pW"  R  QP!PR PU -@@ !@P + tЍO-M-HMMP@D PH D! @G@Px hT.@@@ @; -@NP@k -@Pg @@ CP: v L4Q C>@`-p@.@-P@!@!@PPh.@@=h.@P8 @]P2 H0.@  P.@ @0V.@o00Q Q$h.@P -@P @`/P`h.@@ 'C`PI2T.@DP -@P P0a PO@P-`@.@@Pl  Š 0Ꮚ@ϊ XPP Lo.`@PP Q RK h.@P> @P9  0 4 -@@?.0@op0Q00>WCp!@!p@#h.@P -@P @4! - @PPh.@4 -@PQP[0a -`@Qh.@PL @ PF @L.@ 0   C @@?.0@ 4 -@p0Ro0WCp0>!p@!@#h.@P! -@P @4! - @[P0a h-`@.@P4 -@@ T!@ZDPQ5 u:h.@HЍۍЍH-Y: -@P  -@ P @ -@&MA-h.@Q -@Q 4q _-p@.P@@`P@`O- MMP4 -@@Pn .@Pi \z-@`Q!p@jp`!@ 0Xrp 0(@+~AP J (@?P !@ 0Wj!@ 0WPp (@+0]APZh$.@@0@{!@W$oPaP nP@pP qPh@.@@!@@.@@!@ W4! - @ !@ Ѝۍ(/. @  p0L)!0@! @0 G-KMp@P7`0BPO PPH.@.@L/. @Q0 DP/oS0B 0 @W[ <.@ P3 9W7pEpHT T - ! @=P P " ! @=P PP =0T.@@8 /-@ 0s!@M@.PZB r, @ R @Q(/. @ VT!@ 0"*(@.@@@dKލ @Y6@(/. @  p0+ !0@ @0 HO-MMP P  ! @\=P (/h@. @.@@ !@P<.@ P T @8P -@KPlu -p@ P@P f `X-`@.P@pPPqPn BP#  dPc L .@P0H.@ P.@  P GP  @5  -@!@ jV=(/. @4! (o- @.`@ pZp/o 0"   @ p0!0@ 0!@d) -@u Q-p@``X.P@P 4 -@ P4 -@ ?P,8/T.@Ѝۍ /-@ 0s!@*K-AMP2@ @VP- `P"@ (+.@0Ѐ``j? pp !p@@pPJP  0`<+0T?p˂ .  -@!@UT.@Aލ-j! @@P/H-P  -@ !1!@! @!0@U.T.@p@-P@P Po`j@P !@P .pUpP j8-@!@0@0 !@ }UpH-/(1. @!0@T.@H-P H -@P -@2!@Hm^.T.@H-% f1- @!0@T.@H-P P(8M.@!@@/oQ" j@@'`jH@@PxP }!p@qP {BP48 .@ h -@ .%8.@8.@@U -P@!@ U8O.@@P h -@!@ U!@ PL  -@ T.@  -@u!@TH-H! 1- @!0@=T.@H-% 1- @!0@3T.@@-LA 1-@@!0@ (T/. @Q8.@H-4! 1- @!0@T.@H-MP Pu Pa P-p@-`@ oP* M!@@/-I@Pj@P M!@@P=P, -@N -@@,ᜱ@@T P jH@@ -@,! ]2- @p!0@W 0: !@ jT  6-@ 0!@{T.@ЍH-0! d2- @!0@T.@H-D! m2- @!0@T.@p@-P Pe P-`@P@j@uP !@oP yA0pʤ  -@!@"T- o200% S- @P SP-@j(!@ @0 !@TQT.@pH-MP2 P0P"! @ i:P' !@PT.@}QH -@P  -@!@!@iP` .@ 4.@ `.@,T.@Ѝ0H-T_ .P@P  P -@G>P0@p n= -@0`.@P `(!@. @S 0H,!@2*$!@ 㠷0HH-MP PP- ! @ 9P O!@P4.@b,T.@ЍO- MPZ P ! @9PQ h`T.`@P @PS5 -@HPP =P4 OC㠵 4 p!@@-@-@P! P P P4.@PP pPpP <pP 5P+T.@ ЍH-MP) PW#! @ i9P Pa#! @ _9P Pi!@rPq!@kP 4.@P +T.@ЍG-Mp`pJoR@!@P We !@㡒P!@ @ <.@PC WR !@WCk @;p`pZ!@T2PPP[P@ሶ@=<|` ቯ V =`P, !@=P& ; 0@  y%V ЍG y-@!@0, ЍGjW`pD+T.@ЍT.@O-$MP Pʨ  ! @8P P"  ! @8Px @@k @TP|Po!@@IhT.@PP @4@ -@FP @P@ C㡒[ Li-@!@@ @P@!`@p @[0P- 0 ! Sp0p [0$P -@Q 4! - @`P4 -@`Lih.@!`@P 3P *T.@$Ѝ?<P !@mPA-MMP @3PCP `P@FP3v!@0t*T.@ЍۍPPUr3 @pR P!P@/PሷP+j -@P e -`@XP @   QT ) .@0 @ !@0T.@ Np@-MP  P$ ! @7 @P: *T.@Ѝp!@`P  P!!@\PPP@$P,!@@T P4!@\PPP P>!@s@۴m`T @oP  @>!@]ƴX -@8 -@F!@0H-TO.@@P``\.@.P@PP<P  {-@`,!@. @P00H) U-@!@0% 0H蠴0H-TO.@@P`X.P@PD:P  -@`(!@. @mP00He) *-@!@0$ 0HzH-MP+ P)P$! @ 6P !@PT.@}QH -@P  -@!@C!@P4.@))T.@ЍH-MP+ P)P$! @ 6P !@PT.@}QH -@P  -@!@ !@P4.@(T.@ЍH-M P P%! @ ]6P  !@(T.@ЍK-M@P +ڬUpE` "@ +㠬V +㚬`U !@KP4.@ۍH-M P P.%! @ 6P H!@(T.@ЍH-MP P-! @ 5P P- ! @ 5P PN!@P ^(T.@Ѝ0H-P HA  -@@PP _!@ I(T.@0j!@P00H- @R:9(T.@0HA  -@@PP x!@!@P00H-P HA  -@@PP !@ (T.@0!@P0@-PQ (T.@F -@@P  &P KH-PQ 'T.@ -@P!@wH7H-K@-M P  PP@ 'T.@!@Z@P@>!@RỲMЍH-  -@0 -@Pl& <-@.@Pb& -@oCK-MP P@%! @5P +-P p  -@!@1r'0 -@!@)p P  -@@CP   @k0@(& -@P P -@!@Z&U0 -@!@NT.@Ѝ_ -P@@dP `7@ ȥP 9P@ 2/<.@P% 0H-H/5. @!0@bT.@H-% 6- @!0@XT.@0H-P PPU LO-@.@@"!@T.@0&T.@0LT?.@@ .0@ X .@ iU.@0 0Hު0H-MPH P PO-@.@@/!@T.@<P3:&! @ ,4P. P+T_.@.P@P/. @ z@ -@P  P  @m@+z.@㚪 P z.@+㒪P x&T.@Ѝ0p@-P P%< ]-@@1 !P@-0@/oQ" j@ P@/`jH@@P ]!P@P "@P F&"@ -@]< -@!P@ @ -@@@ -@P< -@ A-@!@ 0'M< -@T.@pH-H! q6- @!0@ R0|! - @iT.@ -@H-H! 6- @!0@ R0! - @VT.@ -@A-H P-@q6|! !0@- @P@0@T.p@6 ! -@`!0@Q`0- @/ -@`H-@/6. @!0@$T.@H-D/6. @!0@T.@O-MPPR@Pڲ%Ѝ`p"@P "@P "@P`U 9PJ`U 9P..Hq -p@ Up -@l -@`T P l  -@-@0p -@j( @!@S !@_L Ux -@t -@`T P t  -@-@0x -@j( @!@S !@=LE. B.H- oT.@H-P# )!@PT.@}Q H -@P  -@.!@"Y!@P` .@ 4.@ `.@%T.@p@-MP P@<.@ Q (_e P.P@-`@! QJ R  ^!@K$T.@Ѝp s-@!@0/ Ѝp@@0  !@ Ѝp@K|!@Ѝp@0H-P HA -@@P!@LP0$T.@0G-MP< f -`@Q -@!@zP-'! @ 2P( P%4 㤅 -@-@P !@l .@ pH (@@Q.@  P PU%P a$G PzPxpF p P  U2  UR3 PW AQ rx P p AQ `x Pd!@&T.@ЍPEB!@0H-MP ! PP-  ! @w1P 5@Pp  -@ !@0Jt#T.@Ѝ00H-MP & P$P-  ! @H1P 5p  -@@P h860!@ Jq#T.@Ѝ0H-P P #T.@!@H/!@H*@-; 0@@P -@0 !@@}JH-MP: P8P" ! @ 0P/ 5P+ @!@.*PPP[P@b`_`4 pc"@ / +T.@8#T.@ЍO-MP = P;P-  ! @0P2 !@)PPP[P@ `3|@ # 8(oH .@.`@ -@Ѐp0Pp!0@!@pPU"T.@Ѝ0H-P&P@!@ P "@P !@PPPP7p 0P  -@!@I"T.@0 -@ 0-@  0-@0!@IA-MT .@  RP (@0S zU 3I`!p@-P@!@@ QI0`SЍA~" ЍH-@`p'P PP 20H -@0PT R-@!@ HZI <-@!@ HRIp@-To@.`@P'P PP  -@i!@8Ipp@0" <-@ !@p@+I0H-P <.@P HA -@@P !@P0"T.@0 z -@!@0, 0H%0H- @R:"T.@0<(. @ R HA  -@@PP  !@  -@!@0, 0H !@P00H- R<(. @ R HA 0-@@ PP  !@h!T.@0 -@!@0, 0H׬  !@SP0O-$MMPQ !*P' ! @/P  -@`VlPp.P@@ bP pPVpW -@ !@}HT.@$Ѝٍ -@)ㄥl.@ P(p@ AY I @O -@@p$Q \Q Q@  00iRU -@ A)L=@ P 0 0@  AQ`/ - @ B)&@& -@&P @p  -@!@ -@!@ P  -@P -@!@T.@ YyH -@P e  -`@-@P @   bH` Ҥ -@`.@ 2/.@PP -@)㺤0& -@.@ -@ @P  P )H[ PUO- MP@ -@Q<P  -@P ~P @n)H @j)P  -@Pp c Ѝа 㬕 X :-@-@`-@P P `PpW k @iP|P PP ~`p@-MP!@ @ƟP !@ 㿟P !@P `!@ 㱟P U PP 0PЍpp !@&PPЍp@= !@ 㑟P F!@0ZG- M p`!@ ڣp'0 ê P/P:P# 1p P P  ЍPP TOp`.@@@cP)`PXᖪp pJ0 嗣 "@ c"@ ㌣ /p堬P p/ P :㔬P p`// PPp{T.@@cPP  !@PO-M-^M@p|xppptppppTpppp -@p|pxxplphpwdpp0pp pp:X P-@ p (p  (|p |(xp x (P: 7<xp 0k!@  p xR/|dN/hJ/Px(UlpP'PQTPQUi UQ 0/ PI Rtp tKPP 1/PP x* d( ; 9 P P P P ^ލЍ !@ P  !@O/㠫P..PPP6I 0.@؀0(/0\ -@pP. @`P\0X0 P(/. @P4-.@! @  @ 6P" 5P@  .p@ \X(_.P@ 5  p_qYH -@P U -P@!@ E(.@  !@E  @ -@ P `L@QpQ P  @&Tx @&E -@@Q+ p -@-p@Q P 2 -@.h `! -@|@- @p |&|$P@P& -@6PA  w/$peV6 "P5 W3J@ Q;Q @ qQ Q@㸱P&W) p@la P-`@P j * -@R ? -@0  R (` U/? (`` 㤅 -@(-@` R 0p -p@  S 썢Ρ0 A5P ` P 0( 0 pWp  dp #PP   XX`ᤅ P-@8.@P L ` -@h -@-@P ,P P P'@A,P ` -@ X -@R 0ES 2 H0ppT0(0 -0@@0P} `#p @P  P  p  R `@PN P @(.@  0 %0&   P 0 '0* /. @`0 P& #   P H -@P  -@ 0L!@٦Y !@"z !@"4-.@! @Q PP'Pn/0 pP Ep-@Px|` C0uTpp55505w?RPL@T P( !@xPD"P R +`vPn"@KP  Pn_"p@:$P!  შP j fX -@Q Q(P IZ:$ AP6 PPxpkWܥZ^ H p` bj_ @-@!`@ v   00 0p@ ὨP  # PP  -@!@ 0A p0 Po2 1p  m[.k?!@y%p o!@ 7!Z {0!@ ;`* `P (UX L@-@U ¥TP UU ᴥFP P Otatp; @#U -P@|Q<#tp!@v2T4#P<}#H 㤅 -@-@P (!@ vAPP H -@PF x0 !!@! @bA;x| !@ #!@1x5!@1C!@1 -@P c!`@ p1P(o.`@ !@> W!@t1 l!@(A  !@d1d -@P 1!!0@! @QR1a!@!`@P弛P  !@E1 !1!@! @!0@<1똀Gt p@PYp`Q`U H -@P !@ @(!@ 1 PV @ H P-@P !@ @P"!@ 1PUH -@P F  @@0x1p `"}`P(p@g* @j?pPH@@@ P9 P B7!@"u gP pn q Q% / ( @ @p  0 P 0 yp (@XsA0  Pi)Hp n?@.pP1 0P  `N8 -@P P Q)P Q) -@PUl`l[ .`@ P@pTP `pWGPL!@ PQ!@P[!@Pj!@P !@Ph !@?!@P"!@P 4!@P (@n? <P b P /Q. @J 04P 0P ` } @P} *Q. p P00Hj 0ϊ Êc+Pp Pkjn/\Xf(0  0`c!@Pm Rj `QFJpP-Q@j  0QJ0PpP @/P/ *R` j 0`QfJP(.@ 0` 4HpPP vw(00`4   (@@ <Pn? P 0p P `   0P\ 0 (0)' * /. @ L!@ @>P  @PV #QPT P (.@P !@x-P x`%ႢP /!@v!@ je0!@  po PPPo!@j_8K@Pq m 4pP @WP_!@!@+!@(ׯ -@ "F!@<!@ -@!@)] -@.@uZL!@t5 H!@j!@X -@8(_.@.P@P< L -@P7 P 3h! - @ P  @P  P #P @  P8Q Q(.@   00 >.P !@EFX5 \0@ R  ! jO`nύX \0L1/`pX@p+) !@= pP p 0.@ S  @ 0R= -@Q !@  00PH 8 -@1R>P  4 -@!@~= 4px0 L-8aV P "@㦪P& h G  00/DP" D`!@ #=9P  4 -@!@?=4px!  00PE:!@:!@`  004P6p  00_ 0p Z P P 00I 0D 0pD[!@l 0!@a0  04PD`p@@ P0 HDV @U <` X PW-@ W W%x| !@4 p  04PD`KPP .>!@! @!0@Y፭O-LMM@P !@ 0P(P,PPPRPEP  %@PdP 5 -0@ , %P:UP %Pk (0!@Pp ,P P PP+ !@UP( LЍۍ`P@VB P@P= /c PQ' P/ P(PQ ;QP ;P!@_P. C!@YP5 K!@SP3 !@ {4P"@  `PQ  @0 -@P! P P``U P !@㊙PTP !@`P``u `f -p@-`@@@P @&8+ Ԙ P8@<( @D8A -@@p8!pP P,0 c"P X `X8qp ! @P !@>8V`U0 [.H 48p"@@.@ `P /SP``{ P P +x@@Q *4/tq -p@ `P4000S) 0- @0 phP P `'!@PU #`-P@4 4R0B0 po`p W w9SZ!  Q @P  P `z h -@ 0!30@+0 @P  P  0P @  P w P  py3 v3Z$ ` V  @P  P> #P @  / ` N34@ '!@0 `@  P 4!@,P ,41/40_0$#$3 '7!@! @!0@+0A-Mp`!p@ P᪟P p DC.@> !@! @Q  .@pW \X.@.@ pPpQpG.@@P h!@PB  -@PB P   !@-@P -@'P<  P-@&P @( -@@@!@Qe P-`@ Q PQP  U -P@Pg \ g -@ !@ -@ !@ T.@ @(.p@   0!@xP9 "@ qP2%y   0!@`P "@ YPD `-@@ |  u  -@!@ 0`1G f AP@ o^ P P; oQ ] -P@P .@ " P p3 !@PT.@@P. , PT.@ cЍ "@ P  "@ PP P  -@@-hM  -@@) -@@4.@ h.@@rP sP]!@T!@@d *!@d   -@P_ -@%c!@DO-M-KM< s -@(J T -p@P-@@-@ g @pIڰ -@ 0 }Pp| -@-@P=  -@P8 H -@ d 4`3 B  S ⑖P, Ha -@-`@S `30PP? !@uUP Z -@P -@!@. @/ -@PZ Z  -@P  0`AO !@PPI -@P? Xp``PP -@m!@P#!@@@@' !@ !@@P0 @ !@U  @-@@@KލЍP>T.@P? @ P< -@!@T.@P @ P -@3 !@PdX l0  Z p`PF.\0-@!@S P@`P\PXP  -@!@dl  00 c0-@!@ppeSPl$! p4-@td,d(hPxt$ 0 P3?( SB  -@ !@s -@!@FS d000 -@!@.S !@QST QU QV Q  -@%@X@T -@u !@ -@ `0 C (Z -P@0p@ -@P<l$!p4Ptd,dh(xt$ -@0 3?( PO-LMT < -@-@Q LЍOqZ @pH P pA (P (-@@m, PP<@b`A(,   00S( 0B 0@SCC?7 /Fp P #P f !@ P  !@@LЍ -@ <Pp@< p⊟P #P   p P Pp =P0  Y@ !@D O-LMpp`Pt` ǿ@[ǿS-@0PW 0?@P~@   ,pp-P )#P  pPJW PP  @p P #Pf @PJpGPWppP  #-@ R Ւ  0QPr" @P  P P ء ?$ R# P- #-@W@w 0 08 (P0S4$pEP/pp r^@P@@AGp㛞PP(  P $!P5 -0@  @P  P  #P @   -5 -0@YmPowLЍ#-5 -0@O-AM`h -@ .@/@` P-@V(! @M4.@ D L! -@- @@P!@oH -@,Q P(PZ -@PPj -@ Q P -@o!PP@Z U -P@P @PT.@p La p-`@p  ~TA -@@PJ`A DQ -@@P-P@P 1/P MYp[-P  !-@!@F,X  '-@!@ =, Aߍ @= @9[ pZD.@P P k @SP|Pw.p@P .@Q  T.@0 pPu Q Ph -@ P_  -@ `A P-@@  @  -@PQ 2T/. @0P0K H/p@P < P0W @W"@t/ " @P"@gpD.p@P  P|p?P  Pm {G!@ (O.@@P XP !@ 0!@P "@ P @Py [  u+P(  @4Y!@k @㊘P |P P  @'P D -@L -@P @ @ BL -@D -@p (@X P@pH  PU -P@Q -@Q j -`@P e 80.@P L! h - @-@ R @@Q,*P lq `-p@ P R * - @0 pP `Q P-P@`=; P v!@ `@3`Q P-P@`.P@u -p@#` R0B0 W P] P p]} 0+MY#  ` -@@T @P  P `ޏ  h -@ 0- +`A -@@  P0U  E  PWP UP @8 @P  PѲ U u U   R0B00R p R 00`! - @w*D -@L -@Yx  ` -@@T  @P  P #P @ [ W0 p P000.q<;!@? `Q `-P@W 0 P,JPP p ` R0B0 V P pP`pP`W  0Wp !@ !@n 9*`Q -P@`@  P v!@@@ ;!@ P 1/kVP E -@@!@k)!@r V R P D -@P  @PP}0 !0 < 8 @`p,`(p0P<p A-@P80!@ +)#)'j'>!@! @!0@3ҘG-/P/pDP @"@T`p"@"@U`v.M -@@+ .  V(M 1dp1P-@@pW! u `P9QP0PPJu0QZ.QJP G!@,@ -@k !@Ϻ0H-hM@  -@ P!@d Dž  -@P -@H-MU@.P@PF oP  0CP !@!@ (.@ $TPP.p@ uʴ !@ -@PT P+PPPP ۍ !@ -@PT.@ۍH`@-齙  @-@7  -@尙@G- @-@P @P5  -@T Q8j s -`@-p@PQ c 8z -`@-p@T6 .@-0@P@Q@  ,A_ JeP-@ PE_ `-@EO*a EA_*EU.P@$!jd@ %. @j@P(QW.P@,$A@.@JA00 -@,AXO4.@@4@.@(188D.@0 <<H.@@@L.@DDRɄR ńiOYQ.@@ 㾄 㺄PzO.@l!.@@ l+㮄+㪄zCW.@@+ᤄW+㠄  P G/@-  -@@s  -@P  -@ P @h$ .@- @@ -@@ -@5p@-M@PT 0S00U 0S 0100 `EP TU T@Ѝp@-P Q  -@ !@)T.@E.@@ PJPdP !@hT.@@ -@ !@O-4MM0,j@!`@,$ -@!@  -@@( -@!@,Q  -P@!@@吁` P-@8 @-@@!@0 -@4 -@PQ < -@-P@@ -@@D -@H -@@L -@@T -@X -@@\ -@@h -@l -@@p -@t -@@| -@@x -@ -@ @ -@-@@ -@@ -@@ -@@ !@8P @ -@+ፃ P* -@ @'P@ -@ !@P. @!@P "@P  @P "@P  !@@ -@@ -@< -@啗:!@mP  !@fP@ -@< -@? !@р P-@ R`Q PI !@x"@㻀P !@<P@@ph _(`@P X -@  -@ PP H T-@ PL -@ 0㐭-@ !@0`0,P q4p@DW] @ 0K V TM V V V U V V V V U V dM V V V V V V M V V V V V TL V L V L V M V L V V V V V V V V V V 0N ~P  !@ !@4~P  !@ pO @@yv@F  @@qn  @j0P}[,:4P ,jPs  -@%P @PH @L,@P@P `P/@a!@/@?Q  D !@0!#M!@`pP+(, t-@pu T_-p@!P@ DV @-@@0V P R P   -@-@@"7jP [c0,Up= -@ @H @G !@ !@ !@ w !@ ?@0 @ 7!@w6?0!@ n6 P0 ,@  -@P Pq00!@ M6O- M⠕ E p f T-@-@@(@-@-`@-@ P@P uP  b"Ň )0 p P Pg.@P  -@p pP !@_!@G!@ P  -@P!@/ P. @ 6 -@.@ T P@2/.@PP P @P  @P  P " @H @ ЍP P @   x"p@-V -P@P(@P I`!@@P P!@5F.F ! @P-@@ pp@-@P lP(`@P P @pp@-Z -P@P(@P L`!@@P P=!@O5F*K ! @P-@@ pp@-.@.@  .@-@U .@-P@o.`@@TpH-P+ 4&( @PU& 0`p@S`P`V p`V V`Ap Vp `PUWO-M@p` @UV2 PPV. V/BU @-P@ 0 -@/@! @S !@!4&( @P  `Q R [ +`Pl ЍOЍOV0 -@!p@`P p!@ 0U 0 3!@ HX ` } `2/Ѝp@- .@.@ .@0$S!S0S S  (@(@!Rp?.0@ 00 0 S S S080S S0?.0@ 00P@` P\V "V `V "V ` P`V$ ` P `!VV V VU  @pS  Sp /. @ p 0H-P @(@P PgP PP!@ 30!@3@-M(@@p -@PM@o O-M-RM(O㸅Хp.@@.@.@U.P@ e J  1$qS(apPPVp` P(-@.@ `0T -@* kPp J `0P P LA P-@@PX zP Z.` P4`0`8` ` EP. A`0` PP.` @P  @ 4`4`08` ` EP cP 0O .@@0S (! @`   p.@`PV9 81 A ᠋!80 A8"h! @  _ dUdP0=`.@Q-@AP B@DTEx$# @ ?"! @P!@2?D h `@ PY@p:0 6@ uP[p!E:R :Wp`I"#@h! @ P@P.@(A 1$q@DS H8 -T=IB`q PJ-p@@ 1 Aᡋ0 P @ڄ70 A 0 QU`u*P#p@ :0 %Pk@!% :S0:`u #p@` &ed a"% `V"1! @! 0e P.@ R4@X)@& R #:Px"e! @ Y@(.@ R7`p70 A@1kG@ p JT `k"e! @cPZ)e @[P -@ P RߍЍc PaI* p,e" @?FP p"! @?e5FQ%.Ba(/O@b"(r0r 27"cA"! @qdP`ꃏ @"0! @p  -@Ph  -@ .AH- M  ` A ЍH-0M0P  B ,MPC0Ѝ@-Z@V@O-M-JMH -@PL -@P/ F` Q.@1Sq@E 7 -T=IBJ 1 A` -@㡋0@T@`p 60 A 0 Q7`pX p$⏣ 4*@.@! @ "! @ 0{ P@ [".L! @F K @ P !@1!He0c딹kP IP?㓰dP:"e! @OP"O! @` pp7ecDp< V 0&U@  `U'p*S0`p:R `5#0@!?#{ 0"0! @@d0'5;A0h' @`[ ` -@ pZ@ .@ Y (/. @ P@PPP )f @ [ -@P8JߍЍ .AP26@P -60 A 1KEI > p * P᠟P#g"f! @@ U:"d! @ 0@"O! @` pp7dcGpq.@Q `W  0Pp Qp0S"f! @`@-` @-@ R -@P  -@ P @@O-kMP -@pPi  -@ @`@oP.@C 6p.ӫ&P!@.@ !@ eP2 PP\ P p0SP  P @Plq q 8r r EP p P .@LP  .@wP !@>P PPJ?P p P.@RPPJ?P p P.@: -@Qv -p@Q A  H Q  Q Q q R lp.p@P PQ Hp  (@@ U P.@^l.@ l.@ v P-p@ PP P l.@ Z{Q A  H Q qbl㬡.@.@ Q HpP q Q  l0.0@ 0Z 0ZS P  Q?JP!@T.@PPꈌP  !@-@ep Gp -@!@Gpkߍ -@!@ -@!@!@Ru!@!@LC!@I -@!@A-U@.P@`  P,PQ A  GP @Q:p ("P&e@.`@Q A  G\P p"P IQ Gp< F@Ddt0E`.@@|Q A  G[P \PQ  Q P ,P Gp D`Fdv/!@@DF@@.@P} |E#@P .@@@}P PP @k@iH-`.@PoP . ~@P pdP `Gu.p@ rPoB@p@-MP4 V -P@Q TP.@!@  -@&Pʍ!! @ wQPa $ -`@,1 -@@-0@R0P0R  -@P R {!@-T.@ЍpP PH -@P  -@!@  -@z`.@"@ `v.@!@`.@ `.@v .@"@`.@ v .@!@`.@ v .@"@`.@ v8 0-@.@ Q  Ѝp@@K-M P-p@`~}뤕 @-@ T!*!@ k` `0 @p (@p /-@. @ R `Ѝ!@UG ~5!@!0@A>O-dMPp@Q`PP PP `W P  -@P V !@U {g !@|  0ppW% p P-@-@(@ `0S c !@r !@ P 0epPOpP P -@P |P|P pu  @ u uP 'p!@[`P> Q!!@$@P@ |G ,!@C P@|<T!Q4!@y$@P@|)P< >!@"P@|`@T-QP>!@ P!d@.@ -@P' -@d -@pWOlPlk .P@ `@ᎅP7 PpWB!@@ ~ 9!@ 0@@T.@@P  PU 7|Ɉ P  PU )|ỈP ~dЍ -@!@)%u -@.@S`X.P@DP`.@` .@A- HQ -@-P@`P!@P\q㤅 V.p@-@ @!@ p P:.P B!@0@!@ pP   @ {pP  X-@\(.@. @Q V) .@!@ %OP!!@㶩.@\( -@X.@. @Q z.@!@ tV Zz'!@. @Q V  R `Q   Ѝ/O-\MMp`@Z    7 4vwP pP !P@7$m m -@P P R PUP Rp=  0p-  P)pK ⼥ <-@8HP Q  p4  qt!@@!@ @7 0w0 @   4 wP p !@$nmԁ@!@\!@Tʁ$P,8pP! H@b0`@@S 0B0@mb`ASCc?; / 㲀ᣴpP #P !XAQ!P<` PT0 㰵p ThVz `y`!@7 V\Ѝۍj0H-@Pl0H臵p@-`P @@}P "@}P P !@2@@pH-`PH!@#@-@tpq!@ #MO-DM@h h l0 [Qc 0`뼵 0-@@B ӝ4 `p@@bA04P I(80 S0 0B0@SCS?8 /pP #P "P  庳P$ pۀP ׀#P  Q  A<@ǀ@  DЍOЍ/ @/(/H-M$Q 0 ѴЍ0H-@㟳P JP0GP @P᧳0p@-MP`0`6P @$`P ㋳0+㣴@ЍpP @-@偳RPN@/O-.@ ! @(0@qp `~/`@.@Qb pOP0@ Q0* 0@E.0>! @(0@L`p/`@a@Q8  ( 4 \ x .@EP FP3& @ P  @ P  @qP ;PP`"@qPn  @qPm  @qP.@ %.@P.@PK`.@.@P`/AhP0 `=Po    m0 0P] !@aX8.@.@.@Lp;hP*F "@ 8.@3~x (@U SQ.P@}QA!@AqP .@@8S.@.P@8.@.@C @@tttt@0A/.@@! @ pK PN p (@@XP#@ @P p.@oB@(@ <`.@AlPP XP#$PPNP$Ѝ@2!@TU!@OF!@Ju!@E _!@?!@:f!@5!@0!@+!@&H-p @(@0 !@lg6H-p (@0 !@`g*O-4M P @Nt`oЀP.@; p `@`.@.p@.@`P/ P   .@Pp Q ᢨQ !@`4@P`@tP@4Ѝk .@P X% @B ɨsH-.@.@G-Mؑ@.@ԁ.@P @zTF!@m]@P ]!@g]P /Q`d"(@! @ꪱ`(@ )P6J fO#@P#`@"@ P`Q.@P QD.P@ @ ᥵p 4W .P@!@ ᛵp 8W.P@P0J!@: űP)gP.`@P /P:@P400.@@.@.@.@8 .@0R4.@.@Q wP.p@ RP .@P b @: cP.`@`'. @QQ P Noo0.@: @ "@^PO(@@:"@: TP!@l: LP @ : DP"@ : <Pa"@: 4P @,: ,P!@<: $P"@<: P"@: P@:  Pb @: P @: P: .@@P L.@Ql(@@.@Qw(@<.@Q E!@D.@Q  @P.@Q "@H.@Q "@TG.@@!@ ჴp!@XG.@@ yp"@\G.@@ op .@@@T ,eP.@@Ѝ!@!@ K!@u u u p!@!@!@G-MP@.@埦.@.@.@Xr@1nPS.@.@PK.@i@#. @p.@  O@ =#.@!.@.@  @q.@!@ !@R!@_Vp.@a PdU C.@@ PJ pʔ!@\,iP!@I&cq2!`@.p@.@!@ vP 0@ Q :p   0@x (@EQQ@U4  (@Pd P:E!@  !@.@A.@@,E]P  @R0.@l#@@! @ S P@,q)q&q#qp P F!@U!@p (@Xr!@Z|P(@.@ @FC.@@P _(P@PiP PO(@@P   !@ y!@0H-&q@p (@P !@7!@ H-.@P #H. @㛥ᥥA-oP(`@ATP Hv.p@P @ @lP(  .@``@lpP"  @lPP >!@lP+ "@lP p (@㰀!@ fd.@Pp {[(@.@ jb aF`VafaFjBp@-0M cP.`@@g .@0   R/(@  PRR   w*/Or  c/ R !0Ѝp@#. @!O-M_G(P@P UFa  @.`@.@w!@(@l Y  ' p?oR 2 0Q Q Q P h @ P ~ oRQp\P R R P   (@ P #. @!O-M@.@ @op o#`. @  !@.@]PpH P(@@P+p p PU@#. @  doao.@P  @oЍ@-@Po.@@h  @~.@-H-M(@lpp>X=(0@ R `.@p@r R VQ  `RpPwP" .@ Pw P:P .@p^ .@P @ ?  PP!@.@<1/ЍH-p (@Q p (@+p  .@Q  P:P .@^ .@P @ ?  .@/@-5.0@0S R .@0@^@@@poP "@@!@ Q0S S /H-PU* $3. @!0@\^^O` pW p`WU@PPPPPU `BlV U@`P.@.@O-M!@X(@P> 㐟.@Eֳc p(@.@@^P!@!`@ WP)l P:P @P?P t W P:P @P? W* 0P ] QЍ@-G.@.@@ [.@ @rG-BMc.`@ i Xp@P Z Q UP:OLf(@@G0.`@ S P ) XL!@P yn.@ Bߍ(@o /O-MMPmmA @@mm .@.@OLp `.@(@@.@P!  P$! .@ PBP SP WP.@ à.@ ۠o aM .@+ˠPP>3`.@P   Q: ᖠGP0S* P* U%P @q_Q:|P  R0B00R P 00P U:u ʋmP X3 "` `3H-G(@PL.@P (K-M␏(@P @PT VP @P\1]$ @! @ @P! @  DP qgd.p@ P!`@P  aP  +P(uuۍG-p"@hPY y㬄!@!@ `=s_P @=P4 P@hP@?X_P #P @ 7ᔁ!QP $@ RP pVdG.@@Ph  @{O(@@P  @ 1P A-dg.`@pG!PpX p(P@ @p`pP @P` XX@X p#PpP_@PM \ | @E P9 d'P/p 0(@0`p Q0AQ`0!X X ! !@" @ P p@^X!^!@#Qh  @Az0H-0SS@7n@!@sP\U  ^U%0S! @0C@#0 0RP00C 0R100C P0U!@00B n@t@S @ T^0@0@00SS S@ 0p@-@`P P !@gPgp၀@pp@-oP(`@@P gP P |gP @pH-@P # p@P6H `V ZgP' P{}P    P !@Hy!P P P Q !@p@-0M@PX O(@P !@+p (@XB_ cP.`@b   K3!@ h[ P@!@ , =R RP] hK @@ @P7 !@y1P h@.@P (@&P!@0EP    w"@!@  ]  @!@!@!@!@0ЍpO-Mx CslXpB.@@!@D .P@` 㩝@  > R (R( ṝ0]PO]P K]P   " pWw!@q`ЍO- M@ @-jhlw㐯  `.@.p@(@.@PP, y   ]P  XPP jip Ѝ0H-M SxD.P@@B ͞-@ Ǟ8kP# !@0!@ !@0P3P !@2!@ @ D㤞m!@ ? 㖞2Ѝ0H- h.@ @ HH-!@h.@l.@O-{MMPi`@e똈㔸P.@.@ @eP @ePfq㜘!`@(p@@.@  1@ Q*0@cP @dP lP nP @@@p VP x (@PPa@p Up-PP5 @P$ pYP iP\P⭮PZ  ].z@ ԝP p & !@*   P  P5 !@P'd!.@P$^pPPJU̝P` id !@G !@@Y -`V 9p3 `PP` 8$!@" @0 P.#z@#%P-PpY U.PPp'P%'  @Ew{  @p !@7GX`+P.@T  PPPm[PP@` !@dPQ P.@P  śP p: !@qr !@6Pc !@p (@1$@l 0|aP.@P-㣛PP㰛qM .@P 0<!@Rᛛ9 0`WP匛P !@V ᄛP !@0 % # P`P \p pʜP  !@P➜ !@ @ !@ 0 !P  ኜ) !@ F7@ .@H-p (@Z&@# @@-p (@@Z&@# @g !@p0H-Mrpڜ.@P !@   P 0<>  @P@ ۚp P @TP@dP p!@Ѝ0!@ 0!@ MH-M  .@QЍH Ѝ/K-MHP.@@`P !@u 0@d`  @p  ㆚P p!@ @!@I@p !@00PE0`T  RJ@T` `@0d `@Vp@p:O0  }.}b@` '! @0. P @ @p (@X!@;"@Ѝ MH-M  啷.@QЍH Ѝ/O-dM$Pp<P `H6P P( (p @(p @ @8@@,PP `4``PLH,oZ  QP X ( L$(h(PҙP p5,@,X [ ( l  H h     `   XXY (QH(, Bz(QQ,H,*(QH,!(H(, P (H,( @ P w ( H,(C( H( ,  P b(H,( @ ,  S ( H, Q(   E (  H, Q(  P 4(H,( @ )'(! @80"dP  (dp(8P5  Y .( Q(X, Y Y( Qr(H,P ZkP   x   ( 1!@8p ` `o ~ Pi` ` X(m84Y[ <!@n j!@j`'!@` [:(mxvPdЍT&W!@J!@!@z!@!@!@!@!@!@!@!@+`t!@$.@R!@!@ MH-M  H-rpq#@W P` p P pWPdO-lM$(DPAU@P!@0P P6#0@ B (@ B,p+0 4 C 7< /!0@`@ 8 00  +sP !@p] ,@ ㎇0@p@P ((P;@202@DTP T)P*)Qk .@P  .@P.@P, !@/VQhdD .@@PD k (@@E_P1PV !@V"`D\egP%g 0.@q  L .@Q)P E .@@P 1P X .@Pf1.@ .@Pz !@eUU T>T:@-p.@@@.@@.@B&P [T .@P .@P (@%6T<&%Hgy@-@U㴫P @#H-髫PH- @U Q Q/@-0SR PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SG-0M.@ P  㘃 .@Z.@" PYp$L.@Q .@ %KP P+P;PP KPP P`[  .@oT .@P .@X .@b P P 4 P4  @P>9JPP4 2P50PKP# P, 'P P&! P K P KP nP K P      P/@Py`.p@0`Ty.p@ 0X9.0@   "  ./O # 0Ѝ0H-Mh Dブ\YP.P@ @ !@ #P v@P "@8P !@"P v!P( @0@0P`YT.P@ !@"P v@@ !@"P vP@PPЍ0C@@P@@-@P @fv .@P@H@-MdI @.@@R@! ! ! ! ! ! ! ! " ! ! ! ! ! ! ! ," !@(Qd   !@ !@ !@ !@ !@ !@ !@Ѝ !@Pd .@ !@P0H-@PGP0 .@Q 00HHG-M !@O"n"o(@"@F"E .@@P "@ .@GP !@PU "@ .@ !@ .@ !@똕 .@ "@e .`@"@ .@ !@ .@r @B% . @P% . @ % . @.@% . @% . @% . @% . @% . @ .@  "@~ P.@ PR/@ @qJ !@@P.@ !@fP .@ !@] .@ !@VP!@ .@ !@KP!@% . @.@ 5 u .0@R.p@ P P$ !@3 "@.% . @Q .@!@P .@!@C  @ P.@P !@ .@ "@  .@R PP @.@  !@ P.@P !@ .@ !@ P.@e u .`@.p@Q .@!@ '  !@!@0@& 6 s"@"@. @.0@[& 6 !P@J !@. @.0@& 6  "@. @.0@ @P .@@ @V P.P@ !@PPz "@ @PU`PQ  `G `WR *,! @  .@  "@^!( @ P`R PQPR \ `.@ AgGƺ `-R h{ p@ b$ P.@? @2P( .@ @)`c "@$V@P*Q! @@@, .@@P .@Ѝ@-@TP 0PP .@Q@EH- Pp@`P P !@P!@G-P@Q P \`.@%QpPX+ @D\Ѝ\ .@ .@0H-O .@P.@P;X .@P\ E .@.@@P  .@P  .@P$ .@~ .@\ .@P\ .@ .@n .@P \ .@ .@b 0 .@.@ Q \I.@@P0P %OPU0( .@0HF$ .@A( .@<0H-0F .@@P0 .@P.@P \Y.@.P@P  .@!\ .@P .@X .@P .@ 00 .@.@P/  .@\ .@, .@/H-  .@EH .@P/ .@Q \.@/ .@PN\ .@ .@ .@@-| ( .@$& .@. @Q 4 .@@T   .@% .@. @Q @5  .@% .@. @Q @@- !@4F .@@  .@  .@  .@x  .@p0H-P4(@   .@P` @  .@  .@  .@P  .@ &<4 .@@0H-MPpPP' +P@p%`O-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 3 4 4 4 4 4 4 4 4 4 4 4 /QPB@ Q*@4 4 4 4 4 4 4 4 4 4 4 4 /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 bNPJQ004 (@`/0H-0Pq;P @+PP+P0H0Hx0@-M@P  !@4XP$  +P PPJJ !@PJ J !@ QP S!@S[QJ[ !@zЍF !@Ѝ@r@-4@(@4&  0. @0 pP@4$ ( @  1 `! `@o/(@P . !@&M .@ H-@M@(@P! 8f .`@PU WP! P PNp"@ P 3, P! @@0\p@Ѝ< .@  /p@- Ma (`@P P@0A@ ЍpPp#@/K-`Rp@O r P T f !@Ps Pp PpEUT  @z !@T !@ !@K%N눅 @8/p pPw p PWpG8/p !@PTPs K.0H-Qp(P@@p !@M@00H-A(@@P0H@ .@ RD& 80. @ 0  r !@NS .P@p  NX.P@00H-DV @.P@P =p 0 (0 ?R   0 @ 0O-Mȑ(@P3JD .@ 0p`/)0S0#&ၹFP!@`pQ !0# "  WMp 廍P` UЍO-MD @.@pW% `PJVJ r P@Ơ   0* ) (EЍ %"0 S  + 0 U Zs .p@[p  QD 0.@Q H& . @ R 80  #@?/0H-DV @.P@P  ,% 80 r 0HsS .P@p  @0@-D .@\ 0 S @ 0FI&0@P@@@T ^0@E@C-@>P D ( .@ R 0aЁ@`V p T0!@@ЃD .@P/(&)/O-MD .@Z& (P R 0@0!p 00pS*07 .0@ % b0@pFT !0# " 3 @'@ T  ! / 8 .@P  (@PJ Q KP @0    @@@ @ 0S*@  0 p 0  @ @ v ! 0   W)'   0R !  D .@ p(@q    *bYHPp D 8.@p#@P`U`v8 !@`KF.@P (@PJV D .@ 0V .uHV .P@ 8Qp  .@P P!@K .@2gIP x .@P#P8 .@P7D .@P  00D .@  @ B @ @0 P:(. ? - !@3K .@Ѝ@-D .@Q" ( R B@ PRPP RPP0520Q @p@$p'p 㰀$PJ Q(@/0H-MDF .@@P( P 8PP R 0PPS # 0@@0@(@ @@ @P!  Ѝ0 !@Ѝ0HJH-M 0PPЍ0H-D 8.@ 0s0 0@@Q@0A-Mⴈ@.@P&Dv P.p@2@` `(`,` P   P000  0P!   &q@ЍAcH-DV .P@@T6 p "  `VP   冢  P   @ 矊@V j.@Hr&D .@P/H-PPL p.@`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP nIPPPPO-M!@ҩC!@% .@[ħ .@ [ .@[w .p@[XPX *bR@P!`@!@ uP+P H-Q   uQ+P  HP {I :P rIbPP .P bP  wP pP cP  .@ .@ [ [,PP .@ .@`.@`g ' p.`@. @pw 0.p@07 .0@ @0P .@@Q!@PP !@4DP 1(@@P.@!0@ P!@~T 1.@!0@ PЍ !@r@PN 3 P!@e@P !@_@P%!@Y@P Y!@]PS!@WP d!@QP_!@KP S !@OP X& (@. @0p`P 0p` VkL .@Q X p.@/0H- @.@PP .@PP(@P   P.@P((@PPP0X p.@/H-p0S :L .@Q P .@ X .@JX .@ X .@ SX E.@C@X .@S@# X !.@! @  0@-MPx E.@C@,@PX .@P T .@x T.@OC@0$x !.@! @ P .@ x .@ 0x .@ЍL& . @ RQ L R  000!30 00?!R 000!6+ R 000!9q 000!< x 00!?00 00!<30 00!930 00!630 00!330 00/ R R R R P/p@-P@P `PpP PU:` q U Q P@ RPH- \ *0 R  B/o"SJ0H-P@@P:U U @PP ` @PPPЍpA-@A!@ !@ " !@`ypP +!@ oP  PipὖW8!@  ^pP"!@ AUH-` R FS@!P@pP :p` R0 .@iPP/ Q /H-MP (@K!@2>ЍG-@M .@@3TP @ЍY p`P P@U>V`:p4p T.p@" PHad@DTB H-4P 0` .P@.`@P p@p7TPP P P7P @WP@T @g@@-@04 .@ @-@%@4 .@ R  @-P@P@-u@4 .@ O-LM\ 8 .@.@ 0P @  .@.P@.@.@eH@ 4p c .@@.p@.`@PCP "L.@P {PPZ ?P . @>9P P B.@$Pwt` .`@P P ..@Pc .@P[Pa!@;EB`IP  @;VP :G;(; .@c .`@P@t` .`@eT .@PetePjpP6PDH` P.`@ /PPYPF p .@PU W W=WPI p .@eP P P.W 0G P:u C eP.@@l  t` dP.@.`@X .@, R{Pp 7P iPP P dP  QP `P t` .@.`@iXiP i "@UHcQ 琋 Ћ , D p  ( T ̌ ( L L ؎  8 P @  l Đ D , | ` ؑ ` @   8 h ̓ | Ԕ     ̕  |                               | .@P'f |"@(@`@Xp`% t` .@.`@.MfPC W W P #@Q2:PC .@@P .@P 8 .@pP `0(@}Ai :P  >@ ECP A(@PH-60(@?]%C P.@@Z WSGQ   | | | | | | |  | | | x )&V!@{P .@P  .@PT .@P P7PM aGx P3.@l .@0@PW6PP 6`/!W @W *Wb.@P]8 . @7Q  Q  .@6ap@mp .@l .@.@Pd(@` ES!@Q t` .@.`@l 8 @Dc .@8 .@rˡQ.@P%N!@(sP .@P .@PT .@P Q.``. Q`H,Pq .@`|(@`%d'"@J C .@.@@mp .@l .@a"6P X8 .@&L(@*qC .@@Q 9l .@ @Qb @*WbW !WQaQC P.@@(3 (@$#! @0_8H1@Q* @p P  .@Px 7Qt 8 . @! Q L(@C .@@  .@t` .`@eQO C .@@P P .@P .@PV T .@PP_WM-W +WHQ6p .@4P; P$ x .@ a@P3$ .6P  $Q x {Q. @ @2`QRP$$@"l .@C .@@P keWs*!@YP .@PeD  .@Pe= T .@Pe6  Pe2  Pe. ?X|+3FHo?pˡN?:7pi.`@ P>?*7 _ .@P l <'?(?7pˡ? 7d .@QK PGP .@Ap\Xi.`@ P>7d .@PP .@ N>7 p VLe .`@pp>}7gNB!@ZP .@Pe  .@Pe T .@Pe  Pe~  Pez >N7?+ep>D7\d \ .`@  % .@.@. @0p ` .@d .@.@0 !@pe JP !@{ RJ0ddpspX@ d0# .@@ R  {JP !@c.@P  \0 \ .0@` .@0.@0  d .@. @ .@  Pe P {e9>%6=!@pˡ+>6d .@QU PLPpˡ>6R>6P ((@(K!@.@P ]!@R8n PLH .@K PXH .@W pˡ Pe !@p1=|6d .@PP .@ P h% . @ Ph .@h . @80 p .0@ ~L(@=J6"h 8 .@ .@ rh` .`@ p h` .`@ p 8 .@rˡIL(@Mr=^6pd .@P P .@-^=J6qtve!.@`fP 7P  n pˡIP !@` pˡ'IPU `/=5  Pe.@H 0! #e L .@ !S=5 p :| .@\ .@#\ .@ .@k>t5!@P .@Pe  .@Pe T .@Pe  Pe  Pe 4)<q5 .@ *<h5 .@ ,l .@0x *.@! @1" e`/<L5d .@P P .@O  /<85 Ce[(!@6 .@^ pˡF PeH 2P fP #! @p !@ !@ X@ .@@]<I5 pˡ' Pe #! @p !@  !@?}e H.@@k @?Pm P !@~6|(@`'"@<4.@c9&;h .@P` .@\$ . @`0V0 .@F`˱0 P` .@\$  . @.@0ppTL% . @ K !@*6e .@A/(!@(s!@G-p;;_4H ㈣ .@ .@ W ` P`W@.@@RU  f PU g48We 2QeK-`P8p .p@@  =  P0@  7=`h .@V VJ  )  P  =`@!@5T KKH-A(@@P  .@P.@P8P (. @0s  H  .@PQE Hf .@@.`@PpP pPp@-l /.@k@ `0 .@@@ @P"@U@jwp @`.@PoV .!@jU U'"@ @` .@p@0H-:m3Pf @0 .@"P.PF#Pc $Ph %P.@PTq .@%!@0H4 P@ P PE P0!P |P .P@P 8 .@P1| .@!@P !@@+Q Q X.P@P Q; "9/P+ 7P7 EP.@P 7!@0H$P P.@P+ 0@ .@0H@ . @0 @ . @0 0HEx l HP .@.@.P@0 ./08 .@!0H@I0H|CA-M8 .@ 0 7.@   !@  !@  !@ !@  !@  !@U`@x!P@1  0"x@Tp !!@" @ !@ i .@ЍL .@Q/0H-P@U @0O-$M@`S   3P `nH@@P @ pT W QL A.@Q =P 9 0AS R 1@P P  P *VPp Q:@ P 2P ᣓp @P JI Z P Y:HUq P@TA$ЍH- .@ .@ .@ .@HO-MP6 @JP,@ P!pP PW3PU!P@@P PPV@`pP V@:XЍ@-~(@2x(@E2!@P @y DU% @!@! @0JP  et% @!@! @0@ % @!@! @08P % @!@! @0@-0H-Q0P@ P . @00!@0H20H-Q0P@ P . @00!@0H2A-@`PQ >PT #pP 5/@!@(PQ A!@!PQ  pP !@ pWK-MP.@@Q@rP<J` pp3@㔈P-  08p!  rr$ 'WPMP+P PQP@P M@ដr@ЍᖊGP`@VEPVnPVdP p U.@.p@PpuP cP eP PU*4vP #PU* PU*@xP@p@-` P.`@ @PD D  0D0  4 .0@.@Up  .@K-PG pA@`Q"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi  .@@-M@ .@ P#(PQ   .@QЍPo/p@-Rp@P `vP p!@p@V1H-M!@ O1ЍG-MpP .@`P .@PЍT `.@P @`.@PQ p p<iPU:P Pe`ЍGW @R d 3  BP`d`3`dV P HV)dppU PAPEP`p@-`Pe@V p#U `U aU B@.@PC@ C@.@PB@\) @. @ R!@#" .@p@-M`7e@P1JP;P-.P);P&'P"V @U AU  B@.@PC@ C@.@PB@mQ \.@Q@#R" .@ЍpO-MPPFp/w YXPp YP !@ 0@ @CPP Ѝ`wp 0G?@ BPp/w P wp?@ CP O-M@`'0pP!0PPU+5G(@PWP* :P Z P@T:4(@P PP @Ѝ0H-@Q P/ R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@, P0P0H 0@-MP5 p  .@Q- @T TPP% h!@ "@,!@ /PP!@ Trp ,!@ /Ѝ@- .@PH.@@P P@P H-.@Q HO-MⴈP.@@PV cP  Z >`{ P .@U Z;  7@U4 v @ P  P``pJ!@I8P >!@B8P`  Y` `P k @08pPp)`k @'8P >!@!8P !@8P P !@.5 p.@ppD .@PPJe3P !@@.  0"@Z` @ .@   P   .@ .@ p   .@.@PPQ?w#@!p@  .@4 0. r- `@ P m.ZZ P P T :6@T  .@PUH P.@@$.@PQ`k @p7P oP ,0p .p@( . @.@P k,P# "0W4\ .@!@H7P >!@B7P }@d(@ \ .@P T@ЍenpD p.@PH P P V!@@z. YP _n+@-H.@@P, 0H-MX.P@P$ 0p  o- P @ R .@ .@Ѝ0P/ H-@P`Q p3) ޅTHp@-M@qHmOPP Jm.@P!@@.Pg!`@`UAU DU. OUaU dU' oU -P mQ(P@ 03 q mi(@pS!@@;-ЍpO-Mⴸ@.@PP  @`@U -P-*P@P U'*  pW , P*p@P W *@PV3 `? <@V P ЍOv@@P * Ѝp@-`P  P@\P U  EPpT  =P p@pH-P .@ H*HH- .@+1P !@,.@k @rH".@ .@ .@ A-鈃 @P`.@T>DpUP W PE` 0H-@P%P PP0H0@-H.@@P @@e@eH-jp g*H*O-M-MP P;  #@͊! R  P \P P:P g͊ @A!`@ P+Tp  P `PV D2/P aP PЍЍA-@+D4(@QPP+ 5$P( @0PQ!@P!@-JjP`@`+pPP PW P@PH-!@ JP@O-MP!@JP@+p W.@O 4`5(@(@ PP@WWV!@`P!@`5(@4(@P .@`@(+ RP @ pWY P [@<+@4(@ (05(@! @ P+@` @V.@ p嵘P!@ @W pP!@pp*P ᝓ@U`PV ЍK-MP@`PЍP*p*pP ' "@!" @ 0X @EkpWk @ &@-@A!@@ @G-鴘㸨P@.@.@`p#Q%QWWP P #Q%QP *`Q `p `@#Q%QTTP P #Q%QP z*`Q @p@-`.@PPe*P(! @0@KP`3PᬂPᩂᧂpG-M.@P Ѝ!@JP@k @RP `!@P!xP!p@p"* * P.@P!@!@Q@*`@|P4(@5(@*(C! @0TQ!@nP!@`V Ax@!p@) b`V) @ X^`.V P!P "G-MP@P@  0@/p8 `,jP1L @ @ P.@.@ `P DP  `P mP  psPP$P `V:@U@ލH-M` @@ P  @ЍH;P P_)`\)`p &@!" @0=ᧁ @@᠁ЍG-@ddP EHP  ` ᅁ')PpP@pOpw W 0H-k @@@2PP !@92P >!@32oR0p@-M@P  P RۍpO-M`p .@pP .@P!@PPz @PT|PPE-PDk @1PJ De  %R R   0%S sS4P-@ (`(` 0p`pV5 U @ T@hPk `@I!@p(p/@P pp[ :P @>!@@p᳀ЍA-MP.@P Ѝ`Ox!@P @ %R R   0%S sSP!@ЍA5(P(p(`(p 0`Pge@`T ЍATH-M ip    @oЍ0H-MDU @.P@P ip(PP'  P# '*IPh`(@ iPJ  P'5PTP(@᠐$PЍ0@-M@iPJx| 0-ЍpC-M@.@P `]iP  . @ ! 0 .0@Ѐ "!q p RЍp @/@-@o'Pp/Q@0H-$ . @@0!P 004 .0@0S 0H0Hp@-H @.@P p<p `(@P!$ /%$oB@@-@P (P@3 .@Q/O-Mⴅ .@pWP@P`<P`n%@T .@PW] .@PW .@PP\\ .@PJ @P`.@T(P`%&. \ `y.@.p@ .@ f \ p.@ W  06P`\ .@ $@ $@P`\ .@@TЍ@-@  .@QI( @O- M0p .@@P \ U.@ P , .@QJQ@P pP`"  .@P 2l .@ H (! .@. @ Q!0 1 ,P` P`E Z.@@<P \ .@@P !&% .(''&%(P ('P ~(@P 2P(@P !@$@X[WpW`P,P` ! %P' ! A(P(P+ P`'Z .@(@ % & .@P .@P # .@ .@P .@@X \ .@@`(PP` @ .@P (P ЍOPH .@ Z a(@ ЍO0G-M .@,@P(`Q  .@Q( .@p  .@P \ .@@ P T \ .@ Pڴ .@Pp  .@P 1l .@ ( .@ 0V R k0Yp@+a`P!&X 'Z~%#@YT Z (ЍG .@Q/( .@p/ .@P/\ .@@/G-M P P ZP ЍG& p 09ЍpZ \ .@@u'P" H .@P W' Pc @P.`@`& 0P@&X& !0" ЍG+ A-MP`C&p@p  0@ЍV 3&ЍA p@-\Y@.P@` R ` r `V V@pP/@-@(. @P(@0Q0S0\ 00  Q 0R0C0  .@  B ||@|'P( @0SQP/P(@ R/P(@ R/  .@/O-MP w`(p@@T 0-P2 @Q|8f@V[ 0 $ @ P0004000@  Q    .@# #X* |!|T ЍP/P // a @/ ` A/// ////0/0/0H-P4@PP {4@04/O-$M 0HV  % (a C H. @.P@.`@.@@(+G P /l .@ P ?.  * P( #+p P Y  E Y + ` po 0P `pP@T .@P U U`pZ P P @`V@p@DTVC .@@b Fp ` F FooPp V Vv pe P0 P,T .@P V VU T& PPC .@@` ) @`PATP@ \ .@PA Q@P -C P`.@@ Pp`P .@P`7T .@P+ V V!  P P C P.@@P P`M\ .@PX (+ PP`C .@@Wd .@P  P 0E  P (% HV (a P. @.P@.`@l .@P  0    .@PW  p P P p $ЍO  $ЍO-M D@QV   0 (*ЍQ OH 0H-M@P\ .@ 0Q P ;Ѝ0O-,ME ( p`.@@.@wP &.l .@ 0W R ,W2P  S .@.P@P @lk T T g P P p Yp PPP P(` mP` $ `P`p  .@P X  P0,P T .@P X XY `Z(N @TJ\ .@V@@P]\ .@PXT .@P X X +&XZ`Z`E ( .@@.@P: P P P2 P  P P PZ(, ~PE ( .@@.@$p ` : ''P#E ( P.@@.@$p ` .@PT R  ,Ѝl .@P U 0 PwH-@p P'Pp P P @P@P(@@\`(@x@VP@TPp@-yP !@p@p \i@.`@P@"! p@V" 0s B @"! pp@p@O- M`@ #"PJ@@T! 000P !@ ЍO$ tP! !d0d .@P~  ЍO%P!!  pq V  P\.@@XM !0  D &`P Z@XP)+ Y`@!& PXPp\ .@ 0  @ .@ H .@0\ .@00@ `@ .@P 1 p.@p{! 0@ Ѝ 0pH-M !{! r   0ЍH-P !@Hp P \)P. @  BHp@-@P`P1p P`Pd .@P  p@H-M@Pj`p pP uP I  !@P@-Ѝd .@P L .@ ЍHL% . @ ( !@ЍHA-P@pg !@B`p!&  0PP0PL% 0`Vp. @S A !@AO-$MM@PP!@P .@`P(@`1 (`(@1,`<0 1q  .p@ .@.@`P`P (@ k @'P  @㨺Pp (@` {P ,Pl!`@ P  P!  !@ P #nGP  !@ P  !@ P p 0 S SP0g0 `<S !S <SRP=Q P=S >SHP=Q P P=QP=Q P P B H t W QPQ@ l Q!`@D QX .@QPR !@!@[lP!`@HPQ4 lQ!`@8 Q> .@Q68 C^Pl!`@4p -p! @ȸl!`@ !@, l.@!`@Q .@Q  l.@!`@Q .@QWp Q Q q"Q#Q P Q\Q Q Q Q P PP[ =taP `P+P60PlT!`@0Q Pq/QTPP P=P P/lP!`@U P PP=PTJ/P P P TP Q Pq/QtQ Pq/QtP P P/pP U U U ] !@!@cR !@!@]MPU U UP `&&P `Pl !@BdlP!`@ U UPU q=/P LQ Pq-/QP"/q/P  !zP*  .@$ЍۍA-MMP .@`0 .@-@! @シ Q `0 y .@:ЍۍH-Pp^P' \P1 @aT>0DPz* 0r !`0 B@0TS@0:Q r P (@  .@  ! . @0P00P0 ! . @  S(@0QkD P00`  8   L `Q- `0TSCbCPP `$,4<DLTZbT eT  .@T  ! 0  @h  @= "@z "@CSDS LS RS +1S BS %US" XS   C^P#  .@0#     .@ !!@    -.@! @ザ>   !@.@P !@``0H- !@,C .@@P3  @ !@0C .@@P !@ K4S .P@ ( .@@ .@- .@-S @.P@- @$T .@0P3/ .@/0H-4  .@ | 0 0 0 R .@@ .@@ .@@ .@@  .@@ .@@ .@@ .@@ .@@  .@@$ .@@( .@@, .@@0 .@@ .@g- .@d-S .P@`- @$T .@0G-M4 p.@`P?  lU .@.P@4C .@@7 { 0 -P.@ !( @ q W-(@ Q Q |P % p|pp0. @ (0|P 0p|pp(0|PP4    P 0 E .@AQ 0|pQ`|``q (0P %|0Pp`|``1p( | | ( |.@Ѝl 4 % .@.@. @0 .@ S Q/p@-4S .P@` VC .@@!R, `V` |.@ `pH-pP0U H)`L .@PPVv@F@PLPG4c @.`@P @Q GP 3@P, P 3P"%  . @.@u 5 .p@.0@@p@0@@ L .@P A@P@@@- % 5 .@. @.0@.@@/04# 4 . @ .@ .@ 8 .@/4$ 4 . @8 .@ .@  .@/Q/H-, .@ePH/0H-@PP, .@WP0 .@P@P@0p@-@P` hPp(P p@-@Q T5 Q \T.QJ-! @ R  R DoQQ PT , .@PQ/H- H/pqA- t @.p@P`P  Tw @ .@  Pn# T! .@P  .@D .@@P H .@)P  .@P P@ .@`PHLv .p@P6  .@P( QPT T$ .P@. @@ Q0T .@2P@ TD .@@nH .@ ?;H .@P$ . @P T .@@P .@ 0$P$ . @ Q P P P H .@ `PH .@O-M@ D hd .@ .@@.`@pRP P /P) P( .@PPC Pg @P} @PuP, .@ w.@*hW .@PU  .@QPO 4 .@ 0S S CLf Q.`@C4c .`@P p n @P6UpS @.P@w@[*c  .`@.@*M*VUEQ@\T t .P@.p@Q .@*@PqNP 4 .@ v>P  .@P<4# . @@4# Q. @ p# P. @p  QPA .@*o@@ PQ_W Lf .`@ P_p_W PpP_PPLf .`@ W) .@P)  .@QP# *43 ( @ , .0@.@.@|p1R0AMQK B1Q0BR @EPW^i `p CpW p!0 2kPQ? PnSj ' P.@p P\@ `  0PPAHA(@@ Dlp"`@@  PpGW4@2  _p.@PPPwxP   0ЍOPP l >P   0)@P@pp@ЍPPCA-P P.@PTd @p.`@F2 0 PpW@@-D .@@PH .@O-MD .@@`PH .@  .@PZ@ .@ Vd ㄵ `y.@ D 4 .`@.p@.@@.@P|& R  .@.@ lU .P@ @R    @R  .@Q0T .P@Q   0 0S  h  QP .@P  Z.@P@ .@Q PX  B   :( @.@PPЍ0H-@ .@P#, m.@P F\@!P@p @T, .@P0]@!P@p @T0A-4s `( .p@.@ P@P ʝP` $ .@. @0QT4  .0@ @-4 .@ 0RA ^01 0R4# . @(/H-$ . @ R `% . @ R P @ P 4# . @|0S1(00 P  B! ~   .@ .@/G- p`r, P(p% c (q 4 @P.`@.p@.@@UP@Pm@t T`pYXP`PpG-( .@pP.k@*kT`V V \mPT Wm4 .@ !ImGmPPPO-M Pp` APwP;( 4C .@.@@P@ P# `.@v+ UpP 0@Q: QBQ* PBPE`` P `pZYЍ`pG-M`VQ &p@  }PP  @  P@@@l 06`F@ VR:B AЍH-\T @.P@` pP 07pP 4s ( .@.p@ @P(P`G-`.@`\.@ RP 0!  t `@.p@K 0R`T@ 0!  Vp@-@PPJ` PP  ,P (@|Pp .@P,#+/*( @2S/Q/(@2S P(@"R P(@"R P(@"R P/H-P(@CA-M@P`pP P p P@"PPЍ@-@% . @0 S $ 4 . @.0@ 0@@`.@ P O-MP D.@@$ ` @p.@+ U/  0  @9 .@@ 0 .@RPQ `$ P. @0p(#*p)6 X 1( .@P Q' p p V.@UEQ@ .@ P @ P1@TpW @U 4s @.p@ P  P@ 0@VP V  /``\ .@.@pQ .@ # "s .p@P@ @T .@% @ $ .@. @0QT4# . @4 .0@ \ pX.@@ @T`Q3U p .@$4 .@ Q&PR 0ppp0pqq 0R A P ڈE `.@@ @PЍ0H-MP @ @.@QP@p2 0QЍ0x .@ cR:x c.@00 .@ P!x- . @(|- . @ @/O- .@pW .@@`T@`@ `P`P%`&`V pW@x P.@| `.@V pp`pp倍 .@`VPP ` 0 p ؠ P TP PUV RP0A `pVp0 `0 R A 0O-MP4 .@P@%$Um .`@P m .`@ pRpPp` !Ѐu- `. @ .@WU0Rp0^0/P[`РV .@ 0`Gp&'B XV  0#ZUP  ' P(`ЀU .@ 01`p&' X&U  0 .@ Ѝ .@p/4 .@Q  .@  !@@-M .@@PJdP- . @  0P !@O-MPPpt @.@Q ` 0pRp!# " .@pDP5 pU"p# pMp R0UPpF*PЀpU 3c .`@  0p + ! XU pЀXc .`@  0p + ! X  09 ЍO-M@`PDpo/t[J\.@ Q@`p!&o T@P` pu P`&0 p'pЍK-@Pg !@Sp ㈓ .@.@`PpP 0 0@`p% . @ R/% 0. @ P0S/O- M`-P`r'"@JH  @Eee!Pp;P!pP @&PPP*P @@jyg!PjPP@;Y  !@  H .@@ ЍOP P p@ m ܹ@&" @ 0O g@TG-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P !@'@r @P: @$ 嵾'"@   @ 5c 㬹h p p  Y `P2p pPwP w P  ppm* @pw W p pPwPw P  pMp @PUm .@PK-鸝 P.@p@4T 5T'#T'a3  `ppPp f@ P6TH-o0H--P$P 'P( .@jNH.P ^P xD .@.@@PPPPnP !@xD .@@P.@P fP#GP @pQ!@@J.@PxD \9.@@ .0@0PP 0 f@00H-MPP @ jp X.P@PP0P ef .@ꖽЍ0a@Q .@/A@Q .@N@/ 'P.@j/#P /H-M^!@  ЍH-P q  .@Ha@-M p M 8.@@.0@k0P6 f .@ЍH-0P7 ] @.P@jTx.p@p L .@` Pff& efP P`pye`P`P@ P H30H-@P (. @ Q )!@n PA00H-8- .0@. @ 4 0 S@0%@$0 :p05Qa#3Q'H- .@0N A R qG-z븭 P.@@rJP $`PPreoe@D6tO-$M .@P*  @ M k B `.@@@!@P r 0 pW>p P  0 pب ` V$Ѝp@-MPmPI PP``P> @ P Q `@ P.JP\.@UP UP R Q @ QJ 0 S  0 S  B0``S# d `Ѝp0H-M@.@Q u!@Ѝ0H P P Pٶ.@g(@PJ!@(@p  .@!@e Ѝ0!@!@ζX@.P@P d@jdЍ0H虾(0. @0@- MP P PF.P- "@ +( @Q, !@' (@0s&,/ @! @  P DP0@0S @3!@ "@ 3Q !@L .@ !@ Ѝ (@ L .@H-M (@ R J\ @2.@0@009 L .@Ѝ@- MP P PF.P- @ R+( @Q, Y!@' (@0s&,/ @! @ ㌦ P DP0@0S @!@ @ Q q!@h .@!@ Ѝ (@ h .@H-M (@ R J` @2.@0@00h .@Ѝ@-MP @P  !@@R Ѝ@-MP @<P  !@@A Ѝp@-P Ppᐵ .@p.@P !@p@* ᛵrE@P p@L6Pp `oL .@ p@0H-MP P P"^D (@sDX @(P@P< (@P Cc@ Ѝ0H:cD (@&!@ Ѝ0@-P @.@P 0.@ .@"@@0H-M@P P P5$[ .P@lP=P MP hP4X @(P@" $ .@.@ !@ mP wP sP@0X @(P@ $ .@P$ .@P@8X @(P@bЍ0P/< .@僿P/@Q*=P/@-5!@PH (@@!@ ;!@R!@Q PxP{!@!@!@ !@K!@!@!@@n@-MPd cRA0BSA@ IlJITJJTJTJ JTJTJTJTJJJTJ$JTJ,J4JTJTJTJI +mRnR sR uR.dR kR(       1BP O% . @ R, !@Ѝ@ @p'@!@  Ѝ !@O-M,! pP@. @0T* P@W@!T*00@ P ? ` 0A? ?*W@0,! X. @P0T* P@WT ,PSS *( @0@(@ЍK-MM@P P PC] ߍۍKꈚ(@"@ p @P ,a Z@p,.`@!P@W:@ ఀ< !ṅpW2 "@ e @@@' (@ A!@㡅 !@@* ߍۍH-MP P P1P  R! Q" Q!@ЍH 45(@(@  u!@  4(@5(@ 5(@5(@ 4(@Ѝ0H-MP P P/@: P 0@P˾@k @P % . @ Q >.@ .@P E .@Pk @!@Ѝ0@Q*!@P.@/P/ .@P J@-PE .@@PȻ@-MP E .@@P !@Ѝ@-MP E .@@P !@kЍH-P .@P.@P<pH2H-MP P P (@^R Q (@¿!@ 7Ѝ0H-0MP, P P4E U .@@.P@,P# ,, @JQ" 6!@ @.@`*0 .@! @P!@@ # , @-Q !@0Ѝ0,,P @-MP Pc P0QSSEC ^: tSSSSSSSSSSdSeC ^/ tSSSSSSSSSSC ^& tSSSSSSSSSS #RS WS ^S   S -S rS wS S SG 1 CR Cm0!@9 .@ E  F   K    N    R    W   0 >0@@ 0RQ-!@G .@Ѝ% P5 . @ .0@ .@0R  S0P /\  .@.@ H .@BP/@-颾D .@@ !@ᇃO-MP Ĕ @.@P Q Q 2/P t .p@@@ HQ~ YVVVYVVVVVV$YVYVVVVVVVVVVVVz` V  P@a ERPP3Q Q =QT QQ3 !@aHPPP3@`T @PDW XX4XXXXXX o% ! QQUP   Q Q~ X$ nX z.@Pn  Q @0 PT  `R 2/V ^QOD .@+ý !@㪂 0P1 `+P.@P s^|.@-Q ``` KbN+Q @@ +QR  .@ 2Ѝ `P!@!@ @`!@H-M0S  $.@! @0*ЍH輠$! @* .@㳠ЍH-M`@P<p-W0A Q:TU "P!@ pT-W` T U P!@ ЍA-M`P* @pPQ& .@pP \Q`P \$Q T AP` `Q !@ i``ЍA-MP  @pP`@W@ f .@<!@-!@ЍAEW  S .@X!@ 7QQW W!  @PO]^^D^^^^^W5 W0 W?oQ5W* W W/ Q QV%WY W W  QAPs!@  o  P PV R X2/@PX U@Q *p!@P X  .@Ѝ!@RPSo/Q p !@ /oPH-tH!@// .@P/H-M .@ .@!@oЍ H-MPp`خ@0D QW1 5 aR0`0FR`@`3 0`C V:R` 0bkZ`0bA` `SA` jbah#fd `0+WV " !@`&Ѝ  .@.@ QR/@->!@{P .@ (@Q@P T 2/$@P+( @0S/ S  C Q $0/O-M[(P@0S@ ` pW) >P@AAQ:-P X T T DoP堂 p  p$PZ  RQ   Q P   ЍH-i!@P%P$ (@/O-M H `@.@p.@P .@Pk p.@P6  .@ ppP@ p .@QF x .@Q$ (@  .@P C a(@PN iQ .@Q QB G  }CPP % U. @Q8u oP k#P U .@Q& . @P  A7C .@P  .@   .@ЍH- .@uH-M ~H-M@'cP``- @0pP吝Ѝ0H-@bPPV y.P@!@ 0O-M(`,Pp 0@ 0!W!)  %&9#,@ʇ t'6#z'0 X ppPpj`VP3UЍK-P@pm`d0%"W$! y (_$5#  W4!00 0dp W2O-M@@ 0pPC` 0*"CU_ᐔ  ' 1$5#j 4#Z%0Yppr@W3[ЍH-MbAQA#,/O @" @ aBЍH-M .@  .@ w .p@QP P`@V ?@`PЍ0H-@ .@Q [(X  (P@.@#P: @ .@0@-((  ( @.@@P, (@ AP .@@-@, (@@ .@Q/$@-P@PK-MO  wP`!p@? % Fb@  E y-PiЍK-MO  wP`!p@?  Fb@  E y-PiЍK-MY pGpiB P`!@@vaPpEy-PiЍO-$Mp`P@0@ Xa@QW@A@Q7@2XJX 0`  @0 t@P PPT$ЍO-Mp`P@0@ Xa@QW@A@Q7@2XJX ?`  @ ? ;@PPPTЍO-M`Pp0@@ Ta@QW@@A@@Q7@@2TJT  0`g 0@  pPXPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `pP%{ʷP `rpP 0P `dP p@pЍ@-M@ P @IPЍH-8 @Q 0@ @ pH.p@-P .@@KP, | .@P붯놯ܯ .@`l@ !@P P @.@Ph` .@Q .@p@L p@H-M:'!0@! @0ЍH-@P`pzJ㠯3P PPPP @PP @PZ .@0H-M@PP (@0'!@! @:'!0@! @0Ѝ00H-@PP @ᷮP x` .@P .@ QTx0K-M@0 .@jPPVP ,p 㚩 0PppV%㎩`.@ .@oQ" 2`pP cWX !@P VW`WpU OWЍ@-@P DWo/O-|MⰰPᤀ@᠐ ;  ` /PQ  P   0koP  #` 0V pB `CR JS 0@ S pwp`pppp@@P0S ?`U-0 .@ [Q0 02@Q0R0s0Z0PU p0p[X 2@XRqQ 0S @PE T:  ꤀ @ 000![$ "(; 1q0WQ|Ѝ "@/p p p\ .@@ \ .@@\ .@@ .@/N- .@p\.@0SC P Q 堎K-p .@ \.@Q 1PC00C1SPʁ蠋H-\ .@P .@  O-M\i .`@.@P3 P.@Q Р +0* 0 P Р@+0 p*p BV4@ .@@P E *+@ЍK-  R.@*\.@AQ\.@A 1 0# "  0AP 0$ `%0  0a1X @ p%0  $ @P@0H- .@ @0\0\9.0@^00N @@\@ 0^00H-\ .@Q0+ . @ @0P0s0: Q00 @- R ; A.0@01$ P r :0Q \P.@@PP@/@-] #@ェ$K  .@@#@ .@  #@Ru #@q #@m0 (@ #@g4 (@L #@a8 (@O-M0 `0 .@.@P p X p!@.P@9P:P ?P \P@P   `%P7 .P P  @T `OThaDQ Hlt|    |   Ѐ    4 .@Q PP@T u`bDQ , 0̂<BDQ. 焀(hN !0  0BT DTLTS4 .@PN ;! Fk @t?TTDP  j @mPT96 # P 20 0 .@.@P%\ .@ P P.@q!  p PPP`\ .@ P % . @0\). @ PRX.P@|P0 \B&L@#0T P  cd Pp'P@!%pᰮWt P0oZ  h0# 0; . @.0@P|@ Qw@Pq|P2 ꈮ ^  r* P p $% \9. @.0@ P0  ?FH.@e 0 R : p P2 P P 0 R : p0    pX.P@G0P=  j 0d!@b00 .@0+ . @!@Q !@Ѝ0H-@b AR0TPQ0P iRjR tR mR BR bR L .@0 0>S:S Q\S 0SS/.SQ?S/0 (@0H- $[ .@.P@@ .@oPB4 (@ .@ 08 (@H-@0s P.p@0 `.@  RP  bp@-@S0P Cs/o"TJ\i.`@@T @A !0  /o"Rpp@o8 .@/H-@ .@P LS T.P@`V .@P \y.p@P@ r ˩e@@T)o`O- M(@q F % (@. @ R:  .@P \.@P'@P`p ! &@  [  0!   R/y롩@T Ѝ ЍOp ЍO@-@8 .@P T.@ P L .@o@^!@@@-@P $R@P .@p@-P@U `RRVP` P.@h .@ Dpp .@p@-@`ᚯP p  .@0P PVPpH- P BR Q9 bR4Q& ^ RN  Q P@pR @pR Q Q PPPP P0H-P@=p  .@0P !T @00H-P@%p  .@0P  0T00 @R P@P0K-$P @Ypl .@P(@0`#( (@P%`$ ( `U0%P 0.@ZQ  %0$  ! R (QY % . @ R L .@PRH-P .@ L .@.@ QH0H-M@ Pp g 0.Ѝ0@-8C .@@ P0  .@.@@0H-PL(@@gP 8 .@ 0@JP J .@PL .@P @0O-,MQP@@P@"PC 8 .@  :U .P@P l .@Q LS P.P@P018  .@PJle u .`@.p@ L .@P .@eQ Pg !@P P!@XL P.@ `p^`p!&WP .@P PP \ .@P@'  P"\ .@P@`pP`p&'*`p!&!PU`p~ 0m`p !\P.@Uj`p!&P & ' `$pv[[# P 000 P'  .@l .@@oQPZ5  .@P l .@P !@w ,Ѝ0  !   $ 0  !  L% . @  .@P l .@P H-8 .@ ToPG-M`Q `(P@pP VPQ:PP 0 .@  .@P0 0.@ PQ P  .@  PJP NOpVp ]|_pЍO-M`` .@P8r4\ .@L .@@p`" .@P   .@ P Po  0pS I084@Р`@+0(ؐ`oP LH$ .@4@P p D, (HL !y  W` HTLY ` HPLY YIV 0@@

`@pp,($(,0 !  PaJ`# 0. @4 P@#p"`Rp`Oo``B` R  Wp P P&P  0t 0!"P (h .@ !0   (@$` T T(@$`TP  0 !0  P 0(@$`` .@h .@P<Ѝ (cH-{ .@ "Qp@-Pp .@@UPS .P@@T `KV@Ν` 0p ڄ .@` .@pp@KO-MHP`D@p0SP@ p-} P Q Q) @ @ 0  9 0|E W)  @*pWQ p8# 0. @00  00B PPЍO-Mp`0 V A@T5 P @V @Р @V @ (@ R Z ` 0(@T @Z @( @T  @TР(p V@ T< . ,,`0@ i+ A + ЍT$p% " Q  p .p, `0@cppP p p Q p@" ' @Kp pP   pp@@ i+ A +Q `X00SPU  p X@ WX  WX @@8p@Ep ЍW O%O5p@-P@U P``㋜P0㇜ Q `PP p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLppH ppp@ ppLP^    QY ?P .@ Z   Y I$ЍH-\ @%  . @.@ RHH-P T @ .@@ P\ @ @H~{xHtH-T @n .@ .@PHH- @Z%  . @.@ RH}yA- .@@T P>ڠbٛ6331 @,ʛ @.@P \i`y.`@.p@P7QP .@) .@t .@PA.0H-HX (P@@T   EICIAI .@ .@ .@00H-D +(@!@P@P& 1!@P 8!@P >!@P k @P '1P J91@@@@@0O-MM@P `pP T 딣 .@VbD < p (@(@(@ MP   .@P wP @ Qd Pp R  0(@ p @ 0pRo Rk Pp`0@p@p W P0`@P@  pW 0`0@ 00RE @`` R> @  0(@ 0S0 0p0@0S( 0 0@ BQ QQ #P 0H8 (0@ 0   Pgp (@X 6P  .@ .@D (@` @܋P%HU 딓 .@` -MPw p!P  ܥP  MPe P P"Q `Q Q Q@P  P,  ^R  R R  0 \R0Q  $ 404 RR 0p$S $Co0?)H8 (0@ 0 *PN  .@H  (@.@ApB!@㧽PŽP;`FpV7p #@W`pₙ !@0`pkW _G @ԆXGXoH (@P   .@  .@ppGP #@Ѝۍp p(@X /O-M `.@P]   ЍO!@Pp .@K 0  gp!*@PQP@P3 4 .@P  0@ .@P|`ၺ `0 Ⴚ 0F`F 0zX {!@ Ѝ@-P H .@ 0 (@.@S @T0000@0 BR@-P H .@ 0 (@.@S @T00C00@0 BR .@/ .@/ .@P/忾H-P p`Ꮨ@㉘VPUa  {VG-錓 `.@P@p QQ Q ? Q H-㤀P J.pO @D.PCH- .@//H-Ms @.p@ Up P`pVUPPЍ/@-@P E/p@-P@P`Q0/ ! R:`Q  ME`@pH-M 0)PЍp@-Rp@P`@TpQA /p@-@`PVp`Vp/@-@ R Q Q! R * Q QS@SJ@0A-M$`S R@x0V@"Q^PpP` 00(0,0 00P0ЍO-M-NMM .@  .@Z.@ P c .@.`@P  (@ @ @;PP#P   !@P   1 (@ZM `R 0pp@E  R``PU  (@# P# @@ {0S 0 SpV R  R 0 @  " PU R|0D`P`p4  J,R @Q @w `P Q  (@@ QQ @ c .`@P5  (@+P  (@c 0.`@PQ pp@;P }PJ\PPO $? # P @#P#P\@T`Zc  먽 P\p.@ $ȍPM \P U P P"bU 0 @ R*$p$00 @Sr  0SQ:P 5\P&P$p$$P  $@@PPAP @K$rPP$  @ B P  ℰ P @0B \PP  $ FP`= @K >P㨠; PQ  (@@Q $M0Jp @K 0Ip P (@PG `(@ Ab PP (08Pc .`@P7  (@ 00@n P* pℰQjP$h M .@@  PtP\W(S@IP@ TQ   sIpM*@( kIpE*T`V H !0q1 Ae $`(^(;P }PJp$ $ $ A  `㄰ [P R  P(@ @ R PP1 A R*P@@K DF@"P tڄ@P@ℰhQ HQIQ gQPiQ pQ1 Q Q;Q#c  .`@P #|  (@P<  00@ P2;P0P,wQ  (@ R 0 @ JA PR RQJ P@ % .@Q !/*p \P ` $0S6 p` p@\S- RV @-  c .`@Q  @ !@^.@Q c .`@Qe @2 !@ c .`@Q @% !@;PQ @Q@,@PP: P: P 2PR2uP  `PM `@  \R R  0S S  `P5 D P@ZP  P'YP .@ aV P7P `1+ . @  P !c)p5&c .`@+(P .@``PN㨫 .@!@@.@QU pP 0)FAWP`V<.@P @.@d.@h.@NߍۍЍ .@N0!@ .@[0!@V .@0!@@L .@0!@ .@0!@ .@0!@`3 .@0!@ .@0!@P"U  .@^0!@ .@?0!@ .@0!@ .@0!@ .@0!@ .@0!@ .@0-!@ .@t0!@ .@M0!@~ .@90!@w .@0!@p .@0!@i .@0!@b .@0!@[ .@c0!@!@ ᱗ .@0!@G .@0!@@$ !@᜗O-MPE <P@.@qP{P tP rP 3aP bP/`V P p 2pR p .@X PP  ?@TЍ.@ .@02!@`9A-MM@0 A R * uCPЍۍ.Q$Q +Q&/Q \Q `MP P IQPR IAo`AP.@!@.@!@0.@ p@-@ (@0PP@ R RQ .@ .@A !@oDP: `pO-M[` [k \[n p[]` \0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" PP]UW0C0 U \U nU 0p0]Q pRp00Ѝ.@!@0.@ O.@!@|.@!@O-M.@`p @\P \Q Q: . AR [Y+ P[R[& \0S! Y IP ]Q [QY[[Y][Y   P R   P R p P` HGPd.@ R5Ѝ.@@.@Pm!@ 0̕H-M@P`pmPn@ P2Dl| aP dP fP       P pЍK-@pP`?V ?PV @p`?P VPD`P00@?6SC hhhhhhxxxxxx?Q7@?QW@Q?0|/O- M`PVy!@qEk~.@㬅p (@X!p@.@/@ UHPa@Q&L\.@EP GP_ IP.@!.@2@M  (T( ( @@ .@P!@.@ 0BP ~!@(`.@ 03P !@` @T( ( @@vp)x (@.@APU T( ( @@PPU X 0(@p 00p"Xh @(`@p pP PU .@ ZP.@H}1@0H- p (@C!@0Q6}O-MȅP.@uԥ̵@`.@.p@.@.@P P< APu"-Pz  Q Q @6P .@ 0|- ! @P:" .B.@.@P:@P .@#QnP.@Vc.@ p0 W8 W @@P.@@@p70@p0pp` CRp  -P- Q#Q) T  P" TP P %. @ p @T ЍnQ%. @l!@RO-MM v.p@fEp P.`@.@@.@(@.@.@ RPH6&!@. @X1@  V.P@ XP; Qp P P/ 0P %#P #P .@P `PP P.@ #PVf.P@.`@.@P .@.@P Qk $P! `P ++ PP++ ᳕$ U7/.@! @ 0} P*$PP  .@@ ~P k 48( P|#  Px#.@.@P.@Vp f.P@(@.`@1&@. @ @~P4!@] .@ ** .F .@@.@SUPP u  E PEP   0.@Ѝۍ !@  ?!@!@!0@ @!@ !@] .@P!@|] .@#z!@ޑ@- F.@@ Q ?p 徼.@P .@QoH-@.@pW h `@}P PP p ŪpWቼṪ@@-@\4P!@ ፑ@-@P J8P!@ @0H-@P7P0!@ 0oH-M~P.p@@P 9 0aV` 0YVЍO-M E.@.@@P p (@DX<>8n@.@.@.0@.`@.@ .@Y Q P# p RPU PY P l>.0@P p R Q Q Q PAnP$ P( Pl l>.0@mQU_ P2 l>.0@3@D8n<>.@.@.`@.0@PK?AoR@D8n<>.@.@.`@.0@PPQv@D8n<>.@.@.`@.0@PkIl.@P5 h>.0@0  M<>8nD@P.0@.`@.@.@ PPQYQPPSPPOl.@P  h>.0@0  M<>8nD@PP.0@.`@.@.@3 PP/l.@P h>P.0@0PP P dM<>8nD@P.0@.`@.@.@ P Q QQ*P PoRUo DA7Pd<$4t@|<4pPL@T2 P D P+ E   E.@<>8nD@Y.@@.0@.`@.@.@,`.@P  =Q @{ @ 0H.@ wPp !Z pa  / PZ @ ' @D8n<>.@.@.`@.0@P J @ 0Y=@D8n<>.@.@.`@.0@P .@ 0!  P  =ZP  P0!  Pv  =r@Td*pj p@P@t:pp@p W\ (@pQ:.@ 0 "@fV$.P@A= >=Pm>Q ?p\ (@Q:.@ 0 "@E.@ 0 =MP' =p$  #@ P p\ (@Q:.@ 0 "@  8 #@G! @.@ 4!@z#\ (@PP:.@ 0 "@@` pP.@!`@  zPU0` PPU`\ E(@.@@P P.@.@:0 "@ $< <@ %l.@ ` VPp W+p^V.P@ l.@`PpW P(@P/W3 P:*  H.@H^.P@ @ 0  0 @TW*p]H.@  0@D8n.@.@.`@<>.0@_HN.@@P !@ 0@D8n.@.@.`@ 0*b0p *C0 (  A1P8 G PP  E   p _@P ! p Q@P <>D.0@.@E.@@\ 0`(@p PPvPsP; h.p. @0d.. @ p p p JP <>8nD@P.0@.`@.@.@ D@`8n@.`@.@.@T PT9hQ.@0  p"p!`p.@0>` h.@0 P" @!P R p.@ 0&h.@0 p[JlP.@Q P dP.@   BJP P{x}0.@PP `.@ 0@-AT  W: P`ᱰ0P @TH`.@ 0@P .@ $ (.@0P .@ @.@0D@08npW.`@.@.@~ 0.p@  *b0*C0 8 A@E.@@ PhN .@@.@0 @p.@ FKPp.@ 0{p. . @ 0p.@*g0 .@*C0 A8 @P 0!  P  :Ep.@@ P  <>8nD@R.0@.`@.@.@q !p1   P% @ p@D8n<>.@.@.`@.0@P @T h.@0! p P'" p[fJpPl.@W pP ppd.@P pp  *I<>8nD@P.0@.`@.@.@ EP.@.@.@@B !@PQAh D"\ P(@[U8nD@.0@.`@.@.@<>8nD@.0@.`@.@.@ E<>p.@.@.@@.0@`.@\ (@E.@@ Q  PP  .@ 0!  P  9D<>8nD@P.0@.`@.@.@TЍl.@ !@x!@s.@ .@! 0@ P .@ 9Ktt.@@Q ;0 @ F  .@0!@ p9 !@9H-P@` pP$W   G-MM8F.@.@@P3 @Pp.@ @!R R"0B9wP `*0vP 0.*0}v PpW:@`.@Ѝڍ.@@pQ kI;0 @ ᴊ .@P  R {RPH.@!@ 0mp@-PpP@`{P wP sPp PP` p CP`@Tp  !@xO-Mp.@ h` @(@.@P 0p&W \W1p2 `/W-0G`2p#  pp'  p@ Q : 2   (@W `p0\W&W``\p P : (@pp P:vЍK-Pሐ,Y`P@.. @.@0@S@ @`F`!@PP" P@p@@: AR 0 h $ P D h P  3!Q , p0:P! PBQpPP Tp  X P K2M!@ {p@-@.@PU- P/@`P P PU P     `  PP PPP@pA-M @PJP `+ P pj!@2RۍA!@ &p( ( @0Q0p0Qp \ 0 /uH-O.@@`PpVP`WpU0PQ S0R ^\ P`p PP0P4 a*dB(*`` DHr # @-h;/0@0\ 0S ?^.0@ @T P PP Q QP RR  P \ 0S?o\@-h /@.@  0 0L@Q0 @ TQ Q 0 G-hp /@(@Q <P P @PѸ ڰ ? u, @<%`.`@ PJ|P@@p@\P P   Z @TP @PѸ ڰ  t.@P  (P , @ ,P , @ 4PP Q P @PѸ ڰ  tcGO0H-M@P"@@PjD P"@@ /PPP${P@.@?PP)@ pPP P!@z!@/5 @p Ѝ0/P+ဇO-Mp @(@`2Ȁ~㳐TP`P!@.p@!@T   s 0 5P  _PPQP@T Ѝ  e5OpO-M⨟P.@ p!@, .@ L?`P/@/rP   (@\"@@y7P.@`V& Q 0`-QV-QpeGQ QeW kW iWe8 (0@`8 (0@j8 (0@0V`!`@ /@@p GPPa@Q&t<hx!@DPEP IPK-P>@QP7 SP ?!@p^WP p?Pp^ZP ?P^YP ?Pr !@m px (@EQ`T'hK/@@ P.@.P@ (hD\QPPQ gHF5P  ZP.@.@, 㱩P /. @㱔P p (@!@ ,rP-!@ 63!@ 18!@ , P @P P@!@GP[1B!0@!@r1l!0@!@  "@FqnH-W p (@!@qnp@-@.@?.0@PPUp1"0@1!0@p (@`!@ qh /@P UP U!@U@ %!@0p@qU !@!@ p@q !@ 0p@O-TMR`p!P@/`@P  :FuPPp GP gPPx (@PU}@X \'P pp Z |@pY P@ Q_P`@"P@;1P Q WO gp ap "@#p !@W [p>!@Z pH!@X 0p  @P @pB P!@@O"@! @0s!@ ڄЦ!@ɄR!@ H-S p (@w!@pm@-M@ %P   p Ѝd!@ ោ0H-M@PH ჿP P 9Ѝ03"Pp H-P@P Q `CP <P`P CP rQ <`V@-@Pv P   ٫0H- (@a1S  @ P PU  @S*Q0Q aD A0sPQ  0 c A 0C0H-%%H@-`% ( @!R0@T 0RQ ` @ rP   a @0 BH-QQHH-RRHH-p C(@0 !@l0H-@.@@Q0tP6 `ȾP  |GV/P@أ . @֣ . @s@.@@) P.@ % ( @!A< *q000O-,MPP_U.J.@P) .@X# ! PP !rQ 0p 0Rp (@㰰(JP , R P 2/0 R  2/ @P!p0@pp$p ppS pQPPP P `PV` @`Q|l  P0S 0.@0 @sR Q1D@  @r  1 PUʰQ@ r R  @pPV`ӼtP1S.P@P8P T@PU PP`` @PV` pPV `Pp@$.@ PS`/vQ  Q `@ @`R .@A 0PاP? r놽P i{,(@  0  Q /@?o A(`@P/PP)vQ+P @Q0SP RPG@Q *(T.(*(0)(8*((((()=P P/ <Pi>P* ?Pv < .0f0)8**) Q0r`E RQ V p1 AR#pa0QA ! o R(`@/P !30@S<)8**)**"P0A@0 B0!ARQ 1A0C?1(tꦎT$pW f/`@̡P͡ 0P P@$P@/@喒 pP`U$ p`P V P`Q V/@s5 !0@  0 屨O Q(@@/@3 PՀ PpP<P >P dP  P@Q:P wP uP qP!RP SPU PQ  ?/xP .@EP.@PAqP$@ᙨḖ/@so ((`@A /o (`@ o r0(`@!pS B  / /(o (`@ xPQ zPaPxP@a@(P(@P  .lQ;s P i?U4R``  R  2/pU P!PU   G s `P < 3 `. `.@1 r P %P (Q P`P ( P`qV4 R  2/ PPP  P,ЍE$0.@F!@  8$v !@a0 @ @+.@ !@1 @ px>>>>Qa  ")/ @q P!@PP  B 0H+r7 Q Q Q/*/ @)q/ @|!/ @aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-!@6H-YH- !@6H-7H-P.@H- /@nH-)H-.!@5H-:H-:H-:H-:////H-/@,!WH-/@,!WH-/@,!@WH-/@, W//@-@0@-@<@-@5@-@r@-@/@-@1@-@1///H-.H-.H-.H-.#2H-M; P/0@ `   0 ЍH-M!/@ 0m ЍH-Mt/@ 0[ ЍH-MQ/@ C0I ЍH-MT/@ 07 Ѝ0H-MK/@@P  0P# SЍ0H-M f$/@p @Q  !@0 # 0d Ѝ0H-M[/P@@ 0@ P p !@ z !@ p !@74z !@44Ѝ0H-MR/@ 0 ЍH-58/@H-P.@/p@-P@`<0!@ p@^hH-M/@ 0 ЍH-MT/@ 0 ЍH-Mt/@ 0n ЍH-MQ/@ C0\ ЍH-MT/@ 0J ЍH-P.@///////H /@@/H /@"@/H-M/@ e0 ЍH-MR/@ 0ЍH-48/@/H-M/@ e0ЍH-Mt/@ 0ЍH-MQ/@ C0ЍH-MT/@ 0Ѝ//H-M/@ e0ЍH-M|/@ q0sЍH-MS/@ 0aЍH-Mt/@ 0OЍH-MQ/@ C0=ЍH-MT/@ 0+Ѝ/H-MS</@ 0ЍH-Mt</@ 0ЍH-MQ</@ C0ЍH-MT</@ 0Ѝ//////p !@/!@/!@/3!@/9!@/H!@/H-Mt /@000Q  a ЍH-Mt!/@ 0~ЍH-Ms/@ 30lЍ0H-MtB/@@P  0PXSЍ0H-Mtf$/@p @Q  !@0I # 0d6Ѝ0H-MtR/P@@ 0@#P p !@ Sz !@ Np !@l1z !@i1Ѝ0H-M K !@  0ЍH-P.@Dt* /@*J" A//H-M /@000Q  a ЍH-M/@ O0Ѝ0H-MB/@@P  0PSЍ0H-Mf$/@p @Q  !@0 # 0dЍ0H-MR/P@@ 0@pP p !@ 㠆z !@ 㛆p !@0z !@0Ѝ0H-MR/@ 0JЍH-B28/@* /@*J" A//tp /@!@/t/@!@/t/@!@////////H-@-Mo~ @P  n{^ЍH-70H-P0p @O~ ~00H-@!p P@~{0H-/@ |<{@-G/@@qP /{H-H-~0H-W@/P@ |!~ {0p@-gP/`@)Q Mz,@ @ |A{ 0x~pp@-gP/`@)Q Ma,@ @ |Az 0_~ #~pp@-gP/`@)Q MD,@ @ |Az 0B~|pH-/@~0H-W@/P@ |! z)Q ~ 0"~0////_!@/g!@/o!@/x!@/!@/!@/!@/!@/!@/!@/!@/!@/ @/b !@/C @/} @/ "@/!@/////////H-M/@ 0ЍH-MT/@ 0tЍH-M /@ j0bЍ/H-M 000Q  a HЍH-M /@ q06Ѝ0H-M@P  0P#SЍ0@-M@!@* P !@0 0 dЍ0H-MP @0 @P p !@ !z !@ p !@:.z !@7.Ѝ0/H-M/@ e0ЍH-M|/@ q0ЍH-M /@ q0Ѝ/K-@`!PRp  " RrǠ Q6!0@嘒<"0@ٌQ P"@/b!xR Uaq wRb(q !@bY `a80S  3/PK|A-P$.@U@& P*`#(.@pPUPWP:,p`.p@P `P`4.@0.@A-Mh P(`@8.@p @U@-  pWp' P 0 0p pPWPu !@P @@<.@@Ѝ0H-@P (@PuT (@A0<.@P:P 8.@P*@H-$.@e0.@4.@$.@弑$.@ԑ@-@$.@e0.@4.@!@@ MH-M    $ЍH Ѝ/M0H-MP$.@@ 0e0.@4.@"$ Ѝ0HЍ/O-M,P@(.P@.@0 ^$40D`T.@.@.@.`@ @P _ (P@ 0@ @ @ 0@0S 0p0@ @ P P3P@.@P P >{P 8{@.@]PޒP ${ !{@ .@ G@Q.@@ `Q PD[ pƒW’VUEPU zD`.`@ [D`.`@p zpGW  T 0_ !@pP D.@(P@32PfP}P z壊@.@ЍO虙H-!@HM@-M@ 08# Ѝ@Ѝ/H-M!@ЍH-Mp$.@`@Pd0.@4.@, |(#  0`ЍO-4MXp/oo`"P$@.@b\ U,@`pWP"@ `*,@P(`$` D@`@ 0p (@0P$p.p@3I 0PP@I [@I[$pPtP Q.p@  ARPAKQ,$`(@0 ˑU : 0@, A ՘@ `ZuP~PZZ? Z_q~kAZ2Z6 AZXYIbZ` ZO Y(@  AR0 B00@PPPAP @ @ P, `K  `Z Z#`u Y', K APIK`j[Y [P ,P J<P`W Z [ (@ ` P D,P K ⷴ P`:0P $ 0( @$.@|y0.@4.@ P QP ,   ,4ЍOL !@ @, p@-M,j0@!`@(4PpЍpO-M$p@.p@P`АɐHDU

P<  @ 7P5 "@ 0P. "@ )P'  @ "P  @ P P P "@ 0mP #" @ 0P T.@"@bP` !P #"@" @ 0FPF 4  G㽏.@@,yx 0tw 0oᔻPXTG.@.@/@@ V 0P <P Uy.@0 R<P sz.@ U.@^$. @QP*\!@@T .@],! @qXAP.@@ ( v  P ,! @[GP/@@  `  رP X-/@! @PT.@<P  C P  -! @+P  2  㪱PPT.@bh`P P T.@4A> `#@" @ 0LPxJt?Qg!@Pr!@ 㦪$. @{0} 0T.@| 0U4t.0@.p@ @P}> Q !0@<0R S DsTp.@@.P@`Wp0 pV` `S0 0  V3W" @. @.0@pd0.`@S0p 0W"Wp 0V3 p @. @.0@ppUPM .RrF R  /"@0xp  p*P"@P2PD/@H8,a 8,[ !@4P TP.@P`/@.`@P7  !@@LP @!@ [?,.0!@! @W.@P W"!@. @X/@.@P '!@/ @&!@yU.@Pg W' s+T U4.@!@. @.0@@kH "@F0 `+.@@ A+ ;P  0=0P:.@P- K!@+ `p"@ `.@ GS "@}B P L_ (p"@@Pp3 PNX.@ (p!@T U4. @.0@V.@P VC.@@<G0P P !@X!!@. @0Q!@oxnߍ ۍЍL /@0S s""@ p (@0 "@HL /@@T A=p (@p@-M!I0@L PDP D2U.@ 0 PDP 52.@ ٨ `p8 PP@ @$ A`T.@(`è8(L P8UC.@ 㱨MCP D`P @.@@ u q 8 @0@pA`@$ 0(@  0@68 R_ P4Qm @0R 0pW PpRaPVW:( R1/4@TQ* O@@pp@P@TBP0< `Y ᐫP K? T9P 0P4PP 0`4``N@TV  y P4Q @0( R1/4@T:0 ߍڍ`[H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU 0Q03P  L03/P P `V:0Z `Pq Pl (0$`P5 (`$,q P) P 0QUQPU 0Q03P@ L03/P P @  X:0`V( @< 0`H0  ``` p 4<`8`P$`4`N8P  P 08p<  $` PtЍO-MpPPF ` Q9 p @pp  L0 3/P# *p/ @p`0t P 0! #7"@P P  `pY: \ `Ѝ0H-@P0P 0Hgp@-P@2`Q+0 @ p@>A-@ PQ ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMP x`p@;p p6/P  @;x` p p6/P v 0"@-oBЍۍG-vM@P #@pO`"@P KP PN۬ N (@ (@ Q Q `P# a'P| ``04P A% @` P )`0" @XyP[ uPWQS @qPO fs@P I  @]pj `~p| ,P@ @@ &@ ?}$@0 L(PNUF@E& @P; &P8@R@P2 "@|P- P b/"@P' K?nz !p@p # 9qᔟ (@ G0 PPB@)" @ 0`o:@Y.@\ boPL @ Q唑P P3 JJP@pT  KXD0H@`L `P\`TrP P" K?j!`@ ` # %9( p @vOP3 p167NPEQ, FPXQ( g!0 k &pA0d 0^K?^j !`@` # 8) " @p= ,@`70 pP(Q0030SP'Q 0W0'0Q0p 0WP07@&P: Q@ RQK?^z !p@p # 8)`" @ 09NPPPvߍA-S `pW WW`V  0B pSW WW V F0\0@P\``vp W:v\WQ Q `&c``aa``a`Q p0RO-dMMpQ :"@P P dЍۍ "@z`P  #@sP v/t_r@evGVv6 + /r+G(P \R R 0S  @/@@PU1 $P R 2/pcQUg/`@+і/+rɖP`@PaUn:f4aPj+⸖/@$P R4 @_R'wP/p@[P K? 4P ` R 2/p1/w/p@N_[p2/p p/@P$aV /@;x@ k 㣬 p@`@ @@ ၦP) |P$ wP W !@qP  "@kP  @eP ! FO"@   @ sP FF&P  p!@ Ppppr /O-M aPL03/PH t R 2/*p/ @0@ P壤 0㜤0&* " @7P @"@ ᡕ ᜕X @"@ ᔕ 㐕Pᰜ P..@!@:ЍOo/G-M   #@#@ 0#@.@Rx /S0#p@. @`PW0C's`0Qppp0O.@@_.P@.@.@P`.@`W@pSPP@pMPP@pGPpPBP*:P" @!0@P(7.@ЍG&H-M !oЍ@-M@ !oЍH-M !oЍ@-M@/@@ 0  / @ !Ѝ0H- !@}{dqQ @ P@##"@/0H0M0H-M@ P$0 n R "@0@ Ѝ0HЍ/"@ K0H-MQ P/@@e#aNR^0P"@@/P@/@ P6Y#0/@ P6Ѝ0O-$Max8TH|" @`!@/@"P@/p@!@P "@=  0 P= :"@/0@'㝰P#@`pP. PPT/@/@ "R/@+"@ 0Pp` @ 뜰P!yP! a!  @$Ѝp@-MM @"@nP  *@ znQ u$f @QЍۍpH-MM "@inoЍۍG--M( P0TO0L0$0LP$̒tX/@P`  PmP Pt/@/@ ՓQ/@/@ ϓPPR/@ P @l PoJPm@qW W /@/@*dP4i /@?*  @0@ t @T0P" l 0 PPPPPPp1 `mTDTt㐁! /@-PW xA/@@P "@ncQUU܍ oRPpV h0"@" @"0@'ۥp@-M @/@P+ *"@/ @P#x/@P@ta^%`/@"P@"`@/@@ 04Q/@ /@04!oBЍp/@-xA/@@P"@@-@P `6F /@@qp@-M  ) @P( -|!:"@/ @/0@Px/@NKt%P/@SmP"@@"P@/`@/@ 0`4Q/@ /@0`4@Ѝp0H-MQ tPKS]/@P"@@/P@/@ 0y4Q/@ /@0p4Ѝ0.@ r/0A B0 /.@ P/ @/ .@0Q00A B r  /.@  /H-M(@/ܥ (@ 0` .@ @@60IP0```@ߍ0H-P.@P 0T A @P1UT @D0U@8K@@KL@@ @ @/T1TS0,X< @ 0@ 0 0A-q 0R&D o.@.@ P"@@.`@p00S 1SR  B0  pT 0T0 @pG?.p@.0@ .p@p@P "@0A6/. @@p@-MP@Q PPWk"`@ aa"@"`@2P` 0ЍpO-kMP@/@`P R/@y PpWPT!P/@/ @  "" @0PX3BaPQ 1/pPtб P  P [ /@ p@\V[ /@D Y Pf"@X  "@0 "@`suV [ /@   !@`p /@1opP8/@P  "@.@p[   /@kߍ@- @!@P @P / @/@Q /@H-P T/ @/@PO-,M@p$@咗P $(P@` (``@ `V$VQQ P*磗 (p@@A$r@P+@PE p$peP@* $`PA( (```'$VPP Z*`H J p@`  h(p@$:PPpP V@D@P,Ѝp/?"@" @"0@ * ( @0/S/.@S0S 00S/0 /S/@-M   @"@0@u POЍO-MM0 0 "@0bQQQ 0 0 "@0OPPP ` p0@"`@"@O%  : PT4l_VS !P@g&e"@ba`^ i/`@f1RP  #@  0I7ᰖP ᣁ)R`Y /P@ Y8m"@ PJ P` "`@6 P  00؁Q;Q8Q6 yPU/ P "P"@ ! P P"@   00夁PPP]T"@ ЍۍO-WM@%"@`  /@0S  "@ < /@(@PP 0ᴏ C/U.@$@X 0S   R /R/U`Xq z $Pa(p@"@/`@Qd QaP @L /@@i/@Vm@x/@P "@@0 0a tV @%XP P P* P P00S 1S /S#Q APP @$PXpG @Pp/U$ { P  Qx0+`"@ p /@lZ) P 8"@.P+P q"@"@"@P  UxA/@@2  N"@"@%xAP/@@ "@(P( ,0"#  "@G- "@'P 7"@x -"@"@PP "@( ( @"@0@RZ  Qo P T"@ Wߍ@H-M 0Ѝ M0H-M@L "@!@P Po "@ ]&!@Ѝ0H Ѝ/p@-t (@PU H `!@@P P  ?PUQppp0H-M"@uP ግHG/@@ P J"@/G"@/@܍0H-M"@RGH/@@ hZH/@ /@JLyPY8$/p@/P@" @06/  @ SK@H<G" 1"@ @H0 ` 0 @ 0 P`0P$J] (P@@sG*@0X." @."@)P GߍA-M`SBO P @  㶓P`E L/@U/@ (p 0 !@ @@ލH-<HzGO-M\/@@T (@@`/@P (@?TP Xr/p@@TP@@TG/@ ` ᓓPH /@U  @ Vl !Pb @epeTU .PR  w 0pJ  (@X/@P UPB  `/@P7 `/@  ݟ (@  P  P"Xr@/p@  T@  "@ Xr/p@PH /@I`/@pῆP|Xr/p@20@ Ѝ@-M@P   / /@P /ЍMH-M  0 ЍHЍ/O-MM@  "@ !@㌮P|J"@ !@ギPrJ"@ !@xphVnplDp!@.Pe Jnprھ P@ZPo p PP` @㙭`ᘒ HP `=P !@ ` P j[h[VF !P /@P!¾P3  Q* P1P2q#P P 2!@ 㟾 /@piPЍڍ '[ $[P  H-M {Ѝ M0H-M@L"@!@P P "@ Z&!@Ѝ0H Ѝ/ "@"@"@-"@@P "@ P &"@@P@O- MM& @㋈P2 9HP2 p@P# pV p`P@"@@+ϊ P* +㚊 T  +㔊 TlP P  ^o᠂ Ѝۍ @-@ᗑQN@!@ do@- @!@㺚P t Q/ @/@Q/@H-PPviP#@Q/p@@U/`@ Q|P ut }0:-:WW:R8R~hH{h0H-M@OP@Ḟp (@0"@ 03-W"@Ѝ0@-M@yt y Ѝp@-P (@@/Q `Q EP /Q`@T@pK- M@$ՐP Pp` pp pVQQP:$㼐P ЍMH-M00 @ 0ЍHЍ/A-pP`P@V !ᖒ P P8/ A MH-MH00 @ 0ЍHЍ/H-P /@Q"@/@"@ /@"@/@& !@/@} @/@ @/@H-P40 0 C 0 A AH-P40 0 C 0 A AHO-DM @`P pP L03/` PU:pRP K ` PVF pK L03/P2 剁i(PQ "0P   PPPR $04@P0R@ S8p,00, SX 4 T\0 [2Y1:PDЍO-MP  @ @4 A0p W[ Ѝ@4 0pS RP pP P`4P!ip } U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P pP` L03/P `V:  D@<08 8<P@ D01/HЍp@-PP` F@ P p@@-@ (@A-@PA pag0 hPUpHpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:JAGK-M @ Wp@ Pw`up @@@ ? e@@ 5&@ .}$0 L@=TE@| J!@@"@ DPЍR@fP "@aP @TO-M7PE y!"@ c0  "@ PU p@l DPa@PP# @PU! @p  Dp@9PP eD .@T  ߍ0P p@"p@ Q R@T: Q4`!~ya0P"@ 0  p0p  esXZ/P@+`p  iaPP k Yz 0T"@ a0f x&(^O  N q Qp @O0"@ A   @0;  0 Qtt.@0@ S 0  0Q00A B r   " /H-M(@P`/#0 a .@@> 0@` P00P `@ĹKߍ.@00S 1SQ/A   .@00S 1SQ/A  H-M`mVpo@p|Ppp  "@ nVp*"@"@V"@RVi"@"@/`@&g@Q4:Ps P)ZPP /@P |/@PP p`"@ `X @X@P a9"@/0@ _ |!:`"@/ @/0@~P.@QB@m o(`@ `  !@R( PPy )P/ @|Pfp@PPk *! @PP]"@0h`.oRWP.@Pk  !@'ڸPP@ /@P8 T /@PP1 p`"@ `X @X@2P' a9"@/0@ v!T<"@/ @/0@`!PP"@ 0`C"@ hPUPލq"" @H-MP' @Ly/p@Pb^P BP% `|H PY/@+0G/@/P@A! @`'  @ gK (@P@T L+cЍH-H9h"/0@d0G/ @/@/@ !@-@H)/ @ G/@ bd!/@ h/@H-MM` p@;@'p  Pp @@'`:#`ЍۍH-|dP@`L P DP p P 'P  P zDH-MM @`;P`d'p p 0V@`tژ`@Ѝۍ eDO-AM@ PPAߍP` L03/P  P@U: АԠ,( X*$ L03/P  X: аp  [ ,[( YY /@ @ 0 ɒ, (0’@/@P`$ 蒒 "@pP % /@0`  ᧒p  0㠒`P(/ @@@0@P ` P% 0iO-SMPP@(JXP@1hT㘰mJ `Vj:T 40@ YVp@$pPh 0p8`#@,P<@Y@  #@ a LP0 #@@ RRp #@pP8 NRAX;  #@ 0 a<@ @H1/ @Pp`0dp0 ppp3/P5 e  I803/|P`$D/@!$Q # @ Q #@<40 8L0 d3/Pf P @Pp ؋4@T@\$ @  0 0 7p` 00  @F`s P5 7Ẻ@q: p<@80QU Sn4P4P@ PP03/q8r L0 3/ |`@D0@ X@<@Px``TPH, \ \T<@!a8 RK Ba"p#},PT 1 C"} @BtS: q8d 0@ 3/P2 T `Q4P, 0 `V/  0S# @0d`4 6/P P - -@Z"@ 9܍0H-PH-d"@H*O-M-ZMh@P~U tP  g(@(P/`@Y Y Y /@$LHP '" @スP ;P3 A'" @u4P3 P9N-`'" @0aL /@X (` r0"@ (`rp\Wg7#/`@O3L7'0" @?8Yts!/@/@/ @P`P P P 䍊`  @/@HF/@@ P&aH J @@& F0hp0  0pPPP?(@ሢZߍЍ /@M PJwPCIp@-@Pխ`@ѭ "@0p@`A-MW@"P@pg @ LP/@ `WO1"@`V "@S1 "@W "@K1"@ ("@ 0dq"@ D 5:TP (7" @"0@ (0" @Pㆸ"@&P 0#"@ & r@\ !@ R'P~oЍ/@"/0H-W@/P@Pb !T0"D/@ Q0(4 /@ (0@-@/@PH DQ\ #@@t0H-@P@o0@-M@ Q T sЍЍ@R@-G/@@P x!/K-/@`P P (NpOO QPP R 0 RR;p@DQP ` A A @1 0 F0PIW# (  Q$0X, @!$ % Q K-0Mo@/`@ PrPЀP 0X0$ 0S!*P    PP9P QP P  R 2S  PP0ЍK-M⺛YB0P,`(BpW@T V `VPY P\apHPW :X X# iq^ "@q^ y"@"@~"@ 0  Ѝ@-0M@    @ @00( P, 0ЍO-M/@pP  P vo!P0APP S @0SSP`RЍȰU P0p 0  ]((Q $xP,QXQ  |h  PP Q9)Q9"@" @"0@ezO-TM@<p4`,$  e@8  `2Pv (@D` $0 R 0@, RRH `L0@8 R P T  ^PP T0_/P@R 080 P@}0<Ġ⺛Y" 0` Q BTPPQQS S S @ hS:@Q@@bTb 0`Y P @ ( (Q $awY. *$@`T& z"  @ 4QP   vg 1 (p Ps 80  RTЍ0 r/ @ JvYH XL0 H  @DL QG-O/@@\K T$ `p0SRUSSW W W P FW:PSPP@U@ p`T`\( p'1!PE Q $v`X zf QP vg !  @@@0H-@PzP  0O- M0p4`pppQp@ pappb@Q w1 Q, w* @TPPPUPPPXPPPUP PP@(0P @ 0  T PD" P%00@@P@ pGY ЍH-@+R 2 `PpWpW V ` SPT "@ RPT }ũ  p"` pG pPO-DMM@XP \P `P dP hP H0 Yf0P"@ 8 8pWQ   80`(p@PPPQ PV`:pW0 Sp#@ a @9 0:W` pQp S0pPPD` "@ @ Pk D `"@  "@`0d "@\h 0"@X "@ P- [ 㤩"P@"@ @+ ap# @0  p PP  p$"@ @X  X:&!@5D@3I+0"@" @0kPaoRDЍۍ):"@" @"0@:x).:"@" @"0@1x)G:"@" @"0@b(x)_:"@" @"0@x)z:"@" @"0@xO-$MMPP @$ p;p>p e0 D`6pTHtPP"L$WXQ  h` @ PE Pv P P  P%q P  $ 0PP  e Q t 0P0P p[:j Y"@P㨳P$ Q:P a0rD`V `VpWs0CQCp$ЍۍpO-M-8MpP&`PK PF ppp@ dt Pp2t p P(t {: #0@(0\0 XpG(!ϊPH #@ `H `|(  B䐄 8ЍЍ/h/p@-M@XP \P `P& dP, hP2 P0 Q&Ѝpi+:"@" @"0@gvi+.:"@" @"0@hvi+G:"@" @"0@ivi+_:"@" @"0@jvi+z:"@" @"0@kvH-R0H # dH-H H-P`/m@P p@H !PaP:a@P*Q P @ R R@P@@-P @@+;"@" @"0@dv@- @"@|@ 0H-@/@PнT TTT T  T T@ P"T0A-Mg@/`@PP "T*a=/@/p@Q (` (0S0  R4``U* P& P4PP+" " @0@` @$ @ F,pr p偦@ @(0" @ (``@pEЍ0H-W@/P@PqD  Q "P/@Q /(0D/ @ S Q4 p0O-$M H 0L rX`0SP\p YPT@QpS 0^0  0q Pp0 qYp [Pp   ^ T  YP `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP@S@@@`Y```` PZp^TT@ ` p 02qPTp ^P pY8 P  P   p  p^T T` P @p0pPTp ^Pp Y\q:p $Ѝp@-o@/`@PP`r0Rv+Piv@ 00  S@ pO-$M $/@0 QA z #p@ P - LP@UP U [ ` 0 H6/P Ko Fo@P  0H  p1/$ЍG-@P# Q 80Q 3/P41/P D0/P@41/@K- t @p Q#@` 0/P``pWV /@`$P/@  TR!HA  qKp@- O/@@Q $_`/P@! R 2/`V:$/@p@H- Mtpq 0@P UUT @U@00@P` VVU0V  PP@Q 8d@0  "`@P"@ % ЍO-|M1/H1/4/@0P1T!sP 0Y, [(0I4p8P0`0 ` ( ,3/PpoH`P ! @ A A40 eQ  DX 3/ p03/pR H L03/PJ QE pH L0p1/>H@$ $p40 ( 8,  7/P\ 8<RLHdh 803/\  p @03/p 0[ypp|ЍO-M⼧@/@P )`Q(P ЍTP +<"@" @"0@rPUa /@Qq 눉/@  Fp0 `@@RQ0/@0 P``哗p &0PHpTPPP@H@Q@ LPBLPJ4P `P TPQ `" R pQ 2 !0>PpW:T`V:P Q TP :@PPT@PT:P($3p P` !@0(C0``.`!0$(0 ` !@$忢$幢H`P A P0 A0S B BP @8 3/P P@THH` /@!@ @ !Q :P@, ]H `Af 0` `````崖p Pᣖ@,oP P`hP d `LobP P  P* pHP` L03/P PU:X\P P`(ViR`P FP R 2/@``L /@0S~  2"@ exO-LM@ PpPD@ <DP `R@ #X  p@@6/P( X\ 0 hhl 3/8qP  h L0 3/< h4pl0p `D @0gV@pPL[:I/@@傸B %,  PH9pCߍ/O-MPQ `$@@`(P  "#@paU $Q ' @ Q "a@p@ЍA-@8q X R 2/P Q8q6 1S   `@ R   `0SP P $0S``0 3/< QP0`2 P$pPPVP*8G-Mℚ/@PP[J/@@㼛/@o_P㳛/@f_P~㪛/@]_P㡛/@T_P 㘛/@K_PŁ㏛/@B_Pū㆛/@9_P$ R p`(t*_ p`P$ V:< 0 RZz X0*:/ @/0@Qk 0@ b`8pdp``J 7//@@P(70"@ I @/@ 0f`*:/ @/0@ @/@ 0f*:/ @`/0@*/ @ 0 P0f*:/ @`/0@x0/p@ p"@p/@0/@ Q /@"@{ލK-MP1< @Cp(0AS*d`08 6/ 0( 噝08 pp 7/Qh0 83/ލp@-(M@,0/`}PV  @  R 0 @ 0  ю`p ᐊAᎶ(ЍpK-0M8q L0 3/P  ~@P |@1/ P@ p U`0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  V` 0P`PP ҜP p@ 2/Ps` 0`PP 帜P`@-@Q 0 A2/@P  @ř !@@U@-M@8q 0 3/P7 Ѝ@/O-MM "@G Ps "@dP Ph  "@WP p# "@$@+:VP  "@ 0"@@"@ $"@@+VڞP "@ 0"@Ť "@@+U"@ ᶤP-0"@" @㭤P MP"@@`+U "@}0"p@ ᐤ:"@+U"@0 |, "@wPs"@p, "@kPg9"@@+U:"@\0"@ VPR  "@t@+UP"@E AJ"@<, "@P6P2I"@U묰+ lUJ"@'⠤ a~Ν@`(@"p@"@ 0;(P  0PE u P *RЍۍ O- Mp`G@T> YP Y8POP0 T~"p@Q:  ?P a "@ 0wp @]OPP Y Y X"@0弣JE ЍO-MMP/@`"@ `OpWP P a.0" @P+T PS*Ap/]PP `P FQ Q/R P:JP vP+ P  Xi #P(J/PP8$0" @pw+T"@+T PϜP J P+|T P:h?h@  h@`Ѝۍ8$P /PP) P`P M[`J[ PU "@+T P*+T P* Ờp ớ`h>h@P`H-)<p@-M P@PJ  @ㅛPJ Py`ᑛ V P: !1qQ0OЍpO-M 0 ` 00 @(8p> DD 6DP  0T 3/P\ P) hpAg"80s ` 0S ФP L03/P hl ! PU:P(P"8PpW: z0@/p@8 ` ` 00 ,`Yb*:! @ 0@0 g.X" @uP,T0 S q i( p @P`TPG CE *! @ ` SP0|8P` Sg.X" @,`H0@4$P,0PU}/@ 8"@`0 0Xh`@i/@/@0HH,!<L`AC p` WcP@ /@P RY0Ѝ0B-(MV@/P@M 0(P (,/ /@(0 L0@Fp `@RQ0/@0 P``ap,0,妉(0(`P,`((`(ЍO-4M@(@ CeP (pU 60@`0 p  0`Qp@@= #0@81,0n@ 5 `$ V 0Q P ` L03/P  P U:PU  0`Xp PU@P0,p(EAΈ(E@4Ѝp@-M)@ÔP8 P `0000S0P`pP %+r@,oi  " @P0  ,+] P Q  @㡔*T Y !@㙔-L0/@Z@( @F.? n.#@ /@" @0ЍpG-pMQJ@PPㅑe: 0 ` V  2*/ @p 0_% : @ r`T P v#"p`" @ /@0 u_: g." @.w" @J& ,Pfp.0" @(H0  R P5 ` p=TX嬪( @/ P 4 t R8qS TX嘪`  P 㭓p." @(0L p㢓 `㎿p 㙓." @p( 08 p`+0 0@0 J "@pV 启U pЍ8=0p 0h`op." @(02/`P O-M⼧/@)$qQ `W W PQ% P!T11/PPP(0`o"P P`pH!L1 0 `1/P p$qP P pp`@ L03/P P P@ `V:@V?@ Q<@pR  :p/0@0S P1Ta(h `P0l0S h 3/,p !@ p0#h`bpdC 0p~\%0pu`p归hb&T %0 `嫒p姒hb '0  !@喒咒0p`,(PbT L @'|pp` |l3@,0@ /@0\3 0@P 0 :(P @<0]p `Af0` `````呆p pဆ@,(Lӆ0ppW PX!\9GP.$41/``pphl 05P pM`ph@l1! ,1/4pT<p<H@1/0` C(   ```4/Pl`h```!(0l0h 0 Q  01/ Pp 0 0NtPUj xH QpU_ p"@`@,P^Po `VppUH ,0 p(pW%  p0UU: ,p`e PUU(PU  BppV+ P^P BG0@ PX SR bpQb 8L0( 3/P px8 0 8p08 ( 7/xPPpP P t0 P |xp`mp`ЍpH08 L` H ( 6/P px8 0 8`08 ( 6/x@DxtPv. ?"@" @"0@k`cO-,M`p@/@ PV/0`ɓ/P PU  4H/Z  P]P pPY {`Ӑ PV߬P( P* pp aP! `P(pp AfRp`TX ,48qa,ЍO-tMP/@$hT`P @ ZP [$P @  R(`d` ``<<A `] L@0H0 ```囄 T]T]`$P>JP (P7 P Pa(P!p |P* p`@p@@b"tGdhR"pmGPp Fg` @0 8@aPh  p hl@ 4 h lh۲`o `tЍ///// O-lMP pP4` Gp Gp G0Pp`@W@R $0 000@ pPp0Q  p〩P @ *.#@1UI  P:R ,0ST0 S Qp D/@lЍO  a @/@P r $,4`X( ,$PQ ` Q 803/P ,(Q  RR(  (  ,Q P  B p,P P*4Q4$@`G"@\P a"@\P GpP,,(($`P P p X:(4,$($P Q 8p` L03/P LPTP P (` V:(8 0 P1 88`p L03/P HLP  08 < P    R pW:H1/` [*k8q p /@Ѐ@pT 0@t0@pW  0!k , P  0 2p@P@0@ X*S 0pP YW!h0$ [ 51 0 7$P5 X*1h2(0 S&*1c20@00@WP,  QP@p`A R80s@0p @X0p0pP0@WPZu$4p W!*!P: 0` Yg [$0`p@Q@`V0 @Q@0@P [#* 0P` _YY0px /p0S P  2p@@0X0@P0` PN0 @ Dp @P@0@ ? P<0,p@(W :Q*Aa^p q P rPU  P$0 00W* ^ 0@PPXT!g0 lЍO-EMP`0Ud hlQ `80 R0P pQ0s  BYN p$PI ࠍpPV p RhP0 lpp`pPW:!8phP @T pPp Rh L0 l@3/h @T:PlE oq-A&KQP0զPX <H1/TPL HRP h D #X`"PPT\P{  0+ @p8q hh( L0 3/l0@TpTLT PHP0 @p$X\ PP\lp0`Y:[6*l 勑kD\p< @  0Pp P L P0PHT `WPp !R\@`DPR` RP PUPD/@PlPJhpd `0r(@Y0 T`0d H1/0W `PP(PPR$P_ SDX\@& @88P @4p,`pq[m P85 P g\p 08 4 pD @ d`3/PM , tp0 Pp\\PU0U p8 0 0( pp00>/ j< J\P A0l0 , 3/p P\ L03/0 $0 P` (  0P`D @0p>WUd`p@p0T:W P T0Xhq P Dp p @p\`Nd0 S`@ P8q0 lpp0Z: hQ~  0Q00TpP`Q0  d`p ````3/Pl Dp @p00TP d`p  ``3/P p\ t l`0p\,ppX pW08 0pT ``;/ g+ Ad0,0R,P}l 03/hp l L0 3/LpHpP`T P0VUd`t l`V|*Pp L0 3/Pe l 0`06/PI  PTp0 RP`0  d`p `PP3/P  0`D P@ P  TP d`p6/P t0p p 7/PQ P Pyh@hP lpd`g8p_ 0\ QW PT@@ Q P L03/P  ! #"+ P U: XPT08( @@B`  8p R7lXPp@h`0h(8p[@pp0PT: |1/ 0 P!, 800`  6/l@ P2 ࠍP L0 3/P lP l 0 Xp8@t@T@ `!@#` P0pp  PU:@08PDHl@X嶥< `p" RT    8 rpQ pcPz `V 8 0 Pp0T l`0Pp W `VpP Q P*`0Ep N `V+ X@` p L03/lPp 0 ` PPX$p PT, P`p@V:l@PT U*l` p 8pep NPVpp2`2 U1:l@l@ "Eߍ /1?"@" @"0@]fXO-M(p,@W `TP(P VPQp0 pWpP<EUPX@p aP8   arpYQP  E` P@  , 48T`XP$T P pPp!E$  V R PX$ЍH-P$`P@ QxpP_Px 甤xxaV`O-MMP$@/@pWr w(P,$P QqW^ L0 3/P  $ Y:Z Z Z P(/K/ @0 `@T@P%@$P S` 0`3S  P  P$00,@ P d`x  0   / @D Ѝp@eBH-M+X @Q0/@ \; )@ @0@ЍA-M@PU/@Q  !@ ^P* /@P t@ RP/ P/@P , @ EP{/@p00 @`CPU PUM pW@h/@ 00A<p8`V 4`V HWQWTo/`@N0A8&04QU 0QU }WE< G 00@  a/" @3NC0$ xP  0P05/)" @P0N@ ``0` `PPPpW XpW,`! VBn/" @$0`P"` xAPЍH-!ROU 0S S S80S00 80S0$180S 0|1S 00000 Ro {4 "@" @0@mTH-8Qo {4 "@" @0@mT0H-p/@/@P@@/@@Q QQ   Qa/PU000H-@$P xQ R1/0H耠~$ Q:Pxv$P U:H-0M@$P L0 3/P* UO ( /@0S0A`0  BR(( /@pWpA`p'`&p  BR @! 0! 0ЍH-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H--xMw@PP` /p@ ϊ@ϊ4$@p@E  ϊ ϊ,⏊`ռR$2P 㤭@|xЍp@-0M`@8PP Pcy 0" @`P 1/$ 0 x`   06/U U # @/" @v0"@ 0ЍpH-0MPUJ@$p0 x` 0  6/"@ P x炟 xP@!0Ѝ0H-P @!@ BP t@ ;P# , @ 4P- "@ -P. "@ ŎP0}#"@ ỎPP @ "@ ᯎPP 4!00B"@ ណP 0P  "@0ᒎP0O-M-MM,pZJS/@PX㐏/P@/@P ǜPbr ]T/P@/@P 㷜PX㴿/P@/@P H㩜Pr]/P@P  㛜P/@hr/@8oM/`@t/0P/ @@XOΠ/@@Hppp PPX        // @0 0`00p0 p x` // @P  /@PP0PonppK/@, ϊ,⏊ ϊ `G R @4@0@pvp' @p: JrvP/@$P @/@P |Q_ZPPPލڍЍO-M-M@`/`@Q|@/@T  P$P |Q1/$Q}P}QAT"@$ /@Pu POp/@@o  !Qb  i( RU  80 0S N(a.0" @e@/@PU  NP QU}QU-pP!/P@.}ϊ( )<,T> "O>@/@P a/bǗbQY [ @`/`@P }AQ  Q  Qa/@TY@T  @/@X Pp k0` )!a `R `00@ 0 8儁Xs$Pl  @ P`8 U5*L0 3/P+ &P# _[%  kQ$!   8 @ V P `0$`1/``$PPV, @P P L03/P P _[  kQ  @ 8 @  PU:@|  Z/@P X| /@h0pxtlh 8P/@| \XT0@T d@`@ /@P | /@@0H/@4,PD@0, L@<@8@/@P t/@| (0$ y|!0"$ @00  @ /@00QARQݍЍ!/@Q/Ѵ!/O-Maa8@PbbTccDdd ef}Q|Q0" "@ߍOPxpW  R/ 07/P- L03/xPP~R 0_z `0!p@; $p" "@P;  LP"@IP LP`Ip,"@@h!P RP,1U A Q< M<0UP @P 0IP4!!<" @L@D$ L0/3/P0T" P  I"@ƿ `BCP pP PIPHRHQP /!I" @ 0@@pRo"@P  ; ;P8p@T 0x 0SU #_R7!" @R/"IPI`D+0" @ 0_z@ 0;!p@ $p"@ ` @lRo$ + "@L` "` I  cQ~~`48ٕ00PS `_ " @ 0$ R FU Ro!@ p; l;  !@ g;$ 0 _z@ 0;!p@ $prR/"@0R%@~ !@I@@-~I  I ߍ/@/O-MMp@/@`@/@T! P|P $P 1/P $ R  0P1/P 1/P|QAT p/@$`P _4C/P@~`@ P ! " @0  @ P  "@ "@ 0"@ pPQ+ XQ(0 oPPTq P0xp `` `7//@ PT0 0xp0P_H0/P@ `7/@ ®,! Y"@㺮pPPQXQ( 0 5PPTq 0xP `` `5//@ PT0 0xP0H0 `5/@ ኮ/@,p! W~  0 $"@x"@t&!@pL B_4/P@)"@ 0P  >"@0PS "@ P f "@ P `NZ/@P_ D`/p@"@D@uP <  0P@ P؈P P$PH`YV( 4@0xP  5/ 8 B$0xP0 05/"@0<  媈P!@Y L P/@P x "@ /@P O@p/@㐟 HP`  P[  0x BQP !#RN0`(@@`30Q  P"@d"@ ]P3 3"@" e9" _98`@T0`4@ !(0S (#" @cC"L9 !,0S /#" @UC">9 !Cn00S 6#" @F"/90 3="@0P0(`Cpp  RS#0,0y0," @Pn0"9Z#y0" @\Pn0 "88$ 0@" @(P @0"8a#y0" @lPn0"8?P #" @0 "80@?P 4%" @0C"84@CP0S h#" @"8T0St#" @"8X0S {#" @"8`0S #" @"u8d0S#" @~"g8h0S #" @p"Y8#" @c"L80吟  "@01,00pWx`!Sp (@0`` @ p HV0`   08Sa`a0` R(@  R   Qx /@P TC~30/@@,QP @(@/@`VG $ Q@  L0 3/P @HXP$ Z:* ᔧ > P/P >/T/@ @ >  P{0P ,0` >@,>TaV{_ 0T4/@P,PY 0`x A>a. " @0@ c1 @P !@ AP "@0 l(@T/@P,00448!0b, "@RTo /`@ "@BP (@T/@(@@TC@Q 1 1Q Io00FF"@ $PQ L K/@/@@P ?PP"L P/@P A "@p (@4 "@*LL/@@P 4 "@!PP W "@ߍۍP@-@y /@PP"@ @؅p@-MP' @$PP# 0PP `HP L0 5/PP !/@$QH`R UPPЍpH-8MP8PFP @ AT A4 @06 P2 $q$Q vP `P``V Q  ϭP H  J P  Y </@|8Ѝo {4 "@" @0@m3IG-Mp8Q P `Y A A4 @P bP $A1/Q  01/P P1/P$QPH1/P򘀍@ @ W A A* #@ 803/P<0S  3/ !`0````X@ 3/Pm d 0 H3/pc h L03/Q5 @᫬  p㬸 PA @` L03/P |Qxp `V:W$:P" @`p L03/P  |Q h l0"#v` pW:v```  [/@|Ѝo {4 "@" @0@mQHa {4 "@" @0@HHp@-@`QP <(PpP^ /@p  @D 5T pp@הO-$M\+@p@`"@/@\ 0 PU PPU 0P 0`EPU EP Q` V$ЍO[`$ЍH-M"`A+/ @P8@Q`V P nRxpP qL /@/@`P  "@@PPq܁܁<܂(Yhat*/@ @P8$('@ @0@ PX+/@P @\;P@)@ P @0@9:80 /@ 0@0?P @ (- @0@ $4 /@ 0@0\3 x  @ !  @0@/0y / @00 8' 89 p@p@ @0@PЍO-MP@  `p2f1 8 00  Q7` RQ`V, P&$pW Q 0"  Sp @PF'@au"@8  `@Ѝ uK-MQR@HЅl̆rw` 04"@ 3p"@PPP XP 30 3,p! WPw` 4"@ 3p"@PPPXP  30 3,p! W !@܍P(w$0 "P"w 0Pw 0Pw 0 Pw 0 P w 0 Pw 0"@܍KK-HMD `(@@PDPp] 0  0(@ 0(k QL b@$DXdp|P/@Pf7 /@ fP/D fDPP$U'Pだ"b@ !n@b@PPb @0&p*! @AP 0p jyi\PWHЍO-4M@Q> `PpPP TL0 3/P X o 0P 0r000"P,`! VU $@Q:P P+E⚠+,t/ @/ @PJ4ЍH-P 0  0$ ALFG-(M/@-p`W O p#@@P v9PpGP wppV(x@@v0 @v`QP */ @ 0qA  @p@`@u`Qu g"@0XP  Qu(0 ! @qp@> P P$1* ! @ap@. P P(1* ! @Qp@ P P,1* ! @Ap@ P P01* ! @1p@u0  g"@(ЍK-MP P@tXp P  0 ```7x /P @ 27 " @09@/QPPePo_PP[0/@,!< "0PMPoGPPC o > PP: P7!Io PP0 P-"Jo PP& P##Ko PP Pn0p*! @P 0p wZPWPPލ@-@Q 8P p t8/@/ @PUX @-@CE4 `I @ 48<PG-M]P`t `1VLȐ(Dp@p\`@"P@P  1 18p@T@.&/@yt 0#(0S*! @@#,0S*! @ @1 00S " @@2Tt0 "@܍K-JME P(@@p] 0  0(@ 0zhQ  o(@琒ܒH/dP+P)P 3 0Pv5b,@6b0@0)p*! @P 0p vYPWPPJߍO-4M`p8` P`f`AP $$ L0 3/P`8@ V V 4Ѝ@-@P$ 0 @\ @4( , C뵤EQ"d b"@@سA-BM@]P`s X0 V$Phȕ ,X@s 0p9@zs "@ w:@os`0g;@is`4a@cs8P`7P][sP"@ 0XX0S% ! @@=8 @Fs`d>>@@s \0"@/`0S  " @@?h0S* ! @@Al0S* ! @@B p0S% ! @@Cs 0 "@ @st`Qs0"@ BߍK-MP Pe@oXp眗Pht(P EP0/@,!< F0>0Po084Po42P8 PG 0u%dPodIb\pJb`pKbhpolp0*! @@P 0  iuhXPWލpP PptPotPP P@-@ Q&6Q p@-@` `Pt` F`B@p_EQ"d b"@p@育p@-@MP@ /@P JDP R ,@! pk/`@P  TX0.P @ЍpG-Ml /@@?X0,@gP pW pW (pArr` rePq @ ,0R]0U 0 00  "fp pahflPJP`,吁!(Q !C A ,R㐁   ލO-0H-00PQ%S?o2P 82 #0@0P A A A@ eT00*eP*A, E00 ,000P S:A-0p`PWQpW P:PW L/@@PmnV:@P0H-0M@ 8PP*{" P  0    0GPPP0Ѝ0H-0$^(0 !1 BR*o 0 ?oRQ \Q A ?oR  0AQQ QH-M@00oQSrPW;$0S7( Ta p 4 0CoQr `CS0pFP@`瀩D  P @Xn +PЍTP#%0H-0o^B Q0 A00OoSB P@P0T@$PU(P !QR@@0^0@ Q0A  @ S0@-0o\Q^$@T ( !PD` *@Ao\ DT@0/oPQ"R/DQ@@/A/oP" 0AQO-wMM0P@pXQ  ؀ X R:RX &RZDQQa &AoZ P((P@堐@8$ `0=q!P" # @A M*p H*$8$Q $ D@T  9*8P $$  $ " @0 P( p;pPJy( L@rp@ q( *P@Z( Z ZpiDP_ ? E ((0@\p```@\PppP% @(0J 0P9 /" @A 0P5 #" @8>>Pq|d`L $rp[ PY(  P * =P$I $ rp? )$" @%0 @pwߍۍY( @$% 0@T T@9P@Bo= v)@{H Or [:$庈y( LCrPH p.$4"@" @"0@;.$4"@" @"0@;@-0M@    @ @00( P, 0ЍG-P0@pP ` Q ` `` V R:RJVH    P PP8# 0 0)"  p"0' P  1  04pP Ѐ "XspXD/@O-lM([ 0p  X  0p`P+ 8P+*`0 d40 P  ±㴅P% (p80$0 JP   C"  R$p0 "[ p[ zk[p."@ᾇplЍP P0H-@ PU  Po0H- 0pS8 0P@Q U `PQ V*`UU U P R"@0s40pP "c  0p@ "O-GMM@8 P;4PPP/J4 D`pp( vo0P# P 0ypp PpW pW` uWPPPDP 4` V u"p@#~vP U`04X 8008,D$( 0`8p P#"@Zv؀Xr8P; PPa 0 #",  #"T(8P  "@*vPDD$ 7P "@ vP6x@pW W  H @dP& X  !@[P "@uP 8 R 8"@㤪808 "@uP PNDR0`V> X 9!@"@P3 DP  8‪880p W P pA8 P"@pi8"@ pu @  `,`V 0  ePGߍۍO-_MMP /@P kP"@ ~u@P _ߍۍ /@}'Z`" @0t@PH㼃P IDh @@(P咖p㎖Pd `T 0,@$i<YO8`@p4PpHL\Pe`8PH P [ [) [TP+T 㫗`0\ 㢗P \&eXePP "@ &  &PX  ㈗P d! 0  }" `T`p  ePm  @tP { @ mP ^ @ fP \P @Pd\ @ $ H48@W$,L 0 HPp=eP #@ X\:HPL7 Y0 PD` T0%T `PP0XԐ4\<8 P 5T P  Q <p< @㔕Pd"HLPp <@84,0DP<h 48@<80p@̈́0`v?(E_/`;DI W/ ,0`0 R 4P @  PPPQ088P`8pZ0W PᱬP0ᇄ@y,0|d[/`L 0pl nP<t~Ppql0 [/ `m`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R $`xp W:; flD@+.D'W7"@" @"0@7.D'b7"@" @"0@v7K-0MP* =`P! H܁P @@ #@T`PpXY80!!!1PppW@ ``8 p<0$ 0Ѝ.'3"@" @"0@=7/ /H-0`@V PpD4P 4P `pV@p@-P 0P@U  ˴`彃VP布p@赃.'7"@" @"0@6@- @"@s@A- l/@/`@p@W P喃唃 @PU# 0 4 `X `8T 0`8@D` `X`@0`4p`ZpP@p`Zp P0p8`Ѐ`P` p`ZpP[ 4e  PpPppWPS ЍO-EM8aV) - @Q_D #@p@"P@ P  ! `!pV 0"@{poEߍA-M &" @oP- @㛑|  #@oP @㏑P 0@Yy`P@ p@]P  0 xPB̀@ЍK-MP`@S  "@1PL "@1PL "@1PT #"@1P6 +"@}1P6 1"@w1P< 8"@q1P4G @P. GD p` @#@P U P @[1P@@PP `P 0@( 8@ iЍD` ЍK !('P )P'P O-LM4p sP㴐`8  000<0尔,`dDEF$$c <@#`@ P ;P 'Z48 p+lP$c <@p#`@P #P p'W48 pFGI0H ! @Jp4800 p,pK`$` LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00E @ @ p` P 0 QQ1"2(p$c p#`@@0P p'W d I(. 0rp 0O-lMP# $ ,p#@ @P0  @ ` @ @` ``  :/p'WlЍ0H-MP/@0!4811"@c  0PJ 1 "@d  0H@T 0 4/᜿Ѝ0O- M/@ .0LQHA04q8a.TU @ QW X ?V p ?`\p`  0 ЍO/ ЍO-\M RZ ,dz @!p@0P  P0fH`@>PJ P!@@0P m P0fHp@P@/@P HL0Pd!0 PU@P?$. 0!. 0$%PX@! `5/p`\Ѝ@-L/@@P 0H-\@/P@Q Q0T/@ D 0"QP!@ RUR00H-@P *p- 02 $ #@H) }({4 "@" @0@10H- P/@@P T/@ T TEU P *< #@0T T00|00H-MP /@@P  ׁPPT y bP // @QQ Ѝ0QЍ0H /@Q/^ /0, @ S :H-M /0 @ ЍH /H-M p/0 @ Ѝ 0 @ 0H-0MB"0T00    000#P0Ѝ0H-M0 P   @ 0 ЍH-M00   @$P ЍH-M0 !  @ 0 ЍH-M !  @ 0 ЍO-WMMXP, @0`p @P !$0 @ P$`VWߍۍ刵P AP*[S /" @xQ@[q #" @p0P QH㈠ 娰X\`@dPp1 $" @0@0ӿ @;@@PJy LPfpYew  $`刵P}(8"@" @"0@e0  &(`(P@ L03/P X( \,0"# #" 0@ T:$`$" @ 0|@o0 0xp 7/@`p@-M4  ?0PBT T TT bRPU 0 Q T TT @0  < PCЍpO-R R@>  pTЍO-tM8^Pc 4/@0@ SD0AQ0R^"@L0` p@SY PPTTT  rp 0`:T 0W_0/P@,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^vtЍQ @ P`P ` `P`  T.^Y:^ q110`2plppS 0 pl  40p0 PJlPU4PU8<`Y,P  Q Y  0Q0p 8/@< @0RD AQ 0pS 0/@@ SD0AQ0R  /@@RD @P QbB`0Dp  W T `V@`8@<`@D 40 P8PP! "A8 PQ o PQ yP d5 0@ `p0p @Q Q< `V@ & @0D (  T, @% @0DP$00(PP0Q01Q U, $0Y"  PP (PP^ P $040wP 00U* /O "U@@% P *$ (0ER@P@D"840 P"0 P`V PV ygB0Pn(0Q  0U @P$ (0 `,0 V R8<V@D408 PPU PU x Y P W vPY U r@@"800P`V PV x 0 0 D0pP T" PpPP PH` R V R RR Q p`@VP 0S`@OPexPU`x4 RD/@})9"@" @"0@+A-8R4`U @Cx@T>xRP2" @ @ @ @*A-(Mp@`P  B0 H@$& @`!PP  "0P 0`08Q 4PU* pRUUO`n`Vn4WRU PP  4 W @@P"@O`n`VnO-M@㾁p_`EfPP V QPکP"0@XKQ RY  "(  `FpvPP P[Ѝ @- P0r0222R0+080@ R  @ Q" }W+s;"@" @"0@!p@-O@@T  @P`QP?@A@p@P`QP?@A@ @ 0$b #b QpO-KM`PῩ /@Г Kp /@"@@/p@ ?pPePfP lP zP<bP eP "@ 0㴁# / @ @ 0妁 px (@pW@T  Upʜ!@ $> ZC XAT? F"@ 0 @P"@  W P)   P% # / @`p@ rPI `$ \# / @kp"@pgm@Z2 I`Vp"@p"@P(EV BV$tU(rU) ) "@ @0CP "@$ -V$_U(]U 0/@p # (@SX/ @c S/`@fpF/@@PhDVp /@P CgP."@upIUpʍ"@kLpD"@c$ZAU$U(UL Y"@NU @!  Tp@P# P( Tp!Q P 0@T !P tk"@my"@(T^OY a` P$Q00P0Q0v 1!P V V > )!wlP @-Mk!@0 !@p (@"@ H-  !U HrT@-E (@@pT /@P){@o O-M-RMc s  p/`@/p@/@T /P@U e J ~U 1$AS(aP@V /@ @@@U* k@ Jc /`@P\ y Y5 Pp@4@0@ 8@ ` ETP. A@0@@  PP.p@ @ @ 4@ 4@08@ ` @ ETP" mP s /p@0S (! @F /@`PV;1 A ᠋!0 A 8"k ! @  _ dUdP0%` /@Q-pAP *pG WEt' `# @ ?"! @P!@2?G k @`TP@p:0 6@ uP[p!E:R :Wp\ I"#@k! @ P @խP /@(A 1$q@DS + -T=IB PpJ 1 A /@㡋0 P @g0 A 0 Q*P @ :0 %Pkp!% :S0:  @` &ed\8 a "%#0@V"1! @!e 0僭 P/@ R5 /@pX(@% R!:Zx"e! @ Y@ /@ R`0 A@1F@ p zWk"e! @FPY)e @>P /@ P RRߍЍc PaI*,e" @#vP"! @?evQP%.ra(/Ob"(r0r 27"cA"! @qeP.AH-0M0P  B ,aPC0Ѝ@-n@j@H- M  ` AS ЍG-RS PPL7Q `1p@"@: `T 0ᵬ@`P: A-M`@P@1  P@(p@P P:PUPP#-P  U   TP V  `@P@ЍH-`@QPp  pQPQU7Pp@-P @Qp  `Q@Qpp@-M@ Sp D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM "@bpQЍۍp/H-M`P@R   `PxR pT1Ѝ0H-@  KQP  PU P R iiP  R hhPU0HhO-MMRR @P T k p`P H`Vp@U,  0p  "@[P #P,T P$ P U p PFP@ R@+ "@  "@7 "@"@8Ѝۍlp@-@$`PbP 0" 000` Pppp@-M>P`@+p& \3 0@@p7 "@"@ 1p l3 0@@p7 "@"@ЍpO-lM `KPo2p, @ p Q mQp Pp hP Qh" Pp SQp [ 1 4 :P tQ lЍ - 0 z0 v0H-@P q PPpPPq qP1p000H-P@@3Qp@P@0p@-pM`0 @p PX Op @OpЍpK-Mp@` Pp% j !@"@Tw-"@" @T X  !@W! @W T @ -" @h0ЍG-MMQځ7QPp@ ` VPZp` ?OЍۍH-MR @P`P pW  R: QpP D5dpP.pP  QQ*HeP  P  p0    7 0@Pp@8ffЍA-MM@PK "@"@ P3`   Np, P ` `P7 0@ @p7 "@"@<l #NP p "@- P 9P "@"@V _Ѝۍp@-xMP`@S K g"@"@ j  Np3  `Np'  Np!  Np  |Np  P !7 0@ p7 g"@"@g "@hNg "@xЍpp@- % P  @ DZj$$ TPV  Qp$P%Q%pH-8q%@Up  D1HHЍA-@`@6p@$   '1?  6  rD Q 0>P :&yP l P P ?U e0A-(MpP@#`6HP$pP< V} P "@"@U LP pPM` 6pP P P a"@D PR DH!~ !@,(ЍAa P? P<PP@Pl6P  "@IL'"@(ЍA,l "@}"@,"@YDP $P  xpFP "@U(ЍA (ЍAc@-M@pM0$1p   "@r "@ЍH-MP@@plP? + 0 - +;P  0 ` "@FxP @P RP 0 0 R I"@f P}TP ,IЍ "@ЍH@-M@pP Q G pP t 0^A"@Ѝ@-M@ P ЍHD  P Ѝ@#@-@:t"@+LP PN@HP%}P! @"@@+p@-@`HPp ʴ@P$  P: @!$@P p|"@A kp|"@p@K-M@q ' ` 0 p5P5 PP4 p x P7 @ P - "@A> > >$Q$I **o ExP @ P  "@) "@YPM L"@gLp8pB@ Q   x@ Rpx C "@DH!@@ *@pV m PBQ   Pb x!pЍH-P@` "@pp@ @BU"@P* 0P P:H O-MM`0 Kp Wf"@"@z"@ӽ@PbA+EJ` p!@Y"@v;7P 7 PP@ `Y "@\!`1 2PP PxP `@P  T`V+ @P xP <0@x` xQ@ DH!<0@ `2 `VaxPx  x f"@IЍۍ@-@ xPHH R$ @@-@!@BA-@Mp@PR `P V :7   @"@@ЍAP"R P  "@0r>pWU% * P P `*<0 ! p "@ <0 2"@X>P * @ЍH-M@`8!QQ Q.Q@ Q PnЍH Qg , Ipa O"@"@ЍHQ, Q< Qe` "@"@" @q0 QJ QW` "@"@" @c@p;"@ЍH`w "@"@" @S 0P`""@"@" @H8D!\H1Bg`pw "@"@" @6 P0 t /p@P  o Ѝ` "@"@" @x@T _@"@ЍHIp@-M@ 0zPЍpD1`H r8!@ 0P0@0@00@P 080 P  090 00  Ѝp@O- MxpWC 0@ [ P ` P8P PY P [ U* PP" @`"@(  L 0=@ U    =QpW ЍK-xPsH"@  8 53,"@} p"@3 P"@l Q :!8!0@" @+00冟0 @@R@) 8N p@Z "@#@Ÿ"@C @@D W 0:*  @  @"@Ep "@!@B Pc Yx <>#@0@ 8``oro{pW `T` 8LpP :"@ DP P8E 0 x (@qR/ ,p@T,  `P("@*!@! @0pP P!@!8" @+`@a"@ !@ p "@ !@ p`P` @ @,@82p "@!@ 84 P Q R000  \87P \$\8P\, J  (@P [P@1"@R @dp x[p (@X[@ߍ, Cp  "@!@_ ,px (@R/,pP/p,: @O"@ 8p ;Pr"@  0p 20@ p ,2,0@ pp"@Dz"@ATT 4"@8 @`P  "@!@ @Q P* ~` P .z"@Dp nP  ""@!@" @"@Dp ]P  ""@!@" @8KP p* 8 "@!@."@  @83P  }!@"@$0S p eP p>  @8 "@@,`Rx (@p 8|p `E- "@$(dCd=8 0@ "p7  "@!@mCp ,P p @,@.P"@v($ Ad!Bd=8 0@ p7  "@!@F Pt"@Oppx (@"@ #3!@" @ "0@ `0 "@A8pp^ +&p"@?0@ pp7  "@!@ !1R84 P= @PR P P"@"@@!Tp,@W  0S+ QP-"@8_G"@"@E"@"@"@C["@e!pW @ P  @@pW!8P4` p4p@8"`V p P qbPp`V@* !0 S `V0@ @00@ W!63 R  =0@P*n"@88 @T UP@ P  0@@T` _p,@pj"@R3C0H-@i"@Ap PBp"@0HA i@"@0H@-M@1p ttdP :"@Ѝ@p=0@d @Ѝ0H-M@K  '"@"@, `AP p'"@<,,jA,Ѝ0RP'"@"@06'"@"@Ѝ0H<PЍ0HUv"@^@-@Q K  "@"@-p7P  P@VP"@@O-M@PP`Р,(p @R ` `0 P    !  "@D"@8 P P @ P@Ѝ0H-@LP PPXLPLPXPTP PXXTPTXXXdP PhXdPdh~XhRU P & ,PPRlXlRU0pP  p,PPplRZXl0@-@"@@@-M@Q K  "@"@b Q@p PQ 20@ @ppЍ7 "@"@Ѝ@= "@Ѝ@p@-M@Q K  "@"@] @p" `PPJ|X7RP| 3 !0@ @1pЍp7 "@"@Ѝp@y7` `"@sЍp@p@-M@Q K  "@"@r_? B?PP p "@U@Ѝp@j!Q| A0S|ph (`@XPP `P@` XX  P Λ20@ @p Ѝp7 "@"@Ѝp@p@-@>P PR yz `L0p`> *>@pH-M@pP tqe*P" @n(P pPpV_ P !@"@wQP  "@C *"@" @U9 >pQ; `l!R pP 0P0  "@.!(pv "@"@lP >P p *P> u>)VptqЍ  "@lx`V >P`lP J "@\>P p *`> J>p@#  "@F/K-PH S` X ;-;"@" @"0@R qp@ ,PU Q P P Q   PPP  U Pp@ `崑U ;-;"@" @"0@G H-P q R 0S t q  U B +;"@" @"0@ A-@_0ϑ@`\```3puVp 0H| p CSRH-M\J C\(  0ЍG-PM PUS @ CSV*$`(pW P P p0pW P 4 PpPP# SP( `P Q   Q,p,ppp, O,;"@" @"0@ O,c<"@" @"0@ O,t<"@" @"0@H-M0Ѝ@-M@bA̎.à.b@@ 0{Ѝp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p  ,;"@" @"0@H-P PT  $,;"@" @"0@)H-PT /,;"@" @"0@//H-P8 ;,;"@" @"0@qG-(M@ #@ `T+ @+8 <PpQ G `P8@?P: <"1`V: <Pp <PP A p `8  p <pW:P(Ѝ ";"@" @"0@Y"$ /@ R/ 00( /@/0H-XR@P P>p @P0@4(@, @@@T0 Mp@- MPO `@V P`q QPpQ   p <@yTHvTU HLP Q   gT Q ,  ^T(PQ 4  ST0PV Ѝp@ Ѝ/@-@@CTO-MP @TP$ ( /@P/@P @ @R D2/(`V P P J `P  Qp   `UVPP/ pLP*H oP% HLpH R 0s qpp 0P   0Q0000P0  Q UP H0aP*y7P3 8pW/ `VPTPP P  `F  Q 2/V pWP,1/4P`4`TP\ PЍ` $;"@" @"0@G-M < @O P/p@P@@@30r`T`0@ 0N j kCs T0  0(PU @F`pPp*` ` p@W*P p@ pG PU h LЍMH-M  0 ЍHЍ/G-AM$u `(p@@Pp `< 0៕p$ ; VV@ V p (@㰀 @ D倗 X   [AލMH-M  0 ЍHЍ/G-M@P` p 0]Z0 @ pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ/$ (@/$ p(@/VZA-MM P$Q:`p @ PPP K $e (`@ !@`Ѝۍ$ (@/$ @(@'Zp@-POp $e (@(`@ ;@ ` ` ZU V@pZP/@-@07D@Q0H-@(#Pp ! @;p ! 9;PpP02;@-@q ^9p 9@P#J;A-M P`@p  ^㐀H 6;Pp !vw? PP 0!;pPЍ$ /H r /Q@ !/p@-XM>PU U7V*T @`@Q T TPUA @@P> <0@  "@> "P> *@XЍp@-@T C@A-M`V @P P  TP Q  R0 p C`VЍ 9Q/K@-@TB@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB 20^0R030O-aM0@p`FP  @KPr po UZn  NRRp$P  PP bP ZT@T vP @U @lP @U@Tu  T@P(Y PX 穣P TP UT\X @` 瘣P \@T\X,LP P 烣P L[LD, o U( Q [P"P "@ R$PR$PPLPI (MP @` , X$- 0 @  pp  @0 DL9pA@ 0@S0,CP !6SR S2 @,WP3RdA(ThQP P@T!P( "@$P,SʇCP%:S!S SX(P "@ X (@ T"@`T@, ฒ*> @RX p "D !pDL}D d! 00H 6 "@ b "@ @OOaߍ"@ A- MP`PU` Ѝ@ P P P*:P `  p8W *p`8  P  (@ !00:P PPA`p ``X0Q` iP.P  ` ``EQ4H-@MP @P`R ~p `V pT P P `V`@Ѝ xQ/$ /0H-M P@  @~L 08pЍ0H- M@0 P:`V 0 PpPP `P`V R: R #0xP Q j Ѝ6p@-@ IN PP ` `,PV:P:N(`$PP` ` (`,PV:$P)N$(pO-G- X @p`#P@P `lV?*"@ QZ 0  G+ @GuQ/K-PBxP Q @K@QKP Q @K@QKx@P@TF ] KKK,(VP K,,PP,(VK40VP =4,PP40VK<8VP /<,PP<8VuKD@VP !D,PPD@VgK eK KbK` P T PT@PH-@ D0\  %Dq@ ": 90+Q+\!Q 0\ RHrO0 O-MS px PQ`(@@  @0 N#@}!~@" @"@ 0 `p 0/@ P @@0Up  @ `p` ЍO-4M@1CpPq`P ` \0X笪ĪЪ(4Ĭ $,$d$$$,Яܯ$$<t$HԲ$@Գ$lX$p| 0P|tȸԸ $0<<HTdpȻԻ,||\ "@\ "@;"@O \y , pP @@,P PBDP !" @0@ᕌC IU \  "@ PP "@P !  @P P p HPW pt\z  @ @P  "@P "@Pg "@PX "@jg\[ @ 0pS "@VS PM\ ?xX\pR B 0p P0 0 P P  0 PO *"@\ ?GX0\vR B 0 P 0 \ = P2 Q*  p Q Q[QX,0 @ pP/P< 0@凰P <, @!0 <,0 @ pP/~P4 08jP 4, 8!0 4 \L XU X\>   (@P PH 0` pp PP BP  0QpPH q\ C  \e 8@ 0P p|o"@"@*;\W @ 0pON "@\ @Pr Pღ@fk8\  "@ @KPm 0p [0QP "@\ 0!   @ 0 R: "@\ ?1X\vR B 0 PP 0 Pp  @pP@ \P  \e 0p @ J[0 R "@O4 0!A !P p "@\@ , @YP PpP W   4$0 0 0-@,0Pd ;"@Y\ 4R R 04S 6R 6R R 0 R R RC\ 0p @ Z0 Rr o"@"\ hPS :Pb\` ,@Pp``VP" P PPF PD HȮP( DV, !DHP<  P PP4`\ L @>G@PL(o"@\ ? X&p\6` @@pP ;P3"@23   P@  ;  \Q  \F :t q"@\XlhPS y\) P ($z\ tgqxx"  \ Pc>P h\ R~{x\ ?tX\vpR B 0 P 0 P 0 0 PN *"@Gdf\ ZP$PPUPO P P0Ep ` Y0P z"@PUP P PE : `P@ p0p! pp p_Y0Q, "@\Y @ 0*p 4@\@ 0p @ %Y0 R "@*\* 0p @ Y0 R "@\ 0p @ X0 R "@BE7 "@=?Q  Q QQ"@/2PQw Q Q@@@Qp  Q QQh=P p0    @ X0 RI  0PhPC @ P  ;1!"@^4O-4*4 40@ 4!="@o"@ / P@P /P@ T /pP pP"@J"@hpP"@P"@.P"@ Pp D!@`LP "@L`P @"@LP  @LP @LPY ``"@LP "@LP   @LP "@LPl  @{L@P* "@tLP "@nL `P "@gLP "@aLP "@[LP "@ULP "@OLP  @ILP "@CLP "@=LP  !@7LP "@1L `AP@@@ "@(LP "@"LP D"@LP "@LP "@LP Q @ LP "@UQ  Q QJQUQ"@1p@ p4ao"@$"@UQ"@@@g "@Q"@*"@JUP,"@  @0p 4@"@ 㞡PL "@ 㗡PV "@ 㐡Ps "@ ㉡PL "@ ァPE "@ {P> "@ tP7 >"@ mP G "@ @ePm Q"@ ^Pf e"@ WP Bo" ZG PpP,Z #Z p5P?UP"@p4Ѝ3D,4tZP{W:c7Z  pPp Q QQM $pWPO P PGQ  Q QQ@P Q QQ@ "@ PP "@P !@P !c!cT` "@P "@Pq`lB  P@P4@ 0'Ap P 4;!@Q Q Q`$P P PPI<Pi"@~PP P PvP:Q~ Q QhL45,0@ 5 0@ 50@@4ko"@gEQy Q QjE@,0 p$ ( Pp GP ,p\ 0Y 8(V  @P B  P= G@PpUpTpBEPH P PfEcE<Z 0D p  eU0,Q V "@jZ3 , ~pp DP 0pP0 8, P B  ;P P PlE Cj$"@yB "@]Z /EP @ @P@NP @ @G@ h QPT 0` `` `T0(Q r"@jT D"@4P F4@@({H`Dw@@E@@E@@K LGGLLF `V@  P*"@` P @@ G"@ C@ Wb"@U ` `Q  Q Q Q`}"@`@Q Q Q@ @IP (`PB`$P  PQ 0 S0S  ,PQRU, ,PpP P% @o"@@ W@ ` `@ ]d`0J\pP @ PPPO- MP`pe@"Py"PP p U [VQ UP X` *`VU\P @mPsPnP: rPXUZ VUPUPS 0P/ bPIUK GtP? xPA (@ p 0pp  @0  P5 U 3  {c.U!   0RP P  acU P U U P X: PpPPU [#7 ЍO-MP`P" =@qP" U``V? P @ NPL  A ЍV"@ЍObbV"@"@ k<p=@@W ᏝP `VP ᵝP p? qLp I=P      V"@ЍO?H-MRP`@PUT' ``:/P p   Q x"@pU bP W /G`T 2-PT`U C-"@`ЍG-M`P8P" G @BP! G @*P p ፦P @ q BPPP"@ "@"@?>ЍK-@M P`@P  A p A A A GP t t ;@ЍG-`p V`1@PGP X FG9Z : J 0Qp00@T*H Q3/K-T`V0 TpW5 @HH Q Pbqp ||PPPP DDPQPQP3PPPPY&6"@" @"0@&6"@" @"0@@- @c#@ g#@@@-@P@H-Q# P" gPP' @ mP` fTpPW`9P %n6"@" @"0@3g%5"@" @"0@5^H-P TP gHH=P&7"@" @"0@G0H-P0@ P"P T 0H0@-P @c g@ &n6"@" @"0@[$0H- @P0PP= PP00H-P g_ P @87@P 0"@3@&n6"@" @"0@[H-P QT &6"@" @"0@ &7"@" @"0@@-P @PT@)&6"@" @"0@@-@#P Sw@H-T R H0&=6"@" @"0@H-P @ c_uP` npTP#W`p@- MQ @T R$ R* PcoP Pz& `" @ 0 ЍpX&7"@" @"0@QX&=6"@" @"0@HX&b6"@" @"0@?O-MPQ pQW H< @ 8P<  X`TWt"P@P PMP IP V! M"@ !!V "@t 7!@"0@0V ~"@ ."@H0"@b 0"@ Ѝ&7"@" @"0@ &7"@" @"0@ O-4M@ P$#@o #`@p P "@"@$8`aB+P $ |bP ̠$`@  pT Q  P P T8p"@PP9PPP [ZTc|X P|TTQ88uP4  P P P ~P "@|QP TT R8 8APYP XX8PxxQpVP "@Qc_ P= Ȱ`@"@ p`PP+9PP'*  PT P   Ip P P "@oV P f@p"`@(P ~T pP$a^4ЍS0Q03Q/K-Q TPp Q @8P @Pr|"@"@W7W, | |TTQ|PttrP88mPP ` p1P- "@*`P# `tt TTQ88JPx@xQ! o᠒ pP "@`` pP @Y E"@G@x@x`'7"@" @"0@H-P Q/Y(g8"@" @"0@;H-P Q/r(g8"@" @"0@QH-P QQo/}(g8"@" @"0@}@-P @Q QoBi/(g8"@" @"0@@-P @Q Q@@oBL/(g8"@" @"0@yH- MP9 @PP 00Po Pa!PU ` eP &#/`PHt /p@P `P  A AXP` Ѝ(g8"@" @"0@2(8"@" @"0@')K-PP+@~A#`Tǁ `YiT dHd /`@QP/(8"@" @"0@n0H-P2 @Q8 PP QP P 0Q0QQ0/P@o1Q01 CR #P 0Hv@0 )9"@" @"0@ )9"@" @"0@iH-@PUpEa x@WgxUȀepp@-Q( PR. `@P P pQ  0p@s 0p@J0d( @{Pp(6"@" @"0@{R(9"@" @"0@_IH-P Q!. *)9?"@" @"0@7*)g8"@" @"0@w.0H-  5I#@P @"@@{Q0O-LMHwpP P0"xpP G.x #@PU xH #@@`@?P:!@PU #@PU H #@@`@?P:!@PUpw H 0!PwU PH LЍM0H-M  P0 |p @=p@@Ѝ0HЍ/G-R'@PU`  R R* R3 `PPPpV' P* 㠟P a ZpP = )9"@" @"0@pYE R  @T:q= )9"@" @"0@VH-Rp`@PWU H}5 %"@"0@p! @0P `p``P QH RU p`0H-P@p 0H|0H-@Q pPWP @Qi"`@ ~PPKPU:p (@XA-M@`PPP]  up+ p"@ XP( !R0  "@0 p PP ` 㾼p8P B@"@ "@'ЍA B @"@QU y"@"p@` !qPUЍ P PPQ4S M "@/Q $?0r "@d "@O-M`Q @U <yz^PP" P;@& @Q(* " @P "@p F "@}p Y M"@ tp W "@pP, t"@P$ !@P }"@P "@P  "@P "@P "@PY \"@ 3p  #@!i"@)p x;@ 0 PP 0S "@ p @ "@}p DP Ro`p @Y   Pz{ &+@" @  u"@pl H5$ "@!0@Q" @0Q "@p[ D "@pT L "@pM $ "@pF  "@p= LP pM0$p  "@p*  tP "@p ;@p #@bx`V& P qP   P`+ "@u+ "@r@ЍH`!@@fp D `R_"@hyp  P `  V ,!@" @Ryp T!@ Jyp  `P6;p "@qP8 W"@kP- t"@eP' !@_P!  "@YP }"@SP| "@M&+P" @ PPj Pf { @{ @ {$ & @"@"@pj  "@pc %P  "@pX +%P x`V %P`V "@p?  "@p6 PP 0S "@ #p! @ "@pn& "@{$  @A-R 0S <{P`@"p@ wp 0SH-@P@pP'  `P.P$ ]!@P !@P }"@ ㋒P HE .,P``P @H-pX @'Q(P@(`A p`pP @P` XXpX x`:`pP @P` XX X x "@Xw C"@Rw  @Lw  @Fw"#$% &@'( )*+ ,-./ 0 12 "@. "@+ "@( "@% "@" "@ "@ "@ "@ @ "@ !@ "@ "@ "@ "@ @v  "@v   "@v C!@v "@v`P@`XX X xXH L70@0S /A+ R 0S,0pQ l2 R Q,0 /H-QM`@Plp !2" @ D," @ "0@>v` *Q pPE E *Q:ǖ`G ,2"@" @"0@!vQލO-4M$\(P PᅑG 00 @6Px GD`0`, @@p@PPc - "@ 6P4"@ /P@U P PY *P.  F,P P @T,P(@$PT= P  |F,P P @T,P&Y# `P$PX  0X  0GD @@P6P 2 24Ѝ 20H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \0\0O-MSVP` @ Z7*@p` `V2 P@PF V :QE TCYP=@Z7@VC*^p [@ @@.@ Z:pWA @'*^`^@NY Z:`^ ^ N nVk"`Q V`FЍ]Z7WO-Mp@Q P@(@`X0y[ PkJQp a Q @YQ% \Y PJ \Y V; WW\pG6V0 WNJ8 0@pG)  `) P /Y YV W6  0pG)\` V W" pG`` (@@ U:@`V W  P P@7@ЍA-PpPW (@ e`0.Wp@0.W`!,W W% W Up\ 0 -W_W  >S0p P pkXp H"pH-M`P @P RpW"LP p-M0# R,8 "@" @W 0s2ЍO-,MP0@ \p P(P  0<"@"@Tp P P* `p P   0 pw,0" @ "@_  pG ,`Y:(PW $`    08/P(,`Y:( $0p8/P^ (P $`  R 6 Q S$ 0m(,`Y:$ ($0(pGp8/P-w "@)&p 0pm w,"@" @0,ЍO "@ W"@ w,0" @=0,ЍO-GMMPD@`p. ApKp\ !@ spR T  @spI =5pD W  @   *BQ+V42 0=p( P 5p"  bMP  !@n    @  0ppAK GߍۍqtWZ+ @!P@"@ p W N5p +-36 >@AD h  .0,AP  !@4sp P PH%  @&sp p.   sp p" p p  sp p  2/ 2/eY !@rp pW:] @s@P`TP0PPEuM 2 4pkPg@- @  Q?T  D08@Q Qp@-@ `P` P `,PV:(Pp$P`(`,PV:p 0 "2KA-M `P+p@ Pۍ@@P `)P @///p@-MP #@  (`P? @"3 p6 0`)`p "@"@(0@ `p "@"@ 0" p "@  `p( "@"@Ѝp0H-QU0@p a.x0H\.G-FM@>P+ pF`    P `yqH F?`> * F?@`Fߍ0H-@M@Q <#@P @ @oQ Q@Ѝ0H-Q  RRL`< -="@" @"0@@$ Ho/0H-@MP   Pp 0H-(MP P@ 0 B C ) L0p`P pT !W:7 6`(ЍH-MP@ pP @$` A` `R8(L ,p!  P(pPP` @ A 3L `p `P``ЍK-MP pP@ G `䰐 :L (P qЍA-M P`p@  @ЍO-OMMQ @TPP Z @@j8`tpTC@BLpHP(p@Lp P TpLpXP3pLpYT|  xHHPpt`(P 0T @x Cp 8LpbDT@x@ Y PⲀ @ @ @  G`  BFV@L ` 4FVL@ k Ⲁ @ @ @L  X @P@@ D$r pOߍۍ< -7"@" @"0@< -=6"@" @"0@< -b6"@" @"0@G-M"0`  ````p< P: &P6 `0 p) pPP-pxPבP"   'P\P  @ P pW:,`Ѝ+,`W`"@A-(M P @`Q Pp(Ѝ0'x Bp $pWtQ `  QG WP   RQ|@|  8@  Q' X70Qx x pPTPPx"@PT< -="@" @"0@H-@M`P@  Pp B B0 B G (T !4P$!T@H H@0@ЍA-p@|0Gx0"PWP`R*)P |bx `EpV r||@-M|@Q `#@ ` Ap | x2"_ЍG-vMM@p$!Pp U U``U`QQZ ARr*P(Q`Z~ $` z x=Pu   Em? pk SP$  RRRppuQ  RQ  RR^P0 ` @  @ @ F]!@L p4pd Q q AR:Q*wP$0`P$R p3 P " ( RWQ QP P% P  "P`vߍۍxP , RRLa pV`P` 1`RPRN % &5 TP P1P "@"@P$,E/F?00 Gp R^Q  L p 3 $H M-H-M 0Ѝp@- @0 Q*P`E`U``@ Tppp@-MQ @P P R xЍp@&PP%P @/PU ` 'x@ PUx@T@Ѝp`>P* ឤP @TQ/@-P@@@V@-P@@@VP/) # @ kO-M(p@@$@'Pa `@@`@"@ZPp pp"@  0k IpDpP =pPf D p/ Q(P% (`  lH p ) p  7/P$ p $.#P "@p (@ЍO-M` #@P    Q4:  0Qp@T WP pP ȣP   , 00  R:   q ЍH-Mg H Ѝ@- M^ @*@@ @@  0` Ѝ@-@ g(@d(@-@p  p ~BpH-M@P `#@p `P x *`#@*@ G gUH * # @\a b Ex* # @\a b+ G   +X!V/ލK- 8~P>#@`@"@"p@jQ™\ r@`"@T 0R ,0TQ jH™`,p V:T @n"`@ j8,P@TO-MRpЍ萧㒓@"@"@PU.* U S-p `p!W*P%W Q  %PPQ  0:kpp Q  1kp&-ppp"G-MMRp @0G`P P Pp  !@pPPЍۍ vPaQ !@jPp pG`!@W ,p LQ jpGp,@-M! @ R r@Ѝ @R S0 00}P Qp@DTD@O-,M`P h,Ѝ@ _ @  y0SP !@ow 0BPm p"@PP*P`JP=`p  Z8PP6@EP4 Z( Q( 7 j0$p t$ ( $8  AP`X@: ` P"P ` @v @yht Xt "@iT`W@ !0PN pJPHP `Q( # Pk ( Q   Q  Qt$ ( D$A8 > P`pW:0p!R Q 0p$t@P0 jP pP$($ |P P(  8  P`W:`O-M P@ᴀP"40$4P $Q``pW pWO O0 H "@Pp P"0P` $Q:` `O0 Y "@5p 0 k "@+p P"0P$P O0 } "@p O0  "@ `p 0lP p$`,, 0"@ `p 0,P $`!@@ @ "@ 0p @Q b@5,`@T:4wp@0@ R @`",`@T:pQ lbp,`ppW:  QH B`0 P1 ,@`V:8Q pW Q, P" UP @#( @p   0@}P(P:0P ("0@ B@ ("  0P" @势`p0P0 P"P @3("0@0  0@`,@V: ߍO-MQR @cPPSP VpЍcPl,@P`  p YZ*0S S6 Z `  X4S V R  @  S 0W  Q u"P X H00 ` Q p @ ^P  rW"z0H-@T P PPPPPP@P*"02S0@"PU 0S, 0 00H-PU0@L0@-@\Q\\X\@-@`qO` `H-M`# @p0 P0p p p" 0 p p 0) p PV @    p @ Ѝp@-M`@P5 0hh\P  R 070@@ P  /"@" @ "@ LM "@\' @Ѝp@p@-@`P`@ >P:&gTx RpRQ TQ   >P:  "@p@@-@$@ỽ@\' @yp@-`Vp@@PPp'  @0k$L "@+'L @p@TpK-MP@`p$ H`P " 0 `` 0  0@# /@0`Pa"@HvQ V "@ `%0`8PP PT:j  "@@ ` * H$L`(j0 "@ 6"@$L = "@Z"@H0:HPbP hO HO"@"@RSW"@HЍK$48[L i "@j @ `  4P 8P  "@@ ` *  @ ` PdQ Phz $)L00 $ "@P<PPoA"@H0p 4 p70@@i,?8 0@@b?0 0@@[4 U80 "@648@P! h`H@ P dh(P ЍKNЍi` "@ 0.p"@A"@LK00 $ "@)E"@A-MR @ ` 0Q0@ 0p 0S  R-  . 0P Q :  PN f 0P Q: P3 0a P 0P:V P 0P;K P  60P Q:Ѝ "2"@" @"0@_H- P@`"@08 @"@E' @0u@ L <  cu,( @`H`0H-@P@  F"@x"@i"@OhhL0HLH-MP@`p:!@P P P dp` 49 0@@p Ѝ]"@%ЍH 7 ]"@"@ЍHK-P`p @@P'   P%:G  zP  @  mPP!\1"@" @"0@  ^P  d#P  $0 \#  @K "@: "@HK "@Kp@-@`KPP c SF Q pKp\# @yQ0S/00@0 dQ Q/"@A-`@VP 0AVp!@1 P i 7P P<P $I g "@{ , 0P) P PPHPP hPdP   $ AO-YM`Đp@R L@P@QP1PP}LPB @P[ @W$" @)PS @W$" @&/" @/" @ #@ R 0S #@ R 0S T0@ "@ q T0"@kP`p (P Y "@ R?K "@8`h4P KKPP 8dP GQ* W8 (R8Q cR R SRcQ8h > B(P* M0`  Pp WWY8T04cSF @ $0,S D`VW W8d\ 8h``S 2 8$,00CS* "@38`51p0$0S D0SGo<QW-, @P:8  "@ `O*` @*A-n8 F ((!(R0`WW zDW 0`DPnW0 , @P:20 W 8`W4Q , AQ:30, @P:7 ` PT 00 $(`4` `4``P` 0`W`:Q $ `,`VK `$00, S:, AP;+  I ~, AQ*:8`6 <:0$lPD h&$0 S$0`Pv0U Q: P'a 4`0` 00 ` P 0400P0 W:Q ,$0Q 00l0$0, ^:$0 `4W ,@P:90p` DP 4Y ,APM  8`(P , AP8 `=( (W0`  4WDP , AP| <  0`P : 4 Z, @P^:P0`WP L 4 < CP Q ` Q6 , (P P@8t`P(P3 `8 A`, AR"QV 0`C!  ` 0`PW DPL+JP EK Kh(PP\ `pj p8`?P_ (` 8D  p PGE-w@ 8\P 0pFw0 "@V(P2@P' #: "@H 0dP $` / PPU`P "@(PX  0@tYߍ<`P}:"#DNP!$#DH! r \/ @( @<R8XTPLHND@<<TaDp "@dO{G, AP2 p @*4^, @P:0`]K-M`pP@ P P "@"@0ЍK;pG жW:@Q Q ЍqW:<Q:Pp R:pP P p pUP rE  "@P  0 `  a006ov 1P0 /r B @H-`P@R : P9E0"@ HpPd]@ 0Hp@- P`P @T PE0"@ p@"@p@Q \Qp0 p@0 p@O-M@p xPU& `;U PQPUT P> R* P "@ 0Ѝ0H-@PU  (@xP0P QQq 1p 00H-M@@J PP@ P  Ry  @>P: ' P 0+' P P0    }PZ "@@  0+S:0@ @Ѝ0Ѝ0HzDO-M Mⴐ@  @(P8p= pL PUP P`ti`"@ȀHp 0@Pp@@ ((q2 `DQ*  P(  ^5&p 9 0@@p7 "@"@]3 p"@Ѝ ۍOO  O>@tP(\ @((*(> ' (P >Q * 2X b "@ 2O L "@pF @L@ @@ _) ` iP)  "@  4y*taP( (((1pt!%"@! "@Ѝ ۍOv"@p (@$PQPp U' "@" @!IPP   @ ;@  50{TP   "@P PP   cQ0S0SS 0 PcQP $P0 N@Pk cQQSQcQ0p i P P{ cQQvSQcPq n@TP PL #P , `EP PR cQQSQcP~$B  "@ W 0<@Qk q?0@h !`( P `PP  h hdP y0cSacSPcPfc T  2"@a@O; r 0 `0 P0R / "@~ 6$@ @@4 B80A0 C48X "@$)B  "@ Ѝ ۍ:0@ u)  @0H-@* @0PUhP00HqO-MP@pWQЍP PdP  0"@Ed"@  P@Q P<崠8 <h $Qhhd@ P   Q $)6"@HHP P PA 5 "@``@ `{P P  0 Q 00S A AR:j   `K-M@`p@ P P$PQ97A N "@iC@P/  1PP  0UP "@Hn< 8 H 50@ @\Ѝ hhg' @b0H-M@0P ;Q  RU 1Ѝ0,( @Ep@-M`P@\P Ѝp@ @^P\ D90@ Pp7 u"@"@8P 0 (@h"@<@@ u @"@@ 3H-AMMp@Q\P K  "@"@ `$p 0 pW\PU  P  @"@zAލڍ0H-hM M@ TXP PP0 A R CP0 X C K "@"@U `/p T"@hЍ ۍ0RQ:0AQQp,R| p/O-MᴀPPT@1P> R *P  0ЍO P ( LQ Pf0 q W 0S: @? "@wDQ  0Hv a Vf 0S:  50 P Q  Q P?"@@P Pr"@@ "@@"@$ @ @pLP`p0  0PPO`VP6`@L   60PPA@ "@9 @W? "@ЍOP`00  0PPP6V`VP l 0?PT  P PL P @ "@:@ "@ 0  7P P "@  P# : "@ i P 50@MPP < <Q 1P V@"@ 0`ЍP@P! 0`%" @ #JPK?0QW 0 @@PP"@ 0 2  P ` "@ T  "@i 0 5 0@WP PP) P`$Q QC Q\PQ`@`Q$DU   60PL QI:<G "@6"@ 0 P hh  0岾50@ 吾RP-   P0{Pb "@Qb Q? "@Q "@/<`:   P0[P   ?r"@ 0 w:"@ 0 o Q*P D  PV:B\' @ 0MPQ  @ R 90@ )  @1 QP * P   P  0@ /"@% PW"@-`- H ``-\PPO-IM p"@P DHPLa p` X" g=cqP"@IߍO P @a Pp ,0@ 60$@@$ o0R03p 40@'P $ R ", R QP $`!@@ @0 P= Z @ "@ `W E !@@@ @@ ` P<Z "@@ "@A @"@0 ᥿ Iߍ"@eIߍOH-M0080(@P PU`PЍ P  p4@0H-0M@: 0%P P ,,P    ,<  "@ 0P 0K*0Ѝ00H-@P "@ iL 0H) @ H-p@`@PQ ]P P P( !PH "@㜿"@HH0H-@P "@㏿vhLh0H00Po ap/A-`@ P:+P P@qP ;fP 0p !R P/H-0S ^Q0 SR 0 S QQ/) 03?#R/Q/@-x^0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUt @@ P ĐY PhP dPe  #@gd P zPV `d|Hp  |Hd H 9 P$   P" p8SP P(  `D+ | b pP p $  'P Hp`Hd8dX 6Vp  㿲P `  |xp |dX7P g!  㢲`P$ @PUN H#@İ ㍲P P. P* 8 P% xp @oW W  P P 0<  # P  PĀX  RP@$p<` 5$S`h0O Pe pttXX 8` X`dxQ XSh07 Y` P `aHz VuH P `HpNg `P5  < ~ "@25  < r  "@&\Ѝbc)s9"@" @"0@*p@-PH P "@Ѽ@p1P P P P (" @   @`V  R 0S `Vp0QP   RU dPdhb(9?"@" @"0@@-Q @r P "@K-Mp@PP# @PP`V4L P ` P  `QmV"@㍼@OT  R P` 8000Po @ a'" @kQ$p8q;|0@ @0 "@ 9p  ``@P  "@"@A@ ЍK-M`pVq @P $dPP4( ,0 dP  h d@ LPHPPU9  "@>hP dPH1 R PQ PU( R, R   "@㊻XQhdPPHVpЍPP  Q  /G-MPPU @ `xq 00   0 TPЍO- MR0x!@<R  ޼P PP p`PP"Y Y V' P PC 2 ЍV P PP3T? 0S= Q4P7 0` P0` ` 7000Po' a " @%P[P: `Y ЍOz ``T "@ ЍO@-P@TQ   d P@^ p@-PA `T /@P /@\@  X (@/@ Q(  P:Q0Q` 0@PP@\Q @ @CQ:Q`VQ`C`QpPD /@@P  T /@p" pp@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0   0ЍO- RNT C H /@6Ѝ///O-M /@P Ѝ< J(@!@@p5 "@ 07/pV )"@ @ @07/0 /0@/@0V)L ` S! @!@/`@>, P`"0@" @ Q7p @"0@V0b "@7/?  /0@/ 0{ /@o PS" @"@/`@+V p U` @ @/p@:'Vp!0@ @~k  7P"`@!0@W05/ /@gv\ [nfvF\L!`@R Q5B1/! A  @!  @!@"@ 0 vp`@ < (@@9"@ 0@ 4/ /@P4 0@ /@@Pt /@Q |P /P@/@ @P@P @Q Pd /@P剚DЍeP\ /@ R@@L (@/L (@/Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^0`SQ0CP1S 0Q  /1S 0Q  / (@/%p0pS C  S \ 00 / \= p(@/ p(@/ p(@ / p(@/ p(@/ p(@/ p(@/ p(@ / p(@ / p(@@/ p(@/ p(@ / p(@@/p@-l P@#`@ኩP @ T@pQ Q, # @//Q R !R/ R/ RQ/ r(@ P/P/ p(@ /P/@ RRR/@-@R !ܡ p(@/ p(@/p@-MZ@!P@P@`\:p 2(@5"0@V0"@ ;Ѝp R/QQ (@/{ ! @!@3P/H-0A Lr RA C 2r R 02 |s R|s Q Q$$@Qa "@/ (@/@$@Qv "@/ (@////MH-M  0 ЍHЍ/0H-p P(@@`<2  @P   @h; `0HǠMH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M UUE3333C@@!??@!11@0! S Q:P @p@mЍp@-j @P#`@ P P UppQ/* # @/O-MpP `@ ̞PP:P@LY pP TUAU$* P$  P$p`ㄐ( @,7Wp +( @@@ @ 0pP0 0 PD00 0p4p ` G E$[@   P * @ p P:P /@  $ A  ^`P Vpp@ P0pP"=SM` DDDDDDDDlDDD  < [Q< Jp0p @ =Q P90 p @4< ["Q<"Jp0p @" `~  >#Q>#"R RRW<0 [Q<Jp0p[ Q P0p @  p0 @>3S<P[; [P,4 [8p ` >3S P:/V `/@` < Q:8@TY ` V` < Pp` <`0qp`[kP  P A,K Aq P ` P8 @[  AP, 0 B P *PK0pW q1Wp! Sq:0CR A1S0!A1 R PL*Q Q: Q:D 0aqPWP1pQ Ap60 >#R R0S0CRS 0`00HE2 er0@0 p0  R`/@` V ^ppЍ`8`;;P`p25`1A-M@``>Q$A QI  0 (  (e]Q?Q" [Q \Q(V:` /`@P`>Q* <Q-&'^Q {Q |QP<9P7 4V:P /@ @`@` V $P*)P )  V LP*`)P P /@`Q(**0@SpP p@{P0S * ? (0@000,R Q  /@VQ  /@>P *PW +P0@ E_?P` {P^`0P*0,Q (@< H0VP  /@ cQ* }R X b. `? $   $ uPh0  @+0  @&0@  @P!A>#" P   ?Q^`!p^ ]@#  x (@'Q`QP ] P  }RP P  /@P* *0BS p` p@ P  /@ {R P* (@ЍK-M @\Y P:P /@```JY0JIPB0LLLLLLLhhhhhhhhhLLL/y`qPLP  O$ ( F*YV .Yz [Y]&}P /@ Dq{YKP2 / @`@` V $P *Q*\P)P \) ( V LP2Q1* \R)Q P /@3&. +P ` /`@P` `QHV x (@'Q`Q| /@ {  P#*0*SPh 0n @0 c @Q*\S{Q $YЍo`0Q* 0,R<Q* (@ V0VP  /@ q RQ1*0\S0}S+ R *Q * Q\R }R P P^ ]@&`P{P /@p @-@P*^Q  $   $ @-@P @ (  (p@-`P pP@P:Pp   !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QP /@tPo u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AM  R0@0 @1>3 " :]P P /@PP  1 B>3 ! A ЍO-# " P   pPp  iPpG0H S@@X@P >F 08  0 @ oP!A># " aP   PF 0  @ GE /@H-} `(p@@PPQ  , (|TP+ ,( , P<P!  (@0Q1 Sr1`/ Q( @ Pr0P  /@@-@ P*Q* [R .R. Q 2R1:Q /@P /@0.S ]RA-@X 2R1 :P /@q`0pSWp]W `00S:h |#@P"p@ IJPP pPWVPA-@ (@PPQ 801 ,P  / (@( @ (0# RR: -'R:0%(%@%(%(%@%@%(%(%@%@%@%@%@%@%@%@%@%$@%@%$$@%@%@%@%$@%(%(%$p >Q>"P P P Q`qQ` O-lMPe"@Q` 0E P  lЍ (@,0Q : P  ,0  X8P= ,0 ; @Z:,p$QX 4Q8P Rp.*$pJ @P< [:$;f,0P pKZ+pP(P0 ἒ,0 .@ Z:, p$P  4Q8P \ p*$ p J @P< X:$f,0P pHZ @P$j:,P Q 4Q8P$PR* P@pp@P< [: e,0P $PKP<@ pB$ W B*d@ W'*P p W:(P0P``@CPE@T`VV[0V 0A`1T@1@(P,0p W: p <@ pB$ W Bt*d @ Wj*P p0(P`@P@0C@T`VVXVN A `T@10p(P,0 W:pD#RR>p&A Q =@@==@@,>@>@???R p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpCAA$CCCCCDAAAAAAAAAxEEE FFAAAAAG2 Q@  0p@ @P>  X@:? "0@PdB@HGG@H@HLHHI>S 0pm `Rd\hA^c p @ 6_0PW@[ >># R0^B* (@ _Q7^ ^/^*_Q',0^! 0^ ^*/ 0( @  pp_S0^0 0^0^ _S^   0^* Q (@_Q 0^ ^(@_P ^s  (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >- ( @ `SRP 8010 Cp <@T6 P (@P"  @- (@_P# Q@P`Xx:?^  y_Qv (@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0XKKKKKLL(L8LMMMMMMMMMLL\LlLLLKKKL,KKKK,K    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ- >( @  s(RP 8 7  000>0HpW2qQ@, B<.Y PPB ((@ PP ((@PPBPP  @T" ,ЍH-@ (@PPQ 801 ,P  / (@( @ (0<pQ ` u`R* w u`R# 0P4P 0 QR RP$P `p P$p`W:88oO-DM0@h` 3 (pP* 0lP p Pp  P Yl P   /$@Y p<<p@h` Sl @Q~@Q40p,@8 Q$@ $@$$@<(qQ@ @ Q  (pP8P@PX y  X0yp Q@Q#  (@8P 8= (@4p 8_P @P <@ p_R 8Y  4 (@r  8 _Y ppr \ @ R < r @_QpqQw  0pY@P"Y  <(@q@_P4@P  4(@q_Yo#wP' < (@^rP4pr o w@ $@  w /opP"Q~  R0(, o0` PPP SY @V#RR>p&A Q UXXUUXXVXVX\W|WWR p>#p!>3 S @ 0@I`8  0A FPP @   0 @p2PZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpZYY[|[[[[\YYYYYYYYYT]t]]]]YYYYYl_2 Q@  0p@ @P>  X@:? "0@P@Z`__``(```>S 0pm `Rd\hA^c p @ ?Y0PW@[ >># R0^B* (@ _Q7^ ^/^*_Q',0^! 0^ ^*/ 0( @  pp_S0^0 0^0^ _S^   0^* Q (@_Q 0^ ^(@_P ^s  (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >- ( @ `SRP 8010 Cp <@T6 P (@P"  @- (@_P# Q@P`Xx:?^  y_Qv (@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`pT@ QV,ЍXP 0 0"$  ~(p-+Rq0chcbcccccc AGE !0 > Q  > 1> Q@4>  >@ PA*^# $p!P$P P(Q qP p  zQ ^J @`∀Vc^J- >( @  (RP 8 1 >083@8Q` <@Y PP ((@ 2PP ((@ 'PPPP @ O-DMP, 04(`  埏   0Dh  lP  τ 8P PU8l@ Q ! U <<$l@PP  9VP@8(@p0S S@  @$@@<qPU U  (@hpp S4P0 @U,0@T {B  0@T?{p Q40P,\$  (@,0P^ hp(4, 4(@8p _^ \ <_\p ^hp( 8 (@r hp ( _^ @qQ?@0p s0RtB  0(@@ p0P 4(p^\!^  < (@r _\2\  8 (@r _ ^ o"pP&/ <0( @^ s8@s0 0otp0P0 hp0 0t0 ?o4 2 Rq B 0kPo@p pP4 @ /UP@Q( $@[$P ᎃ ቃ<@0h tB @@8@@ @@P\a < r [_\fXlP h@P DЍO-M8@S*P`  >#RR>p&A Q lToTollToTolTohmTo n,nLnR p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Spq  X@:? "0@Ppv8vLvvvv8ww>S 0pm `Rd\hA^c p @ S0PW@[ >># R0^B* (@ _Q7^ ^/^*_Q',0^! 0^ ^*/ 0( @  pp_S0^0 0^0^ _S^   0^* Q (@_Q 0^ ^(@_P ^s  (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >- ( @ `SRP 8010 Cp <@5T6 P (@*P"  @- (@_P# Q@P`Xx:?^  y_Qv (@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0y4zyxzzzzzzh|h|h|h|h|h|h|h|h|zzz {{yyyl{yyyyy    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ- >( @  s(RP 8 7  000>0HpW2qQ@, B<Y PPB ((@}PP ((@qPPBPP  @T" ,Ѝ///H-5 // //0H-P @/P@P /@:q Q0P00H-P @/P@P /@(qPTP00H-P@PP0}@P/|@P@   // /////@-P A -//@@0" @P%O"@@P P/O-,MQw PQqT/Pÿ"/X@ϑÏ"ࣟT @DpTd`@# bqQpd`p$ (O,. 0n[* !(  0n@ 0(@ 0PE nXP! d 0n`p  0n@吶 PP'v! 0Yd $   000  T(-Q ,ЍD  O-$MP Q AQ`#dP p W1Q``dP 0L@HpSn[* !* 0Gnp@ 0 p0 >nX d 05nP`  0.n@ᐅp&e!P 0[  0$   @$Ѝ g @-M@(2<FPZdЍ@<2 t  *4>HQT tD t , t t  t t  |t wt  pt kt  dt| _t d XtT St 1Ѝ-l i k 9 k I Yk ] y j I . O-MQ`P@T -P p P P nPoPoPa@PThhhhhhhhhhhhhhLh  IP  CPZ U 5PZ T 'PZ Uhp PZj UZ<  PE ( P?  P  P  PhZV U4 P'  ߃P!  كP | ӃP h ̓PBZ6 UZ UZ UT13TTTT TTU  Ѝ [ s h FIh h p g + Zg  p@-`MP0 ` B@ @F?Q @@@@@:0"1P vp$ 0H up fp  f@p@@@xHP ^rPp P QjP`ЍpO-DMMp yX@@? Tp FDP û`^v P `e $($ ;$ P@ p @ 娺@q⨱8`pp tpW1 @ 0'?X A  =p P=债 ePcP)P p PX*@ @ pTP  @ h\Y @ 7 @U gH 9DЍۍt> t/ _ g ? 0H-MP @ 00Fp jPp U 幹i PP 对Ѝ00H-p @@ PT 0PgAp xҺ P|P\@@P犹HUD  @ j@P0T<\4 <(44;;3G-CMH@T@P@T /xP2@!1@0@ 0 P:??,@@9@p)  `+p.PP@w !0  0q}P@U VU P P@ PCލ3: ? 0H-MMQ@PPp\ T /TxP҅@!1@@ 0_ P:߅?AXp LP :4p%@@i/ɸp- +Wq; 0@@p 0@y~p   Pp@뛅@PЍۍ0蔅P#P/p @ኅP 6p9x1D99 1188] 08H-nPO-M@Ppj`hU^RT, `!kP P`kP P`@0P   H $ +8``0@PP X 0@ @l0? A0? ?0@ @(P EP ȿ 0X\ WA q *   0TS dS S Q  QTQ tQ "h"S"b .R  Z    zRLQ @I Ʉ !pP=LHX[p zQ \!~ ? ? ?(  ?$   ر  0pv6P XP\QH RPQP@mPRPj LP 0p/ /"l@P}d`P```3V@EPp3W@VPW P@`@LBPPP !$` AlF(!@ `L0$T 8R PT "0pP PT@P$ b(RV@ ! $QQ0! 3QTРPS "baZI@0B!@%@ 0!$ < "i$ PRσ 0P $#@X  V(PU P @嶃P @,ߍP *+ TP/PxP`E T PXP @` J wPL  \p2g'o0Sr"y/0S!0T 7 0@}l'0@ 1 "p'# !D@R!'p`%Px )Lu@BLt#(|@r@c1SP8 )|5@rL7 7 0@@`P@38T`4P |`Q%`w+ @!)4  L!HDB@cP! !B[P : :BRSBq/Dr AC!/@2 `L"HS p 0! MPPPA HP>ڂ@ Ѐw  PB v:  ;K!S-5:0`X/ }Tptp`VzQ p@P@%g'E# Q "q` 2pG`Vp, @NPJ" 2"pq 2apRp T剂@P4/@!  P! !BP * *BSRCq?Dr0AB1/@2 `L"HS p 0! , @P6(RO-M`2ᜐ嘐^@P p XP ` @P8p,00@8L@DHXPPXH`<Cp(d$4T@Ud aV$uʘ ~_P `PP PN QJQEaV 4Vi F3Phx$L$DLXp @   8 ( D 0ll@"0 "eK p  02p;0s0 0p3@P@ 0 L   00 R&@ptp*#pRp`p $ L @$' r0'$0S(ʁW@@CR@dB¯ " p!" Z"@"B \0 @p 0@Cc 0 p/"?'P:@p`!< !0 @3$0SʁW@@CR@dB¯ "@O!" Z"@"B \0 @ 0 c  0/"?#P:@ p`!< !0@2a ppTx QpQp tp pT\$P ?/?#/"pSp"B"r"BB"r@@Tp:?\M?TEK(PQ Rgd 0 @@xL 0d 8xd 05xP 0'-x T<  |! 02p s PL@ 0< `p\ L < P qD D`p@gD`p0h T_(c p 7D BP <0P' L 0D @@ \H :(X:$ R 8p4RPWP1$QY| d 0 @aD 0d w TH0   h X   `pTD h 8牱KPFQ uʘ PP p88" !R 0S201S(X+:$ R\ 8p4RdPg`1`8p4PV @ PO HT`pA \偱A($`8@4@@P8p4P6 @ P2 H`p$PA8@偱4A(PA@p@48p 4@8p8p@P@4 ~Ѝ@p @p08;(,1L9O-M⌸ p0```&`P0@@+U 0-U ^(UX00P(U )U U 0CS0-U +U 0@ s xP$ QS QPЍ l @lL  tA@0P@   PV p "' 7T@UQ.U p0PpP4P 5```.U` pP 80 0 ppAP AP  AP  AP  AP KnP P  `.P` `Qv``HPD@V cw X$P# QuPp@SwP Qdt@P  |AP  uADP@  lAP  eAP  ^AP D WA4TPP \ NAP D GAP dy@ P  ;AP  4AP mIn@@P  'AP sc@P m`@sPBD AP $  ASPP  AP  @P  P  @P  @P P  @P~ sc@P{ sdP`@vPZ Q P `@vPD Q Q}#! 0 0 .R R  @P`p 0 PQPA_L @`@vP Q@ P;P P 0P @PPP`PpPPP P%D} D0 J xVۦ @XI ѧ Xd [W [F + Z\L ~ ~ @ pZT 9 '   4A n Y0H-P˭aB @㦮p  U:500PL0 0P Q/0P  Q/ /$ w@-tp0  @ R0@P  T@@Q 0P @T ˪ wH-T  P  ! P  0S hwp@-l0O0Q O O@ PQ0 P`VP  pvH-PP p@ PP `QYP`H-d`@`P p P` PQ=PPvH-d`@`P p P` PQ PPDuO-M`:"P6 PP5 @p`P  P QP{ @ `pPY W k :_`P Y```Ѝ譜 t- H-P@Q p`P `Q4Q  9 Fs*K-MP@Q p`P `QQ6 Ѝ FY' x  qPPPPx`W``!"P`V Qt 06/Ѝ<Q( \s<)r9 @ssr} @-@j h@eO- M`pPP PPQ㌽PY @R!PQ  P H T `PE `nPoPo@o`=jP PPQ P Q0HQ  P S p`P HP @ Ѝ V xp' O-MMpP@w` ._P:RjPr  "_P /P P ڪp _jPl /80p pp=bpf ߼P| p0 ,bpU `7P{ `嬒  +`Pn  O P 0p z Dpu ᗪ @sPY  cE 0ap#  b1`w `b Wwl `bOwP/kr bAw=w` bp@ 0w`Ѝۍ 0p 71`P  9  0 ` wX  0 ` T $ ۢ | ,& A| %S S 8 1. D W H-M  0 \apЍH-M>  0 FapЍH-M?  0 0a p ЍH-M8  0T pЍ P   /TDH-0H-@ bPP :v? $  0 fTQ@S04`@@017qUpST| <`V*,4`|*YvWP pVb4`Y> I@<?Qm Ri pa2! Q'3!Q @4Q <P*, 4;(`P< R< 4080CS7:04 R*>(4 8 `0B4 S  @4P*# 4 4 @R*`4 @ 0 P@0<08 4 0@@V*<4`@ @FY4Fp`   4  4P 0Q:Q*=  4 4 P0@ P@p P@ DP`44(P< R 4080CSQ*P pP*< 4@ 4  44 R 0P: (pQ<0S 8 @P:40S*>(408 40@S 0@4P*# 44P*pp404 R*>(4 8 p0B4 S  @4P*# 4 4 @R*p4 @ 0 P@0<08 4 10@@/ @ P`4` @ `P P J(P< R`PQP@ {`P pP @4P4P80FS: R4 *>(4 8 `0B4 S  @4P*# 4 4 R*`4 @ 0 `P@0<08 4 0@@p  @Q@p(04p8`4@Q @4P*# 44P*4 Q@<84pA 4  4  P0R:Y @4 Pj R*>0 q04 R*#004  4 (P4 80pBW  @4P* #004 4 R*004  0R@0<08 4 *04  4 R$P: #  @P:  R*004  4 R P: #  @P   @4 QBLЍH-M007ЍH-MPЍVO-MR @ `pPJP/ .N TAT 0/ 0 @)PPH NPHPJ Z@  0 @  @AP  0 @ @M@ 0 @ @M@ P t  0P@@ 0   0rЍЍ?>O- MP @P H@p, pWbDP0 Q@`p p P    ?Q Q$ v , A L@ P| 0  (0  Cp/  0p P:pv , pL C@.ppW,0 Ѝ Ѝ=0H-D@ PU BP 08@@800=0H-@P PBP 08@@80H-M0     0"ЍH-M0     0Ѝp@-M 0,(@0P4`@ 0 P`Ѝp|;H-VMP`@s@ ." B")#2 `K *` K0*@0!K C0," `K *` KB *@K Bpa "! `!*` K *@K BtQ o"X! `!*` K *@K Bxa S" `*` K *@K B|Q h8"  ` *` Kh *@hK Bha @" "+! `(!*` K@ *@@K B@  ` *` K *@K B@h 000 B/ pp Vߍ;:<:9`98l88O-kMP @`pQ <P  *a gK*B Ap" `K *`K @ *AVK P  *aV fK*B A" `K *`VK @ *AaTK P  *aB dK*B! `!*`BK*@ AV AK ڻP  *a fK*B(! `!*`K*@ aT AK 幻P  *a dK*B  `*` K*@ AV AK 噻P  *a fK*Bl  ` *`K*@ aT AK xP  *a dK*B! `(!*`K*@ AVK XP  *ah fK*B  ` *`hK*@ @`0 A3@KHPh `p x  h0    @    4   0 D఍   @ H@0A   X \    T X! p `pq@PdBXP `L\1V∡ ℑ$C  <I,08( Ἲ,@PCX>` f`V4 Q Pp @T`,@  V Y封: P pW     p ( ``P!!rAD |  \@p , @aPJLpW,pXPpCP`  AXE 0 ALT P P嶲U`,   X Aq,P:$P `׬P `V     P`  HY  `P 0P @AP!a@D | !  ?p ,@DH T  `F dp([,ֹpҹPι`pʹ@ ƹPCV`CUXPCW8P@pCT @@C V@@(W `<$Tph(pHT,!`DPAD |  ?p/ ,`H V@Q X8` PA<XV<X`pV,!d@FQ`D |  d?p ,@dTH Pa Q Q800P TP䰝 `Kp,`XT@B  ALZ@,`pg p W5  \ P P坱U,`  W డLP: PP X     `$ @TFgTpW Q,D P @YT`,` W[T:P @}P[ @T   8A8` 4LA\$ZF`,pdi Y9 dA P PU`,pd Ydడ\P:LP$/P  d [    H< `V(`pP4WI,`@I \ 6GP@T7 Q P `帰V,` WQY :\ ڪP X    `4t68PJ┰ `Kp,` 5p5dg8pW5 dQ@ P @fT`,`d Wd[8:P @㈪Pf d @T   X`pPZWlh,` @H\X 4l43dJP@T@ dQ0 P `V,`d Zd QX:\ 4P d X     `pX kߍh3,p+p@-M 0,(@0P4`@ 0 P`Ѝp#`Q/p RD D  80#@ 00S @H/P#!"P/q RD @  40#@ 00S @H/L!!t"P/p@-q RD P S@P 000PRP@\H 0 R ^,@PA@@`0D``PU`h``@8p,! P/H-H H0@00S 00@0 0S@ DH  O-,MPP,Ѝ墶P |p80I$p 2<`吶P D V ;P `Q: PpApW `  P!P V <@ C@?3p  DPPP`|V  HLpq 8<;PQ``VP,@PqP@U   < ~,Ѝtp@-`T@PUPpPTd@p|p@-P@P`PpP<L@pH-Q$ H ?30000S |0@0 0S( | 0DR  R 0S H-P% H ?30000S |0@0 0S( | DR ^0 01RT /ᔪK-Ÿ`P @T3 ! !  !  !  ! 10qpp! 100"! Xp\ T `lmnTpЂL@4P$p0  `lmn Q >)   `8dTl8hHA-MpPPhKPP `P @ 0 ` ` #`pf`PX  pT xpO pQhPG PP 0PPPt)P9  0PPPi)P. p* N%p&  0T)P  (Qw oP P  P ^PpW Wp彬Ử@Ѝ_ Pp@-@ PP ^(`V (V`-@坬\囬Qp@蒬HH-MRp[`]@P ` *a ajAjAjAjAjAjAjAjAjAjAjAjAjAjAj@jAj@jAj@jApj@jA`j@jAPj@jA@⏊@jA0*@ojA J@fjA @#:jA}_ojBf! 0S R 0@T& r`VhSaW 0RQ  00@FpP *'Q!!Q b  Q BЍ '###|<>*><^v(0p'.TR ,Q* 11 R 0 c0  R C/A-M @`pP+/`(P Upㇳ\P~3ㆳPQ ><^ v 8#:0'# #H#p--`_|opޱrڱyֱzұ{αM|ʱh}Ʊ}p% `H1 *` J` j` `C `0`@8710/1 71! 61/ 6575Bf/?001%<㏪B!08!<50`!30,30("50P"$50x"450",50"50#00!30!30"d20j/⏊Bn/jBr/JBv/N*B z h`" M- e" @  R 0S  pW+ s`V1P`Q1W8SpU0U0 SQ  00D0' 0p'nG f&nG*f`(KWp FK`*Gp PppЍ z{|}vwxyrstunopqjklmfghi+,-.p# h +   H-D' 0 c*`(K0 @ Q*CK,$ $0000000/ O-0@Q QJ q" R R `!0Qu  0Q`Q| 0 ݮpyAT `Ta  0ˮ`pe @Qb ᘴ/. A<Z P  E P EP* p8 Pf`vW @UTQ " p(   ` 0on`0C10 {p;@`!0Q J`C! @Pp$ @)!Ab ?>0 B0R!!`p P@P`Ѝ/. @@ <0!sO= Xl\<,8 O-M@$f P `R`P Y0 R LZ 0 R LPk Ex!(0$0R  Dlh<p$(EP  KTEP  sPC XR$T0pd` x$ @ld00PQ\pP PP QoPHP QLQd_TqP@〱V,@P `p PS @Wm LATj NPd P``p$V <P>LNPVjNP P`@`p$V <P>.N@PV Ӧ@ ᥦ ᣦT [  pWPEQ gWP E W ^WPO L `C@pP `P@ \[ P UP&  ZЍ\[  0WPP@Y(WP@PPV WP@Q WPP @Y   WP@ P PV VP@  7 X7 57 t`|0H-H@VPI 4VPC MQ08QP@Q7 P  P*mQ+P P PmQ 0 A R;A"o!!!0Q 1 A R:;A@o;Q 0A@ P3@00 )2 1 @-"TXl@@0 p0p@@,@d  @X  L  @  4  @oW$dt8<Td(Q  X//p@-P@`` V PJpQ PPXPURp@OO-MM@h``~P _ }D2ʽ@<"0 Gy Gu@ Gq Gm Gi Ge Ga G] GY GU GQ GM GI GE GA Gp Gp Gp Gp Gp Gp Gp Gp Gtp Gdp GTp GDp G4p G$p Gp Gp`b` G``  0"`@T( QU }L V#EtLpP`pGWP 0PU"`Ѝۍ$c4DJ- O-M@PP LsPp8$Q  BQ   BQQ8& P Q#P  0 P 0`0Q 0`02`N  cQ @8LЍ Q A  AP 'ԡ oQ8<Q q Y Q* q.)p  P@ x"@@; !YP7SP2 L&|p  <PJp RP  XYi X PO@`8{Tx@- $@:p@ ,@-@:p@H-M08 R   ЍlO-M(@`pPP U PJpQ Q 0Q[ЍK-Q1Q+ PY# J@Pp@DT P` 0 `V"p 0"hK-`Pp Pp W PJpAP P QO-M`PE@ؓ `QPHU V V Pp ˾ppp@ WPLP 4,^ |  @Z pX w " qP( PU tpB ዾp P~ wb U pp6 0,q/". @@" 8" Q3! !@10q! PQ  RJr0"1pW \pA0S 10S0p1\\! Tq0poq&.  C 4R p@ FWP`S`P tl|`Ѝ |0 I(tp\xd<TX" dđܑp@-Pֽ@p p@@ VPHPcPP 0(gLp@`H-PPQ @ S pcP 00A B< @H-PPQ @ S p᳟cP 00A B< @ H-M< R 0 ЍT(Q  T// A-pqP` q@@_P| ]P      @a@VA`N VQ=PT _ } Ay Au Aq Am Ai Ae Aa A] AY AU AQ AM AI AE AA A A A A A A A A At Ad AT AD A4 A$ A A APtt0T <<0 ZH$M  *  G-PM @,  !q!1saqQ P `qV PEPjW *  0 c00 GW:W`D0H |-p apW 0@B @- $@67p@@-@,7p@0H-(M$ P@$ \(Ѝ00H-(M P@ O(Ѝ0p@-(MP D@7p ` :(Ѝp(ЍpDp@-(MP@6p ` &(Ѝp(ЍpH-M   ЍH-M@  ,00   ЍlH-M ,0 0 1 00 0 Ѝ0H-MP `@6p  ,0 00  PЍ0Ѝ00H-MP@6p  ,0 00  PЍ0Ѝ0$Q/`@-@@@p$l m hK-@4P`PKpP PKP `#  e0Ja*e CJA*ClPPR aP*c20Jb CJA*EF c4<mJe?OJ@*a @,*A   PP0@-@@P d 0 T  "4 ` 01SPPh|@-@@ P b `2P01S`` PP@-@@P <l   R0 @T P` P4\A-As@P   # R6 ``: P P 0 02;8 PYQ0"``@ r8PT ` 8PAP@-t@@P  R  8 PP`p@-@@PP"``P   P 0 `V P` P p(P8<@8p0H-PPQ n@Q%  "+ 8 PP Q R@Q  ,-  0@-X@@Q 6Q ,-  0H-PPQ @Q% @BK@8 PsP Q @Q  ,-  0@-D@@Q Q0 .pC-`P`Q @Q+ @-P,@P@P@8 PP Q @Q  ,-  p|H-0P @H-0P @H-@@P n R0LPH @ m   t PPK-@@P = R DP@ 0lP@0L0Ll (00PP8@-P@@Q Q,@0A,@1A@0L (00P@RX(0H-P2 P@PP  R0 T, 0P,0P,800L PP00P@-P@@Q Q,@0A,@1A@0L (00P@(H-M@ PDmQ DQZ QP1DQPP@DQ 0p  pPP050  5:  < 005PqЍ`P/H-H-@ R/PGPH-D QPbPD$ Rs/$ Ru/4 0S s/(# Ru#/P#/p@- M@@ P` `` ` `` `   ЍpH- MRPQ  R Ѝ ЍoP%GA@PuOP Ot! Qh OTLA@P p% 0  Bp(qp|P  5P: 8  5@@ 5 X5wC 0@ @4# PzP Ѝl t ttsssdHp@$A-Mb`Pe A@PNPP ! @ ,OhD Pp QP3D<@4PQQ   QQ  4PIF Pu0CЍl  0S 0S@@H R 3PP rqqqq$p\H@-4@@P$dNoo@-(@@PQNo|o0H-MP@ PPhDpP QT  LDPP  Ѝ01/Ѝ080nH-M\P ЍP < @ 4ZNЍntndnH-M\P FN8  Q, ;NЍ8nmmmH-@ R/PvEPH-0 P'P@H-,/4PWEP@-P tQ |@Px@P <  =40#@A@l/0H-PQP @ Q Q0t l0L0Q00,  4A0 @-@@P P P tPl P H  3@}A$ PX$$H-P" p8 68P, (@0`P0`` 0C`V@`V0PpW0H-P0^, 0 (P@PP 0PUPAU^P/0 S,Х/p@-P! 0QJPURJ0ES R,!(@0`P0`` 0C`V@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V  P B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0`` 0C`V@@T0 Q0pQ  R/, B0BR P/0H-^, 0 (P@PP 0PUPAU^000H-^, 0 (P@PP 0PUPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-0QS, (@`P `` `V`@PF`VP0SpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^0, 0 (P@PP 0PUPAU^0P/  ,YP/0H-PX@tQT X0 P#P/4  P3P/" P#P/о  P3P/Ꜿ P#P/l $P3P/ 04@-tP MpP @pQ 7@b1tP #t@$P#P/ |< R/Q3 0S 0/H PP/PP/H-4PPp H괼H-@T& mpP @tQ 6H0tP |Q pPpPp|Uw tHp0 ꨻O- MPE ZCp P=S;pR0@P @Qp @)=`p 0ʛPJ叜P  `FPGNP  J0  Ѝ  PP/PO-MPpW! @`  0* tP  0`ݛp   0}PP 'Ѝp@-]P D|P @`|`0@V xp& @P@0|’P Q @XPPpD X|$pp@pApRlRp@-@P P P`Ȕ`0PVp@A-P @pPP  X `0@ PS S'0,01N0oC0000\L0|X, 0cl00`S00C`VXP PUPP`np`P VO-M  p BT P P;`p 0ጚPBJ彛 [`Fp P bP P P(@ PJ J P QP@U  HHJ@W  = J@Z   6H @ЍO-TM$p R TЍ]p!R @0 0t 4TЍO /tATV |! BR8   `,Pp; 0TЍ 1€ ,``VS@4p  pʀY`t 0@  Qp p t1 Q 0 0+p  YpG-` PPp @PAA@Y ZXT  8PP Q褰K-P `P:@ᣚP3pP:彚P,J幚P P$p @ @ WP`W ` @$ A` !pPX@ <`劚PW 僚PW |P꘯@-p0@ SP 1 @  !0 b D *c *A  PK 0H-@ P  R!4ĒP PUXP R 0P R 0 0R000墒,堒`Q Q QP 勒ቒ0H/\8  R/P@0?30Q@ ( /LP/Q@0?30R@/Q/ 꼭R/Q/ (ꄭR/#R/p@-@,P?`HpDS/p@-@?`PHpH-QPQX-@0 8@0 8 R #@( @ ȬH-R^X=@ 0(@ 080S03@@M K0H-@xPU XTP@? @48P@@$0Ы$0H-@PP XTP@? @h08P@@0蜫p@-Pw @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP  @pX0m@ 0(@ 080S@pp0H-PO @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@    @0(8Q@@00HP@/0H-TP  0R  QS\ UA ^ T (!R !R 8!R !R  R0LQ0p@-TP&  0R@ S 1T S1 AS0 T4! S`RQV U@@^\(!R !R 8!R !R  RpLQp80H-@ P7 0Hbꈥ0H-@PR J 0 P  S 7 0HH0H-P@7 0H>0H-@PQP J P  Q 7 0H&Ĥ0H-@ 8P'p 7 0H0\0H-@P&p P J Q  P07 0H0H-@P&p y7 0H0p@-@ l`P&p V J P  V pV7 p@\O-M-MPl@P( p0T`$, ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2p! p Š ϊϊ ϊϊϊϊ ϊ$ 0ᰀ @D PT ( 0ᣕpP ЍЍĢO-M-Mp`P(Pp U$0 ϊ ϊ0ϊ@ϊPϊ` ϊ Šϊ4@% p ϊϊϊϊϊ ϊ Šϊ$ 0 GPE`U ڨ 0@pP ЍЍO-M-Mp$P@P( p0T ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2`! p Š ϊϊ ϊϊϊϊ ϊ $0ᰀ @D PT ( 0pP ЍЍH-M 0 0ЍDO-M-M@pw%pR P( ap0V$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ4P"$p Š ϊ ϊ ϊϊϊϊϊ 0y `F @V( 0qpP ЍЍO-M-Mp(`PP0 ,0p0U$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ2@!$p Š ϊ ϊ ϊϊϊϊϊ, 0(帐PE`U 0 0pP ЍЍO-4MP, X q\@Qa @QB \(YIPPK X@PzwPX @ X` T@#U`F8  PV p pf `VTU8P   ]ߔP X@ T P8P  DpaX@T PlP*  @T  (0 p0Q Q 0jPPh @Uq0,D 0|@ 縐wp  HLPEpG @U(0@  X@ QcZCAZNTQ8P ' (0  p0S0 RP|D1p HLP`P 0A( @p Q0@ TP,X@` (0 P P * p@ s@H@PPU㰡080pP:Xp@@ P㑆PO pW@@ ZX@PpG pG0?W P P  Q%Q{ `Vjp,@Qp_|Dpp `HL V!PMP[PT R 8P R P P@0@(  pP0@ TP,0(  A% PPP Q `B@0F(  Q  ;P4Ѝ,, a \O-M-MP ( PpP IP4$$x Q A X@T`XPEP8  P4 0P8  `,p,ϊ (ϊ0$ϊ@ ϊPϊ`ϊp ŠϊB@!,p Šϊ(ϊϊ$ϊ ϊϊϊ0 40 g pG @W ڸ 0P_pPxt  Qh  T P 8 O H, Y@ $@`Yp0s@ (@po0`@p`S0 p`S0 YD0`@  S1 HpQ! 080! p0pp CQ -ЍЍQT+LP/88!R!RQ@@/PԎP/48!R!RQ@@/ᄎ<Q/(!R@ ,@ /ᨍ,P/$!R@ ,@ /LP/X-(!R!RQ@@/P/X-(!R!RQ@@/P@/|P@/A-P@P8 `@Q Pp fj 4P m P@@8؋t40S \/A R QPT/\\ Q/A0SRPT /$  RP00T/PP00T/$QQ/4$QQ/4O-M@T Q lP\PH@X P\T \ AAR `hPVTV[Z IQpI W @ Z+ Y  0@;IYʔ ` 0!!2G`F Wp,0P!PPPPPP,!PJ ZQ`p,D |    upM p`WQI P pIV 0!!`2`V,0 S!PPPPPP!,Z!p WPP`,D |  㰡 -p `PVЍP U 0@PYP )ЍdH-^a^ 0S,P@ Q( ,APq`0SPQPQ RA/Q R  A/P/P/P/P /P/P/dO-MPF @P H@, DP 0 p@Y* !Xaq | Pp pW:0@  ЍЍ踃@-T0 0SQR,@(r @@@ÃA(((@-(^^*,@ Q 0+0N,2*PA 0r%r@P c`0Sfffaj(bb 0+ 0NR@0S QR@@O- MP6,`p@蠟 @T*Q QPPaBHQ0 0A  P !(R p(X! 2/p < 0 Ѝ Ѝ''&&A-@(P $Pp(pWa,Q Q 0aBa,pPq0 p,Pp@-@(Pp0P`1(`Vpp@-00S S* $pPPCP @P `ACfHd$b`kk@k@k@@ PU`0K0CP`V P0Sp%x%X%G-P pP% 0P 0 R@ C 0 `0 V `` CV` V`QB   P BPPPC: ` P>`PTPHP@ U PU`P V `V`%P P0 S0 `0V `` BV` V`Q R @ R RP p h $P P@ @p $p}T~~ ~ ~\|,~O- M@ZX'PQW Z A(O 00!,PP`,PaE`a0ZpPppa Pqp5, MPPm 0 ,jDPe Q,48PY !0H!0p4,PPpZ P4P0PJTPP*`pPY, PPDp`&| `1p ⰱPZPPQ P ЍPU 0p S0G0$ p  `0GVQ 0QPC 0p0WC R R .PU  RQ/$0$\/ P/zp@-`@P#0P`T0p$ R Q P8UCPpTzwG-P@Q訡 $ Q P P0  @`$ VQI0S R H@p 4  0p$` WQI RPUPH p P I p$ 0 `S R0 HSPU P@p x@hT @T :q@p@y`wy(x4xw0H-P0S 0@@T@PU @^8PtVx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P _PU   TPUP;0 P CP8 @ #8 /0H-MP @0@0Ѝ0K-MP P@Q E0Y  `I  `V PЍp`^p `V`4pP `0pD QH0 P$D H0` 0 R Q B(P,0 qB,0 0 !0PU(pt0H-MP @0@0Ѝ0p@-MP @lP`0 ``F oob` P `PЍpPssO-MSP8U[SZЍ@<@`PP p @p8 V0$ @  AY  bP ljPDQH `$H(PPPX`@p (pW ,[D 0`0S@P"  Pqlrp pH-M  @ 0Ѝ\qP Q/H-M$000lЍqO- MQ@pR Ѝ`P+}P @!}P, 㧀P0v 4`P# 4<0EL0P00 `8|Q@`  P$pH* P@lp\8 @vP4C `|P< 0@0(Q?  Q8^U80@@8 SR$0p@8pSV0 @8  R  R| !R$Rv RdQ8pi gec@f8(^00 4 U ``  y 4` 0, @, `4U" 0 `H-MPЍA-@  Q@(0`p,0 Pa B,0 !0P P 0pW(`p@-X ]80 @^_O` P8`Q p$0 T8R0Q08Qp Q !R$R RdQ8pP:/p@-M `0 B 0C@ P  L 00N```ЍpO-DMPP@QDЍt¿pPlW`GSA@?Q`0C@C00h0QpRL@\ K@P op0K P0@ P0 0VPbxp` V` , YPPYZ |@ M $P   0 0P  Q:iiP/H-Mp@pQo : 0 tx P`a%P:9 D 0` FA/   ЍxifH-M0   ЍO-\MX0P8  P0$ G  `RPR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S(0sp pqs4E R :[,@``v@[P PpP,0PE1PPP0PP 0P0,p0C1@@@000~`P4@4t (@0SK$,p(@,04q0 ,p$`Q(0 pR ppW8` p@(p@W@ ppW8`(@" p BR`p@@ F` 0V (0  B0s`Tq t@A@T00T@0p 0sP8 0 `V1V Q 1Q/J,V,0 ,PQpVP* Q pAPP pW P @ .V ,V- `,Q&PU :Oq  ,!PE |GU! !  0A &0V P,Z' H,pz UDSTRRtRP$Pp R,0 `<P ( ,0  R P i( Awp `0 PU iYQP \' 'YT 0 ? > FdBD=DdA?x?T>`><t<BxD=>>4@is s s H@_@ P ,0@   RQW@ ' >  @BT<[S8P%  PCAlP '  xP l `PCAP = :00@@ TAWgP ` lP PG@T*lP  PZP  jPCApPJPP  [-FVf@P`  [PJKxPP .PCAEU@P|Q A j PPZ@P> 4up0@P9 e`  M @pPUG/@TPP PCAx ]4tpD@,Y```T P \@T`pppJ WF, $ 0S!`q 30S0@?3S P  P wPCA W6 @<# F@ P    Ѝ@PTP D" 4P ( 3PCA  @T(QpaP` t qpWNGxPP PCApp2'L% $d 84($$\%#  |p@<$ |pXLh\4H( 0|p@@H|8,|pPDT,H-LP @8P4 C B p8 RDQ/lPh%R/!R!Rt%RQ/ P/ O-M․ 80SD`VЍlUUhUUQUQU (Pa# S <Pp `0C@V\0``P # l P # c 0p@p@lPh0P0P l 0h00p0Tp !T/ @PHJ\`r&pV ǡ P?V !ǡ/ P8V !ǡ' P1V """@$ P(V/#ǡ 0 P!V/$ǡ< PV/$ǡ'H PV/%""@T P p``p`` W R t"0p` `C0P R _1`"'0p"(pZ0pX! 0`L`. @8 J Z# PP  H0\ H P`,` V !Uppp p  R0Ѝ0P<5St0Q 4tUUUU `@xT4hPp@-0P JhA@@TPQ PA@@TTp41lB0@T%@AT0A4 (40@BT0A4 (40    1tBp pR@Pq`VrRr`PV rR 0pdG-d"XR L #@8XE 0 S S' Q@,ZT ap@pQ@@T@@@@PU @PUZP,P U QAp@`@0SH@`pW`H@-^8J00`0S2lp2@0T0'00CS@1,0 0(0AS@1,0 0($p@-M@P&J\ Rڀ PvfQ 0tfrf  R -P 0 0 @ CЍp@-\JD\@ T،rF@@tv\H-| p0R0 ` ? "'p"8P (,D  t H-0!l2 0S%0@S 14 (400AS 14 (40  t0R0 \ ? "'p2 8P (X  X   h/A-t @R \" @  " DR@P PlhP9 PxpQJr2pP p! h @0p @qPᴆ qlp! P rZQ7@pQJr2pP p  0 @0p @qPᴆ q   r]Q =q  d  Xf@ (@$  L  h   l 0   (  p 0H-pP@lPPPPP 8  ,@@0(  , h / 0H-h@ Q pP QpP U  ᏭPS0 0H-@ Q pP QpP U  tP800H-$@oP,0 0H-@oP#0@-  0 S QPSZ\^@, Tᒷ!@@ij@@\ @-0P RQSZ\^@,0T ᓷ1@@ij@@\0p@-P0SpP 0Sp`0 @0P0SUPQPJ^@ T`,V0A ``Ƴ`@^```O-MxX  Q pPCZ @P@P0DUE ЍO` F@P pTT8  Y,!aq!R1'rq@ AZ~0 @00(@P 0`S0P@jp!  U ` P @)hT |DpV HPE U[:  aQ  E*PP P?㰡  : @`@2bP* `VPP Z 0`P Q!` 0 BP`( 0A pQ0@_ Ѝ 0H-@ ,Pp 0H 000H-@Pp 0H0   O-TMP" `Qo p oPC[ aP @P G PPR0@[mgTЍPP$0 A Rp? 0 J @ P TU8  P PP P P P#XppH$pnPCK  nph WIpC 吇(+$PnPC P  Q$`$@P@$Y@IXHnPCKP5 @Q# p mn@P$pPTE@C Pt!)+ $$SnP C A PQ`F $0,(p!P@PPQAQP U!A@'r 1pWpp P/ @gQpQ [p|D pl HK [ U: `PP K*Y$ p(@P $P ,@ 0P,00 (   0@Yp  0@ M P$P @T @PP 5P P`P( A Q PQ pf TЍ hH0H-@ 0Pp  0Hn0t0H-@Pp  0H`0p@-P 4@`p  p@Mp0H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS H`Pp NpOOpq0Pp0.Qp  pP0000pEp` 00`B/Q *Q@`hq Un HD 2/`P$U<P.X@> P [.Q  >?O  D.Q `0000F 00BH/QDp *Q@`` `Q PQ` Q'qr RPP@7/@DTPH`PDp PPЍ P qp/P@7/@DT4 Q H-M0 R!R Q L ЍH/ $ R p\H-M<4 0 0Ѝ4H-M0@ 8(Ѝ0H-MP@PQ PQ   PЍ0dQ\QD  <x , Ѝ0TH|H-M@Qqp@P> P 0 @-!N+A2"!K``!a  % a!`paP `V $Pp`Vp fPP@ @Ѝ< H-M  @R  qp P= Py 0 ,k,'@2" C`` a   ? @paP `V $Pp`Vp nP{POЍP7 | K-MPQ| PPV `% 0 i,-( ?,DC2" @ pA$` $a ! "*#E"!`q3P* aV$ @T $P pp@T WsP P`V X PU os` PЍ  0 O-DM4 lT]Pj P @ @ A4@:3@P2 `4:P) P Q5 21=Q< #Qr Q+1 80 +8q<N{A''!K0`!a$ % a!`pq PPz =; P p"@kPi1W 80 +8-x ?|D<S'' @ 0A$` $a# "*#E"!`qdP5  Px-1  80  c+8k|<w@'' C0` a# ?@pq 3PP \ P !P1  P- x P) d P% P  P! < P ( P  P  P   p Y  P P "`P6V, r`Y  r `U a`堀,=@D t PpᲐQ7qf P`q^ `DЍU aDЍ@ ˸ ޹ Ȭ ]o  $m $ k l # # # ; O- M` [P @0p     00.R A*R 0Sf Pp%p+c p  00SB   RX%S ,S  RQ p00\00000+0AGS`1ppppp  pppppppppp$ppppDppppppppppppppppppppppppppppppp ppppppppppppp  R P       0  dQ00  00p  d V  QP` `0cp        p)0iQpp0pppp6 QP 0p0000Pe Pt%0Bp %/C0  `%%G +%|%+%+Ccp  p PB  p `*`  A0 *@ P,pD Oa0@@W:P\Q P^P  P \[$ `J P_ @ $< po/> Ѝ L 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q0E   C ~0 % ,  PP ,S 'S\S/{ dS :) aPP0P! S :@bPP%aB0  b0PP%! N0 00}0:S ' 0000 0 O-Mp@`PDQp$ %QpPp1@ Q:OPsPplP T TX B @0@@T`ЍMH-M00  0ЍHЍ/O-sM`Q pPP  Z 8Y|Z 00`4`P@(YP, 0@@PP @ P A`K QP$ %QpPP1@ Q:sPPlP [ [ 0@[ `8 P00V @ @ @D Ax @`Vp Q Sc ,Pf  4 @`@%T TRp%W`40 P:P,\PK 4,0P%P 0 T-p@ p0Pp @@Q* 0G@XSe Pa0d.Y08 0 AR Pl00Pp0Y \ !G]P@xxTxxxxxxxxxXxX4`xXxXxx P @ aP @  m` Pf&GVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888`4 P @ A P @ ~W !Wo@ Y4 `0 P*,P Vp,ZP 4,0p 0K`p 4P4) PP*    P 'PP'PH P @  P @ A ;R ?R%Q Q P* @a@Q OQII/P88P@@ P @@ APP  PT*1@P OQ$80p!! !P  P @ PpW  P4 10 P*,P P @ P 0 0p0@   PQ*    P +@`>`@<V9 C`6P``2@ob.P``*PV``$``!` V |``P}P}PB~W OQ  ` OPa  P &A@Q# OQa ARI/A AR @40 P*,P b`,YP\ 4,0`T @4 @ APT&:%Q Q  ;R ?R eRP$ P" @PT*Y `,sYP 4,0`  0ȝp44, 4 ,`;`sߍL MH-M  0  0ЍH Ѝ/ MH-M  0  0ЍH Ѝ//TjK-Mp`PQt<`P# P Wp#PpXP  @TpC Q& X.pX,!X# T tXd P XG X: X7 Ѝh DDpP Q  (P P  }p(P  }pXЍ@8ἱ, ᶱ       - hh @-M0S C@P  ЍA-P`P p N@ ZT  DpW P  P  P  P  P | P 0AC hO     O- MM pP /P  0 ЍۍO P= Q/Q9 P6 @`YV.᧷`P& @YT  Pp  0`YA V Wg@3 P$ `@Pt@:PUppGTP:PW g U g  0PF[P P9 P 0 ՛P 0DP% @`P@t@:PppGTP:PW g U g  0PF P P ЍۍN      F  O-MR `@P pP P!  A @%VP P   !VP  P ( VP  GP VP  8 rPp R  pPpP ?@p  `p[ `Q'pQQpQpQ [ P `A0Uup  !P 岐$ Q$P   $P` PPR \X$POYX$ VP$E `YC [ PP0 0Ss0  r0P, psP nP fP0p pSpp1[pp2Xpp[ $ `Ѝ/ p`P[Aqr 0Xp`G-MtPp!` 0{ P 43@P pP+ Q@P g 0' pp R Ѝ P 0P  0pP Pp ps xsDs$sH-@`aP! V &PPP` |P p@U |oQWU joO-M- M@P  PP,P|QP  `,`3@7WPH p|P  倣P  Pl @@P,P `HQP  P`   PPp@*UPe  lV[ pV P  p及WL ` P(, (, `pW> 岀PPUZPUJ  $Z @TP TP &P!PP ( $@Z㰀( ( PPy@H V@yV @ @及T3 Pp`sV nV fV   Py  0&  rP @T pHV ЍЍ   A-@P P|``P,PP`PP  pP 0 S p A-@p` PUP 8TPP3PP !Vpఀ  O-M`8P. LpW @@fP@pW PPr @sP nP P@@  PZ  0{DpW: 0Pn4sY nY fY  P H DPUP @SP'@P#OP H @DP pH@HHsY@ H  nY fY+H @(0H0$P& ,Q@?H P00@H 0ఀH @ H  H@H HHLPLЍ   0H-@ PU0P HSIOP!0@- \ s\ 0@T sR nR fR 0S00 A- pW `@`pW P`P sP nP fP` P` `M0H-M@P 0  1ZЍ0HЍ/K-PLp@P E@P @` `(8 H0NP* `p Q`   p@Q  p岐Q   pP p@ @,@P ,@(`  `<@P <@8`0 `L@P L@@HP PA@-0@@@@ @@0 @DS @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B  A-@pP `VP  RP!PNP A pP8  H-@`PpWP QPPMP `  P  O-DMp @ P  ,P ^P00\P`00V I<I|!P@|P@P: DЍZ P: 0 T P:d 0bPPPP `< P`P,PKMPI  PT<`P$Z5 @ PA ` ,P> ^P00\Pp00W `F2``P,PMP  PM<`P ̰P R<@RRR@RR R0RRn `FYP RJP0 nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- @P+ PP.P, 2PP(P! K P P"P PP P  @PPPP P P P PPP PPPR0Ѝ0H-PU@``P1 Q},``P |p` `Q  W|`pQ  P|37`2`F``0@-P@MMM M$M,MM Rț /ᨛQ/ᐛ4 @-Q R$ R R 0S4?0LS 0 S00004p@@4?PT <@$0@-Q R$ R R 0S4?0LS 0 S00004p@@4?PT,04 <@$0A-P@P P$ RpW P`4@Pv0V&`v`fVP8Q(P(` (2/(`8 P $PP Q4/AQ 9@Rp 0 4%04? ,@0@4@ @p <@@@$@@pP T @@@H-`R @1P8S T* 0PS(00 0$+P$(3/P `p8`@4nP P$ (2/`ЗԖH-PQ @1P8R T) 0S(00 0$+P$(3/P P`8P@41P p$ (2/PܖH-^ 0S$0S\ 0S4?0NSQ q Q@0 S@0<0<<@O-lM`Yph P $PPUhPlЍ P`4@Q \ Q + 4 / 4% ` ??<P B, \ / t ( X  p  D @@P  D 0 T$@L`\P4 @RX !|8HX|$p @H ( <`$ | P P XT*[ T 0KT*S T0@K 0T0T*X[ T KT*R T @K T XTXT  X T*X0pS T` CT*R  CTR  CTR `0CT`X0@T:X[6 T KT*R T T K Ry T T K @TT*X[ T KT$*R_ T @K T `lXQ.:`Q08< XA p w:l(X PpA`G P 0QL`<88l`H@LTXP@PR H0S*` V p`F0S:8L TX!^ PNHa Q TX0S T 0CT*S T0T  X00CS T0T  X00C{S T0 @ 0T0X@Xr XXT @+X z!P2B@PX`P  CP`V XV`V`Vk T  H@@ p PTNHH@@L`p?L`XUP  @ p"D@0?,PQ:P N@:XT[ TKT@  AG pPp0`Ph  `T 4 p:X``pp@CL`Jp\T8 1`T*XT0[ K0 `S:<<0TX@ 4@@X@ 2&q@pW-pT P  @X@T p 2&A@^DQ@D⪡QL`<8XH@p40G:岀L`0C:@ /Q>Q    Q 8P R R 0S/$0S\ 0S/ 4? BR $0/A-M|P R $ R\ PЍʟ R 4?0BS0S@@T:SRl.@ <030<  P0b 0P!@ l@PE`0,@p0WfV03ST*@Q`: l,0 @S Q@`PpV@PaQp3WPT*U:PlPU  0A  PKri @,P Q0P04P4 PPP``0?pPPPTPP<@$`P lmQ R/$ R R 0S/4?0ASA?Q@o/K-Qp 0`S@$PPU P4@PT (+3/pP 8P ( 0( 3/P$ (2/0 a *b ga Jb+*AJA AgA4P@Q :o-QT04%A 0C PT pYA4p ( 8 8Q R/$ R R 0S4?AQ/ / R 0S/$0S\ 0S 4? BR/ Q P /Q OR/$ R R 0S4?0AS/ 0ȠLQ C0QD0D0A /Q R/$ R R 0S4?AQ/p4@@@/O-MP`80R 0` C C<4 @P0PU0pppP[ 8PQ0 Q, Q( Q$ Q  QQQQQ QQQ f U PV U@PV6p@Q/@Q+@Q'@Q#@Q@Q@Q @Q @Q @Q  @Q @QQ @UP1vqQnPQS2JhQ6QcPQS+J0,`QQ`PQS"J($`QQ`PQSJ `QQ`PQSJ`QQ`PQSJ `QkPQSZ Ѝ(Q0 4o,0$0 0R0000 0d <0@0R pW p`4P P Uqpppp 8 $p 0,(`40P :W``0C`00 Dp, ; 0`@ D000 04P$p`(`F`0@ 0  TL <@T` V \ D T*0 J pAQ 0 P:0  0@p  P0%S00 018C!! `Pp[ @ 8 PPopD U@P [80P vs ,s p p O-TM{ a04P Hp0C,@0G0GX\083LAP,` Tp P@@<4 8D0(`$T 0P @Lp a @D1V @\&qa@D1V  PU\* ^:Y< Ⲑ T040@22@D 1T 0 @00D ` Q @D1 @/%aQ@D1 `T *PPU*0@P@P@6p@D N1W10`GV, R 8 RI Ri*0F$  B`40YVPp`: ^ 50G0 0 0[1:0 pP` k R N 4R80 NPPg` 0p`FS PPYm pI0WPbc( Y40 B<VPp]: ^@ 50G0 0 0[1U: P p0`P k R N SKy40 BYVPpg: ^@ 50G0 0 0[1_: P p0`P k R N SUX pY : I Y    Y  Y   <P< p0P ` PU ) p P804 `V  IY#S#: U 0[1:  k R E S P p0P ` PU  ILPY: P0 R0 L8 IY*?/  <PpH Q/ H`0Iq0E 0P0C @ <TЍ<o H-M  00ЍO- MP8@P 1P<8P  Ѝ@U p 040S(\20 0$PL$xwWpGwpgJQRWWXJ XYJYo(&3/W@ pP `* 0qk  (40p2tP  P`,L0TXp @ 0   ,QP @0B 0  pWpW   0 LQP$ IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW   0 LQQ0 p 0 00Q ,P P  [$PF  P- , R P0 @0  0BpWpW  K 0 LQQ0 p $0 00Q ,P Pg,P7   R!pWpW    0 LQP?00 0 0 "$00  ' 0q pWpW   0 LQP PtPg P^ Qe Q>P tPtP9 8l 0` 00 00t0l C 0tQl\ 0R8UP @C l\_ pWpW  h 0 LQ)VP_ P t P*)tPV P P`l2`lX- 80 pSW) W W$ WgWfWeWdWc Wb Wa  W^ X>8 00 00 00t0l C 0tQl\ 0R8UP @C8 l\ pWpW   0 LQk      B! R R` :0000B p0uppp 0uppp`  tppGl0tp p`Ql-D 2/4V= V\0l P8U BP l\@ pWpW  I 0 LQQQ P<V V6  0p V L D ptP\l pWpW   0  QLP7 VQ60Q7 000 "$00 #00 3 00  00  "$00  00  (ЍЍ9 00 < 0 000 00"4000 `~ pWpW   0 LQP`oЍ  @0 0A @0 0P. \PJ8l 0 B l\4 pWpW  = 0 LQPQ(ЍH,L-@-\ @T$@T^ @ T9@L8T;AB\*\|0 p@-1"!4P#4 P%0U $PU^S p@T9@@8T;A*PBPP% P Pl@ T@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- MP 6, 0AS00Y @ *R:1\lp B`pGoQo`1V` V *0EV ?o 2 RiUg Ve&%o ᠒ 0z `@&@@! @P @T@T   0 LQW W8p\  `F\ P \, C0 PV   0  B0t@ `R' , V&*<l@P 80Al0 zlPP8 0 Ckl, l@V` l 8AX,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l 1lP ,R@ T@T 8  0l, l@T@ p *pP,0qB\5/WA 1R0Q*pEQ0o0`r0S?U= 00S9Q7Q@@`U0Qpp0o`8 0 op\P\@T@T   0 LQV` ЍA-Q`P P$P@T P9 @8R;!"P*PU 0 b *`J` gb&*@J@( A0 0gA3/`P p&p= 0 (,P3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ L DD  !| 00 `$   B`p@-P@P@T `@ P P 0 0 0pO-MP tP tQQ P P:8 lH` X@4 TP0"Dp @H p0Q , @ BPp`Pr: @l0`pp`0C0p pd```#d` C;P<;p0 S0CR @ B C`V @B@^ X+0=r<t@`T !`FRPQ p^ N p尀PX%P@Dp^ @ @`pPRP`b` PRP`b`1P`Rpc # `Qsq1#!@TcJ$ Q 1 R `pPP`P `F pVPʰ DЍO-M6v`0{Vp | @$@p^*@\" Pd$pAඐb@ᰂ`dW3`p p!`` $`pf@@D9ᰂ q@$PbpEB`gU`PP@P!`@@`$@Pdp@G 00H-PP @m"P/ 00Q/0H-@`"P" 0@-@!@L@-@!@m@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@(@-@{!@M@-@u!@o@-@o!@~@-@i!@@-@c!@@-@]!@@-@W!@@-@Q!@@-@K!@@-@E!@8@-@?!@Y@-@9!@sp@-@`P P R!@ pp0H- @P P!@ 00p@-@`P P +!@q pp0H- @P P!@^ 00p@-@`P P !@J pp0H- @lP Pu!@7 00p@-@`YP P @# pp0H- @EP PN!@ 00p@-@`2P P @ pp0H-PP @(!P 00p@-@` P P @ pp0H- @ P P!@ 00p@-@` P P i @ pp0H- @ P P @ 00p@-@` P P B @ pp0H- @ P P @u 00p@-@` P P  @a pp0H- @ P P @N 00p@-@`p P P @: pp0H-P] P @f P( 00p@-@` P P @ pp0H-@ P P@ @ 00p@-@` P P @ pp0H-@ P P @ 00p@-@`m P P @ pp0H-@Z P P@ 00p@-@`G P P \@ pp0H-@4 P P@ 00p@-@`! P P 6@| pp0H-P P @Pj 00p@-@` P P @V pp0H-@ P P@D 00p@-@` P P @0 pp0H-@ P P\@ 00p@-@` P P @ pp0H-@ P P6@ 00p@-@` P P @ pp0H-@v P P@ 00p@-@`c P P x@ pp0H-PP P @P 00p@-@3`F gPtGPPPpp@-`PP @ BP pp0H-PP @Pw 00p@-`PUP @ Pd pp0H-PCP @PS 00H-@`p aPaFP+PPTp@-@`P P @& ppp@-@`P P @ pp0H-PP @>P 000H-P\P @,P00A-u` g@tGPPHP p P pp@-@V`i gPtGPPPpp@-`P$P @ ePpp0H-PP @P00p@-`PxP @ APpp0H-PfP @Pv00@- @P $ tA-P! @ P Py`` `%pP $ p=  0 0$ @-P @ @Um 0 0( z @-P @ @?m 0 0 f " MK-M$P $@ 0pVPJ` YP  0PV pЍK Ѝ/E 0 0V i  H-P`p" 0P @`P!ऴT `@ h!@$!lN, Șhhhp@p0H- R PP @Q! P  ,  @00d` `0 0LH H0 040 00 0w S / j 0H- R @PrP  R000H-P<@P /P P PpP P>P  0H0p@-@ PP ` P" `V:<xP P PpoP P/gP >bP  p@\pp@-@PQ@ RP> @;Q <Q >Q&E`P, g&Q&:`P! a4P m/P p &'`P l!P tP ;Ppp`p0H-@P<pP| P P P Pp PU:<Pg pPb lP] iPX sPS tPN  PI vPD eP? rP: sP5 iP0 oP+ nP& =P! "P 1P .P 0P "P >P  0H0 @-<@P+ /zP& puP! lpP ikP sfP taP >\P  WP @Q0H-i @P  \c P P 00K-`@Q Ḷp@0 PCU pP<Sp0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP` p(`>PX` P\ ኉P/Q PY $>Q; $>Q5 Q PQx  Q&  Q@ P A=R(  P R0!,PP"Q qR  PR "R  PP>Q  0 0* 4 R p@-@P&U U[ <UT `Q TT*P@PaPEUL`QD(((((x((((((((PpU% mU3PpUP;U.&P`PtUP;U&>P`PtUP;UR``<pP >P `< Ѝ` O-GM  EF T 1/  0PQ aVk Q 1/P@siP pf T 4/ 2/pT 4/W KiW WqqW) @?i@Pp Q 1/P`CiP P  2/P V 6/p V 6/Gߍ 0 0 0 0  0 0p;l l0 0XET T0 0XBT T0 0w H( ' / N S r j ~ G-Mr@PP`P>. p  Q:?E}A Ob@@ᔎpw3  DP$mp Pp k qM@ֲP @Q/Q ?@R 9@ۍ/Q @P*T @T P/Q As Pp1 ~8Y G-M`㸡P-P @,p ptp E0e ``V*  @Ѝ    0p墜x  Z 0㌜p @-@ h@ H-gP 0 0 i x P/ O-KMp( P@$U QTFGo  0PE5/P JI/ 0`P $A(qP P7 1P$!( P Aq$A(q Q U JI/0P @J_Io($  2/ 0PKߍ 0 0f //@-@@ H-M  Ѝp@-P$$\P `Jp(P @ e A>P `, pppP\pLH H0 0&AA@@q@@`@T@$@ H-M  ЍH-M   ЍH-M  Ѝ@-@T  R|o /Q 0 S / !@  ! Q/ q3/@S"# Qr3/8oP , 0S0! 0/|nP , 0S0! 0/HzD D0 0P0, ,0 0GVV+   ʲ O- M@P Q04Q8 4@T ,p`PP ᣳP5 `P@D¤Y@PGtlP& ` P04Y0p,hP# @P" !  ,@0pQ @W3c)`,V,6<V0<2FO,@0p 4,@Y Pt DpUC PEp I!ᙝ4,< 4<a@+<@@4@<$@V!P  2x`ࢢP `p P;* *|@Z Ѝ!Y4,< 4<` ТY( `^z 0 0S 0 0J 0 0A 0 08tUp p0 0/PU <$H$$|#RH"T""!! N 7  ˫ J P 80 SQ 0 S /PPO- MP @D`Q Ѝ8.4P* ,婰 PqW& eP PIQ0 S `C!ᰜ4<@4<:8 ЍODz@ @0 0ᰴ,I( (0 0᧴TP  / C P 4 0 SQ/ 0 S /NNP , 0 SQ 0S /NP/ R/xNP/ R/PNP , 0 SQ 0S /},N0H-PP @P  2/P P PP00A-`P @@PP xp$P,<P ApP 0p A$MG-Mp@ PP 08! 7P (P 0! )P (P$P  Z`Ѝ0 P P*  YP  `RP H 0` P ,K( (0 0᫳-  j Ѥ H-Pp@P+ `SP  2/P P pW ֧ P *&8P4P0H-P (@FPa00գ p@-M@004 R;P,S Q R& `V8 P)  0Q Q 4,A4P. `ЍpQ b 0 0$Ѝp`Ѝppl l0 0XqT T0 0@a< <0 0{  # ^ z ۢ V ף H-4Q , 0A40Q H^@< <0 0ڲ($ $0 0ѲS f / B + O- M` 4P H apP P C@P  Ѝ   ЍOP P`P < " *xVj Pg<PC4PQh,@qW:  P0U. 㥰PC P PPEQP@T^  P P  bP  2/Pp P p@ P| @T: Apr(z$!$1 0c 0 0 0 0 0 0tp p0 0| |0 0A DGdF\F  r Þ  ! / Ϡ S 9 Q b K-P? P`VA@V U1 U1 44P pP 5 , !$ ,,P  Q,Q 0S pu s Qp D}@ @0 0|, ( (0 0sCۜ  ɞ  @-@K @H H- H , pH-$ `XdAʮǮp@-@P ``QP P Q `< R4 Q ,  a ph{d d0 0PcL L0 084 40 0XA/ Ϝ ^ ֜ 0H-@P P L R< 0H  0 0װ @G Ҝ @-L@P*w  0 0ὰpߙ 0H-P@P dSP P H0H0  0 0ᘰK ל @o/K-S" pP`@W  @P   0Ki#  0 0`k n H-Pp@@P `W  0P  `o`>H-P@`P oop,W@PP @t=H-P@`P oop,W@PP @=H-P@PpQPP T@ p`P  @p<A-@P PQ P`@V pPW P  PPP (`O@P ,<;Q/ 0 S /H;Q/ 0 S/;H-0S L RQ R0SRᥥ:H-@P  R  `PV U JP  pብ@U D@ @0 0N,( (0 0E:f B { Q/ 0 S/9P , 0 SQ 0S /G9H-^ 40 S 0S Qvo89H-M$PjP@P* !0 >P P\   V`p "PL  PF"P 0,!,1 0ٮ 0 BP1 `pP+ `0 2P Q IP P_` pPP \E` pMЍV FPGx ( ; zd7O-Mp(`  P@pW=Q@10 A Qh U P V T0* A U UP V P * A!!  P V P* A!"  V T7* AP y-* pGZ@X$ pЍ R U:0p0@ `BV  =R p0`0@ p AR<Q Ѝ @-@P pnG-M PG P VPx Z%:܁`p@P &nP7 $ fP/ % ^P' ? XP! JZZF pZpp:0 S 0P1:p  `Q CZ  ЍGP@`- J0Q0@ p@P`' P % P Z=& P = P ( ЍGSЍft~ 0} JH-0S RR toP P@< <0 0($ $0 0f  U B 0H-@444(T$PPP0 @-@T  Rt0Q  0 S/P/<0Q  0 S/P/0P , 0 SQ 0S //0H-P 0$PP @ 0  P |PP 0h  P XPPTTP040 00 0|\ \= v p@-@@@P@P ,``p./0 0 Q [ ' R ,0 S/Q 0 SBo/.0H-@#@P 8PPPPP,

{ #{ ]{ { @-AT\ T%@QARS ^ GDQ B@R S ^  Z 0 0yy z z G-(MRP@U tP0  ` p  8P _PT(Ѝa i     /     / 2/ / /     / 2/ / /     /K-(MP@`PP(ЍK5T*$P-P (Ѝ 0   0 B  ppdZ P QPT T (ЍgPQ @/@-@Tp00q@-@P @-@PH-P +H-P +H-P +H-P X+H-P ,+H-P +H-P ۦ*H-P Ц*H-P Ŧ|*H-P 㺦P*@- ?\ʴ0 @0!0S @ @T\#x @ 0 R @ 0\#HT? #- ? b ,0 0!0 @*X**  /) /)/)@-@P 1/p@-`H@PP R TP kpp(/H-@-H-1H-P 20(@o//0H-MP@p8;4 40 0v HPЍ0r r r @-M@pL;H H0 0w DqpЍr r r 0H-MP@p U U U d:` `0 0aU HjЍ0Ѝ0Or r q @-@p08, ,0 0?^B @M r >r pq 0H-@PP(7$ $0 0)$@(@0q +r ه 0H-@PP$7 0 0(@0q $r 0H-@PP$7 0 0$@0q "r = @-@PP;L L0 0, /Og* 0/O << q "r @-@P ( 7 0 0ѣ(q q y @-@P $ 7 0 0ྣ$q q - R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@  P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P8UUE@33C @ @ /  R0H-@PQ9!1 0Ģ  @  Q d8@HHPHXHtH|Hpc? b Aa-lsww!- r- Q-QxsSw- r- Q-QxsSw-r- Q-QxtT  0n In G-P >!1 0N yP( p P5  pՍP-*Ȁ@}`qPw`@pW   }LP =P qP껣Up@qPT}l l U 0H-M, (2P$R0H PD@P<80( P @u@pn  np t|d xt]p PPP A P\oBK H D?@QPr-P-d-0-e8 0 Pqc-U 4P L@ gsp*P L  d L@Ѝ0a] L T 00O-MP@PH?D"D2 0_T D "P XptЍ`P+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0b@I" 0ꯢ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qi Oi Zi _00O-MP@PH?D"D2 0໠T D "P OXptЍ`YP+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0徆@I" 0  0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qtf f f _p@-M0`(04@0`,@ 08PpЍpXO- M80`<@4P P*K!1 0@p[tMp!p1 0WpVpT D#P:P<ꃡ`偡D0  _@xP tq`P Q Y:8

h`瘨 z Y(8 0J @@ EQ EQ@ReX\ P 0Q R``k0S qQPq`PfG@' 瘇嘷B ``S0q q@-VPPPB =2PPz `@{:V pP+@o P WV;Q :Q& Q PP:PE|`?`v````Ѝ| z pFY@d`&`6 0J pE  EQ EQEdX]\X P 0Q R``k0S AQPA`Eې`PUy @ppPU  FPP? t  0S 0S Q@Z, P :PL  F40$ Bp``d`iPI P_@00t RP$S"  @P:POQ -P+P_ZP :P?`. @RbSN p0V:P@@T @@@T|t"P :P\`W z<4P:PL `-P+P:`:Q :P?`P!$20 P P  `P``@P@ `P:P 9Q 10! A-P+PW#o\ \ \ G\ \ \ \ W\ n\ [ _\ 8\ [ 7\ #\ 4`T$ĩt $ [ [ [ tp\X R 8 0ԩ<(d : \ D u6 , 4 a6    ؤȤX GY Y ȢĢHd9 h]7 Lttd 6 8 K-@PQ/ T7 # P; pp Q1 -R"` `p܂Wp6 -W00-pS:200HRD"D2 0T,S("(2 0pW $` " `p::W .a--p``׎P pюP :Q.Q `:P  P9a! 0Q0P0`P8(?PP:P P 0*:P:P ?PP  0Q Q lQ Q Q Q ؜<   JP \\  ,,( 4O @-@P,/( (0 0@ @ sO O @-@P(/$ $0 0,@]O O O H-MP`QP3@aP P p0P 0PPP PP2P ` PPꐛ`vPꊛ`pnP僛`ЍhA-@` Q0 pS P1Q*P pE⃚ Pp pAWp ẏ Q  1 H-Q Q Q-s& 0 0psAQ,T  0 0YϠq  0 R1 R010 aM M M M ?M SM H- Xf*0 X8p@-@P`P844 40 0Co0 p@M`L L @-@P0A, ,0 0, 0@ML CL < 0H-@PP864 40 0o; 0HMK ,L @-M@PD0@ @0 0 0hPЍK L L 0  H-P@P`/\ \0 0p 0UUa V`qwK K A-@`pQ PTPPT fP  ?D 0PpB,@HO-M@`p^PU( ĠT (VWp` @ @V@@V +P \/ @D P $(,Ѝ Ѝ4r!#/H-R @P`pw0 !#3/p pW@T@ /0H-@PU 0H/0p@-MP@P U% 0`P ,P  &$P   oЍpD;@ @0 0 U(<$ $0 0H H  fH H H 0H-@P< 0 0P 0P @ P d0 P  QQ$v0h 0eH H @ p@-@PP T# 0`P ,P  㶍$P  㯍LopD8@ @0 0T(9$ $0 0^G G  6G iG F 0H-@Pl7h h0 0㩏P@PTP0)G ZG  MH-M  0 KЍHЍ/MH-M 0 00dKЍHЍ/@- MP @Q p  @PJtQhLHV@  D ! Ѝ F F ,P0E@/A(Q///F +F A-8Md`Vp@PW4 T 0,#,3 0T U #3 0Vi`:Pu 4Pq .Pp (Pl "Ph Pd |P` hP\ T PX @PT ,PP PL PH PD P@ P< ړP8 a`<H< QQ `1Q `2 ᚃ)0!0F 2F CF RF ^F eF sF ~F qF F F F F \ D H-MЍ@-M@P@ЍO-MM`pPV : WB ДZk%5 0؄Yl%5 0ו%u@p0 $ P 0  @<($嫐P @児 0F@pi$4 0କWj$4 0࢕Q D,@͂@DPA P>aPWR ZZ Yb t@ ;lUP9tP6 0 pST x0 pJx7{pHPPL T | %g@ 0@@PЍۍS?p l@(z$#$3 0+Z {#3 0!Y_"2 0@PJpڄTwp|qp\Xm x|zp(P$t P" 2P# -Pt$A@Q/@!P @ 03t tt /P/PPT P L#HX X0! ,! 10  0  8 C +D C C D C D E D qD D  h i8z PC A bD A A :D A qA D  E D D %D C (D C bC vC B jB ,@T2p0$ ": << @< }: < : U: ; : 1: ; y: : ; l> #? ,> > = = ˘ ; < X: p: P: @-M@P@ЍG-PMȁ`PpVL: UB pZ!1 0kx@Y!1 0`t!w,pp0 p! P 0  @(@4P @ @' 0 05U 0 0+t@Q p,pUp 0@@LPPЍ&<5 N6 6 5 &6 5 6 &7 7 6 6 3 ?Z X@-@P,~( (0 0 @4 K5 Q5 K-M@P`T !1 0Ց Pp B`V AP A@ A0 A  A B A V&UpppUp  a @ `P:JVPV p ڲp)3/$.@A*@ `p Hp0P @ P(# PЍ;pi4 4 4 A-(M@P`pP# U+ T3  P(0 @ @7P2pW)  0@5P# pW  0 0/Up]l l0 0%TT^P P0 0(Ѝ1 j2 n2 1 B2 T2 1 2 :2 O-MMR@`XP"2 0Yg [o T!P  0@pMWg dP] < ;pPv<Ps  @+}+}Ps< < < P/ @@p,H  P-G@p*\P<P/H$ X+!1 0[ 0 0vpp p  0HppkM xPPPЍۍ`:0 1 1 / / / . / / X1 6 0 F / / / / 0 0@- MT@ P@0 0 A ! Q Ѝ0:O-M ` ,xZ@<%<5 0BX0 T8 - 0 zP PP@  R PK - 0bP ؃P  0` GLp Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P,!P- @P-P P  0 \ !PP @PPP Pp  0 F`   %-P +P&TP- @P,T" 0`"*TP! @P3T" 0`` jo `[oXP p x XP4 - 0nP AP `K@Z Pߍ8\1X X0 0ĎT@< <0 0ຎ (- . . %( ) ( ' v) ( <@- MP@P@   0 0 B !  Q Ѝ8G-!M⸡`PV <!1 0!@ 4@;D@@;PI@; 4p@/P=  P 0 C0@4@ pp@>P)P:@;`pPU  4:``P ᗋP@ ; \0\P00@<P!ݍ78' S* ' L{  ) K-8MM⠁`@pV4@ TH P3 43TP ƄPI P0Pp C0P G 0 PֈP6 `V0 2@3pP`V%  42pppP圄P ,P P|x x0 0T`:\ \0 0෍ Pよ4P8Ѝۍ7$$ @' $ # ' !' Dz O-M@`PP4C0"02 0AJ0p P  0 WO* 0 A Ra ARWAA AR7A Q P A BR:P P @ 0aX4@dL\LLLX 2 0 0 @ G Z :` `0 04 0GA Q:} 0 0 PGG!U@ : U:HD D0 0 PЍ& ' -$ a% % % % ?% m% $ $ K% K-(a@`p?PU ?U` ?`# @0 ]`P >U.:W$ .P p?0P V*pW:V'B71@4P1*p@@V *p`ppQ:,?V35蹈5p p@-<`P@`(00 @pd0H-M@P`3\ \0 00P4@4 @P PЍ0d# # e up@-(M`PB 0 0f 000  @PP@@Q @` PN$@ 0`P@(Ѝp" # '] " gO-dMRXP` YY"2 0-0p`@"F  `@8RZ @  0@YPn ,P`p  ꜍  0@A`PU MP- X!1 0  0 U@P,@p@PXXY Z  \@@]PP[0 pXSP(P$PF (0P,X 9,$-$P( HPP H6PP `RdЍ5(X$ $0 0YWNX   ! L" +d <" ."   h ! /! DA-0M@pP% T- X5  000  P``P?P p 0`p0Ѝ0Ѝlh h0 0=TPL L0 03X40 00 0)0     C`   G O-UMR`PP=V` Y"2 0:X P 0PAPp 4p`@( $ ꄌi 0P)`PW 5P/ Y!1 0ˊ O $ 0( @;?P40HP@Dp pp@ 0PP0}P,p0 0P4O 4,,PGPPGPP PRUߍ4($ $0 0mYd[P  W T  _  } O h - ^ ; ܿ/~A-MЀPpU W 4 0 0@W!pP `Ih @"2 0 P  PЍ74p( ? C G-GM`PU lDN@!@1 0+!㝾P7J\+`ᐾpP P\@ 2+ヾpPʄ@ᗾ뀋W@JY!P \@l p"2 0 P  lPGލ34) h m >~A-pM䀟`pPVlh 0 0उ@Ȕ ߔW!WpP \Pᦗh @"2 0 P  lPpЍ3pꬼ   2}k<j<@-M8@ 4@v 0wЍz 0 Q/p$/A-MЀPpU W F 0 0AW)pP `uh V@"2 0d@ p (PЍ83p,  G {O-EMM R@P㦽@PjJ<`8u pZ xp|X  0ZqG W+  RUP⠰ W+  RLt@P  WpW jP}fPTP@P(JY)~P @ T p"2 0g@ p  @( WPP@PQ4PP@PEߍۍ220dxyH-M 0  jЍA-xM䀟`pPVt 0 0o@C ^W)"pP `Ph U@"2 0d@ p (tPxЍ_2pطL  ( ^xO-M@Q T 噹`傺E,10 H0 0b'8  PTp pb>f b L@ @\ c9f hdf PgX`c!`c! 6ot`ea@ba ga&4_`ga&c10`a@ ba&`lP4_=ba&gqpaa 0@`a&pP4_}` p`a&b! @-P `c!a!"4_ `a!"$@g!c!"P4_ c!"a f!(@ g!" xP4_g!"c1 `1 ,@f1#P4_-0 f1#gq00@=P pa1`1#4_0fa`1#4@0baaa&P4_`aa&`=ga 0ba&P` b&8` 6oPa

Fn1a1#@#0p$l'_'pP?P`)lq0 0o&Pbq᡻nq'=o&`p'پF_`,t@a`q 0bq'o&P&|Pp'Ona@p@ `%  xo&}O&@唀 Ob!@@cqh@o,`q' p'o&@ aq-cq' &p'O` @ @ dnqaq'o%p'o&_&`` |POc1<@o&@0bq=nq' 0o&@p'o&``Oa4@8@ `o$l@b! !o&O&@o@nq0`,` pco&p@`! !o&@o&`_b!( $P/"@ `l/"c!/" !_`(P@tP g/"xPl  /"/"_c!0 ,P/"0 P n/"g /" t ?`l!80 0  hPan ?#P ?#?#0_@g1dPP b1bqi10p%''`p_aqhPDP0iqa'%|P!'_'Ponq`l poHlP0`b`a`o&Po&pPo&`Oial@ga`agA@O$P O$P$cAob!D`caga @@`-O$ xPO$O$@o` @` aa ac o Po&o&`gqx bq bap< t''pc1< pibi104? ?#?#0a4 @nin1|P00?#P?#\ #_Hg1ob!0` `` gn$0?#`?#?#0oi1`` a1`ag0(? ?#O#@n1( b1ba,0?#?##g1, f1 pfbP80?#P?#P#l1_a8P P lfd0?#?#?#p0_b!dP @ glg1tP0?#P?##|_f1$P a1 agPh0?#P?#P?#t0ol1h` ba 0ba l`o&Po&t&D`嘐Ogqjq @bqjA pO&` PO$@`$OacqD@jqcApO&` xPO$o$`Ob! `q@@cq`A-p@ O%PO$P$ O@jApaA} aq`qp<@O$PO$O$x@_c1PP04@bq=aq'_$p@ 0 p'_%O%@_``A 4PbJL P0@lqO$|Pbq'p'O$$`@_a0PP pcl!O$!O$O$@_b!R/u0H-MP @yP(JDU ?P :y ?P:yh P 1 @ P 1  [yЍ0`u4u/ Mp@-M@Jy`0T` P P P J 0`0 PL  @@`Q Ѝp@ Ѝ/\8H88U?u0H-@PPb!1 0wI\ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0 O-LMPP @0<8 40㜫>`< 㓫D D6 @x@xPD00@0@` ppPaIQ dddddTdddddddddddd\8' +IP =YP|@ @ `  0 DP`X@ PI[p  @\* p, p @1I GP#GP#|#꒰IPpH HwwPDH @D  0 |D=Y@+Y @V \*p,H H ZwwPDH@Dp\ ]% @5 0vXWD\F:H H`*@w@wPDH @D0 @[p=YT p(=Y@\* pH HppwmwP|DH @D  0 DV \*p/H HEwCwPD H@Dp\ ]# 3 0u XWD00@`YZ ,YPw& w HPH@wT "PP : U*D@T* v@ v@ LЍv  j`v`vPD @@D@T\]X!X1 0*u P+-X(o$!$1 0uX+- 0p P 0UP0V`0@+TXTP`@@`@+T XT -T@`P@@`P@-T ATArF 9 <   H 8 H-P`p@P|]x!x1 0tWW/XGQP 88888888888888x8888888x88888xVp & +W-WVp=U -U +U =W -V+p@ 0H-M@PPT:P P0 0Tt   0P@a`pЍ0Z m P/P   @ @ B/P//// / ` A/ ` A//// / a @/ a @/A-M@PP% T- `pP@ ؁@P I`pp" PP P`rP. / `,LH!H1 0sT0,!,1 0s\uP`P ; fdMuPЍ/ pT P Q @ Ѝ ]T `PpL H0 0y9ᠩ t X W d<. ,//H-pP@ehg`+dgP V 0PㄨPZripPl   V` ᕨp PtPtPP<$p@-`P@`V ٧`VrPѧP 㘨ʧ+Ppp@菨P ㈨p@蹧p-G-M@pP 0# T+ P `P= @ P Ksp! PN `rP-. P+($!$1 0rT !1 0r`tPP @kiRtPЍ. pY `| Q @ dЍ b  ;᭨ p h S a@++H-MPP,(!(1 0sra`P A@T P p@T P P sЍpb/W Q  lP  D`psP ḾvЍ Z ^ _*t*PH-HMP`P> 0 0r@0 Ỷp pTP" @0 ᭶ppAPpsPP 8UPP0PT jPHЍ 6 > O-DMl@`P@0H8D&D6 0qppthP$9 & 6 0q0 ?&Ɵ 4U PTgJ0 oT á_V] [@ <r4` 0ڭG( QG@d`㙰",S HOYc0㙰(0` A",@ $d`$,  yd$, @ `(0Pp 8@xe < QDЍZ IQ 6p@lPUA ` @0  $mpEWp#W  0mW  0mW  0 mW  0mW  0lpcpQ d  0 @#:2`R@2`@[ lD DЍ P 0 lP p2  0lP p'  0lP p  0lP p  0lP p  0lplZ5 $0( S !P@> dd PNgfffFEUWTEH!00 U00 02?,pE8ppA4 * d 0[lP,`U U6 ' 0  2d 0Gl,`6' x 0   80 4] PDЍ(  - |`} @ K p H-MMP` @pPV @5   p R `P:0S\0 90`P* 0\S S Ѝۍ$ 0 0o " O- MM@P [#  P :jq{Q}PP/ {Q`"2 0o["2 0oP `{P[ V PFp eE  ЍۍO<8"82 0oV`pR p zR{R }RP @[R 0]SSSppp  cVQSP@`` ZHzP ,P [P ]QQQ  {P }PV `FV Q * P: 00X 0Q1: @0 @M a@TM C@\  R: R  $ Ѝۍ, x  P > d O-TMM<[ P Y# [+ Y3 p~P `  P0S/S, 0Qpq$4 0nY$4 0n[pl$l4 0nYTP$P4 0n pQF P ;HN ⭴P1HP. bYP  0S  0 R! R  b P 0@0 BS`Pp `pꅣ;HN ĴP `p `W PPTЍڍhp*`V*Q WL @ @T   RS QUQ pP0E EQP ?Q [Q@ᰀ!XQ 0 ]\ \!X[`Fp  p qp1P!X @P  P0]R r ` -Rp- ]W `P`w  3p`p pY% 0 0mP 0N+JpPgP P  p P\  pVp S @`X0 0[IQp α 1 H \ 2 l  έ p@-@Ptp p0 0mPpPU aPU` P pl H-\50? CR,0!|Q 0SS *SO-MP`P U   0 ZfP ̷!1 0 mU!1 0l ẳPK PP  m@@PpᡳP V T G 0 0lT  `W HЍ     P KnЍ[Ѝ| v : T N E / 0H-P@P U 0H'KD@ @0 0lU(E$ $0 0lꀨ X \=O-MMp`@[ F TN ؔWT Y\ ܄Q$ /p@Q 0U.*qq0 QP/Q S/Q@pT*/Q Q[? YG [O  -  Pus"2 0lTm"2 0ln"2 0 lYo"2 0l @  PCL"L2 0kY4E0"02 0k[G"2 0k$ 2/Q!   Q  :fm/T/P     0 \$QЍۍ   P0 P[qS!1p 0k!1G 0k 00   P @q( 2/P   PT*/G̦ @ B  * A X ̦  * ȥ u _ t ^ M 7 O-MM,0H`[U V] ,tP,('(7 09kDW '7 0.kTT&6 0#k@(`@lU$@ **`PP< PU:$` PW DTdE`&`6 0j 00   Pf%5 0jV%5 0j @0ՠ괐Y ,QGP!  (,0 pkP3 $ 02/Q*8 Q&DT/ % 5 0jP    Q 00+W @(J 1/pP @d :/P H` P, :/DP   d R00*  .RK   .R R .R R (@ Y RY$P P3 (, P I@ P0/3!1 @ P(@d, P I 0 P , .RPE"2 0j0    0 S @0P}$ 02/Pw8 Ps PU#  "  PI` @GV 1/VakP6  1 ,Rk5/Q$  (P0G0 $PI(ob$.k`/($QЍۍ`D`DC r ԡ Z <  ˣ ͣ  P š * \A` <I O- MP \ R " @2 0Ki P\:U Ѝ]* p `@ 00T3PA@uPT PFV:U`?T [T %    H-tP h 0dd 0PP 9<P,, T H-pdP LL<Q((X(\T (O-MMP섟 D@0 C+ C40笳P  t `⨔Tpࠤ P 4+0P  d OP  \ %P Q #P  \ P Q  \ P Q  \ P Q   \ P Q x \ P Q x@ +N@8\ P P UP _P  _P}  ^Pz  ^Pw  ^Pt  ^Pm\ Pe Q #P_ \ P Q \ P- @P @^PD @^P\ pP Q w\ eP Q 4 T! PP(P ^P  (묐P l@@Rw|@@$QЍۍ \XGQ FQ  ,"gUD lTB6hF} áß_k@-@P 0 0`P |P xP h ^PT44$| E| E M p0H-@P 0 0`P |P 7P hPP]P00440{ L{ A L H- Pd@0O-$M`p@P' Z/ V7 F` P   p `pP"X pZQ*Q ?Q<p/Pa PK .P_P\ ZC VW Z/PT=[Q \Q Q @#X p*Q"p *RX  p/R0 R0Q @ X A.Q  R pZ V  Z/R p/PV /SP @V @VX\\ ` 0^ @!@o/o"`p\]\4R0`pX  @@  r@OoB=r\P /P H P pX  r @R9 -PX ```\\ PUP\`X pppP PR0@S@ X qP+@pt `T[ @`[PVX{T!T1 0_Z<|8!81 0_Vp>p<P pP5 /RpPp.p@X  q`V 0  P/VP  p/P Pp$Ѝu u Qs _u u u @tL@-@P PT T2 P T 0( P 5`蕦0H-@lP[P X[P ` T0T00%O-MBp` @0 ғPP u_`-Pc``PP `  0ḓpQ  PM PPG p p  ` < .   0@堓p) X٨PP1   0pጓp @  0qP  `Z:p@@ `L@@`wu P ߍ  O-MBp` @0 APP uk_`-Pc``ႤPP `  0'pQ  tPM PPG p p  ` < R.   0@p) XKPP1   0pp @  0P  `Z:p@@ `L@@` P ߍs\   O-MBp` @0 ᰒPP u^`-Pc``PP `  0ᖒpQ  PM PPG p p  ` < -   0@~p) XὧPP1   0pjp @  0OP  `Z:p@@ `L@@`[Y P ߍ$ ` | p@-X`@P`R JP` RБP px p@-X`@P`R P` RP p p@-X`@P`R 2P` RP p   "MH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S@" QKHЍ/aMH-MPP@  00@  @@@ @0T 00@MР0    R   4p 00 4p0P  P0  hP0 P DP0 T  p 00 0ppbfotᔐ&$P"a``圣 pTh*@ @@@!@%@|p  tp mPP   cp V  WP`  P`J [|"|2 0Yl` P `Q< oF  `p_qvP$@p d&0%  `P \1% P `2% P d3% P h4%W VHPlХPP(P,ЍZ(i [i He e k%vh \4h XGH- g mg d ̀ "*  ( 'X|\ːm}p` ` ^ &P˲q`L8 {N<p2$p@-@`T' PU$ MD`p Q/R DP@Q Q/RP @@`P PF/R SVP@X/UT@@@P4``T ( ;l)p4 tx K-MPLP@ @`t,@UPP3:S0ϟ`PP3` p0 C=R Dp2 PW0@ Q. a0/RP06UPP30:RPP30 p0BA4QP8llW 0`@ V_ 0PUR0SP::SPN* 0PA`0SE0VC:9VA 0PA0`V80S6:9S 0PA1P0@ Q a0/RP0dUPP30:RPP30 p0BcQ^ 00@ S Q`nA R0V::V * 0 B0nAaPU0S:9S0 A 0 @ R0`/SP`UPP3:S0Ο`PP3`p0 C R  pt 0@ Pa0 /QP0 UPP3:Q0 3 0Ap@ Qp0 0@ Q `0/RP` UPP3:R`030 ϟ0B Ap R p 0CBp`@FP 2;PW @FP (;(ϟP MJ P50`@ Vp` 00Fs Q1 FR0 r0%pc#tBwpp#4#11C r  0 @ RR py P? 0Uϟp g 0@ Pa0 /QP0dUPP3:Q0 3 0ApcPp P 51ESr?dp0C+0A/S@`!0||`0@ V:T@`  V@0A`@ T T.a0 /QP0dUPP3:Q0 3 0ApcPpdl'@ R  51ESb?!a  `$@00C P \ \L @PUp9 0C\0@0S0/ $0`0pC W@B <̟P@p u P k˟  0  Sʁ pXEQdpO  MR`0 TR R XK@@@@@CR 0 R (k`` @ ˟R w 0``@rQ 00@ @R @ R @ R @  q9P7 p  j9P2  @b9P, l  [9P& T  T9P*   M9P%  @E9P   >9P @D` 29P @}D` &9P   @ɟ A0A S *@0A  p$(ȟ L`AVJ*MQM0a a$p( +'# pȟ  s   ̧p <ȟ  [ǟ V8RA 0``@( JQ> %P Ul lWEXǟ p< 0B0S  B  p.^I SI %!ER2?d a;QP.a! @QH \a $p( Ɵ Q JQ@ ak `P @ Q` ` 00@P*Q  P P@ P $(Pwpş H şzU :0@@@A.ap$(@@@LA >a $ 0p%a ! Qe  Q*%!ER3/>bK/)<b!qp'qqpWQq ""q R3$40 #0 A6Pu4 `l0pEPQ0"/dqaQ "p Bqpv AqA%)b8/0!bB$I"IqRBq/!B !b B AQ>%!ER3/>g 0K5)lB6#sP%Q7sP0UQ>sp'r6sp0W03b4p`gpA W B R:4 b0 G B 1 \%!ER3/>bK/)<b!qp'qqpWQq ""q R3!40 # 0C +pE0Q0"/dqaQ$ "p Bqpv AqA%)c Rx?1CqJ 0Q0 R00 "Qߍ9P8 )l5@bL6# g `@cr0W03P8 )l5@bL6# g `@cr0W03, lr(p< dq< tpHX  < < < U< =< O-M@DPTHPP% 0 P R `1 0Q1GV耟l S  P  1 P `O*` @*@ L  qq`F`P:@TP.OPЍ !1 1 u1 ꭥ@-0M@ P0Ѝ@-0M@_P0ЍH-<PH~1H-0M B[P ` X ؑP4 `P [[Zpp{p 0 0K  {ʠ 0 0JktpC Ѝ` [ ᜑ`P ) $* ( ( ( i( ( ( @-M@B(P @ " (0 1/`p) p 0`VQ <`VJC>L`p eP @`6CЍЀ`.Cp@-M@B(P H@  (0 1/`p, p 0`VQ <`VCKeP @`B KT`ЍЀB0H-PP4K0!01 00JeBP M ! 1 0$JP% @T" E P0P P Q P0厖 (劖  冖PU* 0 },P y4P u8P q0Hn% %  ~% % % 0H-(P@P>@[0H7H@- @@0[@*Ľ0H-,@@# /[P0ܽO-M@PF!1 0I `P0V ` xP-`p0V,p0 V& P`pV    ("` @P 8 B/o"k"0PB` @p0V`W Y$*U".VP@ЍV @ P  BQR Q Q QЍЍ# &$ 0$ H4  R  *4 8/4 0X\S 040:8 R РS /JxBH-P`@JH DpV   U$p@-@P`J 0A-p@`PP/ T7   pQ @ Dl(p \Vh h %VfpQ:pP P j '7 0HT&6 0H FnP{ 08DP\ht0F3-V ^V?V0P 0QTv (v _v   W@v P P} v z  v Q Qo =Q v#P)v;Q U 0@0 ̠ ^ Q+W@%0vp;pWpcSXb`a0 `XV^"w Q" `s dR0dS 0@ hf $ &V" ` Cq0 0K0A\  =V  9 20` `  F    Ptdȳ p p O- MpPR 7 X? @TE `  0PU> PEP:((U- PE@T P&. U PE} 0 0FX 0 0{F`U FH L!H H0 0iFH` Ѝ     ?  $\ 0  00~  zq A-qPpW1 /C!=QdaV P $QPXDP* V(`,1/P- V;  $PJ3@`@`P=RpWpQ 1/xpV@V T  0 $PX@0l,̈I0J2A-qPpW1  HQdaV P $QPXDP* V(l`,1/P- V;  $P2@`@`P܏pWpQ 1/xpV@V T  0 $PX@`\G(`HZG-@P_ `9PZ qPpW  U` /C"=!i QU ZBPB @P U& P0=rpWpQ 1/U(ˋPP   :21/P $@Z $41/P tFxlpEEG-@P_ `9PZ qPpW  U`  H i QU ZBPB @P U& P0pWpQ 1/U(LPP   11/P $@Z $41/P |Ă$DxxCCG-R`SPP 0/` {O`V @@ P Ő``@@T p P l``` \0Xp T@0p`@`PCL̀(B0B B,BK-R@SPP 0/``V ppGw P o``ppW `Fv P Zl`\ \0Xp T0P`p `P@AxXh@@@@O-MMP `Q bP P/P P 3E/E~ &ypu 7P PPi ``p/P PY @@/QQ.P`T T.P  PU P/ ^9 Syp@  P /Q P G Z P z/P P P? #e wP"J @PZ7  P0 p '9p'p/P  P Z/ .ᖏ ЍۍD? Z/ DhD>eD?bp@-P Q @xp@p 㪉@TC ~xpp|D9xD"P/㐍PP- hxppgD"P `P WxppVD"Pn@P Fxp(@pp@-PE `6\TH\E 88 Q,  Q' P:Q0Q` 0@@CQ PP@\Q@:Q`VQ`C`Qp@P ׎0,  pC pyy|yzzzA-PpP( U0 @R5 Q `p:Q 0S R p 0SRpGS@R :XR :R\X X0 0BU@< <0 0A@P} U p@-M`@PP T V  0`'Ѝplh h0 0ATPL L0 0AV40 00 0A  ]  O-LMM܉P`UH  Z ptY )9 0AtDW )9 0A TT)tI@T% W` \)\9 0}A R 0S Q:Q |Q P @Q:Q |Q @P 0PS @@ ,VJ 0;(H` \ 0HP u`VJ(H` p$0P4``Jp [ :H+Pu@PeH P6W4 @0pP@pP 0#P pTU|x'x7 0@0 R 0S Q:Qb |Q` P@Q:Q |QpW4``9P P P :P \PpVp ``p,Z:0P,@KvP^ ,J0$pW au(t4@0PPpt ``0SL#%5 0@ZlBh%h5 0@4($4` @` <P @P`5X,<P ( @(UtPP `@:PtPp p0SRS@@Rp =R R@ @Rh @:R  RD( @40 @H$0vH@[ {{:$d 0[  F B 0S:S0 Ap,`S:V:p` A`V Ap p᳊P , Dp@ A I` I @'  '@e@F$vA ,@\ 4t  T K ၊P H^A  XlHP LЍۍIA@0/CA@`&W!1 0?@p3@8P pD 07/p P 8p@T <@p@1/3P0P  +'1/pDoᠲ 1/ދ$ @P t@@Ӌ@@$P 4s ɋ 4ŋ$P s@tꜜ     L   ] lvU  Lr@   y M   $rr3 Ȕ/0.0H-@PP T(  R 0S  R:R |R Q A R:R |R0D@ @0 0>T($ $0 0>\a4 0H-@PP T P 0  0000H8D@ @0 0>T($ $0 0>!cCkpkTkXkXkH-LP <00,,  000jj|jjjO-MMℴX p Yx plDP@ \$ XXtR pH P 0P $400Sa 0$  P   AQ 30000@:R#R)P\@o" S`PU P8l#  P TQP DP 8Q R  R\R   "2 0=Y|"|2 0=}2 0 ` Q pAQ\Q hB PTRPU :Q MP   V`N:  PBa 0`P  R :R|R  0@P 4P ` `PЍۍq̏EgjjiiiKgiii fghe JehhiggLgLgԌfdf=  UP WlFh h0 0; QmE+ uM}A(A-PpPG UO XW W_ Ug @Qm `p:Q 0S R p 0SRpGS@RV #R @RP 0R xP 0/p0`C V:a`CVpV:A`C6pV60S30"q 0 0 ;Ur 0 0;Xs 0 0 ;Wtp p0 0;UXT T0 0: EkCHiAqvO-MM`@PV$ E"2 0:P ./.P,D 0d  4 p J%눒KP$`N p4 @YQ:Q(d PD@`@ ` I P o o o(d:K$N ;5 K/$N 00,D(dWp o <P @P9LL:P 4P+;P;  P ⤀ pAР B`40 nh$PK<4 :Pm ; \]܉ ~H-  %}MH-MPP@  00@  @@@ @0T 00@MР0    R0 n QKHЍ/}H}O-$Mlr`p TT ڔDP"  0 `币NPP U: @ GP  E p p:0APX qp Xp VQ!&H@ 0 P"" 3q Q$ЍE8 P9$ JP2 @P QX" 0# " !  P PHP  &P* H "[ E/,pp P $ЍP,}pxWzt|Z}LVDfT H-8M, , 0TKX@-M$@;0@07P@ЍT@ /  +` @a p  / = @ /  +` @a p  /=@ /  `A ` p  /=0 A@ /  +` @a p  / =@-0M@Q 0 !   0 T ":PT,0 0#0ЍH- M mP ЍH- M lP ЍH-M  lЍ n n0 nG-M8pPW2 U: `@a$A A塒OʒdA`A\Aqpqg,ppN 0 038  0qtq@P!Qލ:HGD D0 08U,H( (0 08PwRW *1/0 vp@-P@`#0( 0@0pvH-`@Pp0 0@0O-MؿP@pU f Wn 0 @Q@($8p`Vv  b3@P Q AQ P L3P%Vp@` p@WzPK!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$ $$$$$$,$$$$$$p,$$|8$D$$$Pp0`@y@pv@ps lKpkKphJpeJpbpPhPVA%LQ AQKP w2P%`@ @x@u,``-^[ @ `f7[ p*0<0-< 4 p-Q*-0][ 4 oO`@BPJpp W  p5p p-P-<Q ]Q0  $$    I @I 8PP  1 1P P@PZi \PV`]Ps  0 P iV`Tr -΍D Q %  0A D`V P @ePpQ  0D @B D `VD Q (,V`T @ D@ k1P0D A````SD P$P DHD((FϠP Ml#D`V +@MQ llLLLLLLL8888888888888 QfM*M8 8"@Z @@8  BRN:M  K DT(0 QEL88QL 8M MD D P@kzPj + @@Fϰ T@l# 04, , T<@Y*<@`+Vd -Vb Z $4< <+VPIF%P:$$4  Y0P /P0VK0V_ xP<, 4<@, @8Q V VQ @Q,@, }P?04P aQMdVEV PV" M /P @ _< < @ UpV eV74 @PV 5, <4 @8 < <, 9,)V @   9/P@_V ~ nQ @  w(V, @r4 @  /P < 4 (u F/PX < `P@`KPG,`T<@:B pFp @0 @ ,`pP<d @ d4,`  4  < @V`F@P TA->QJ @`  R  T0A  QP /@P@` /@`PuZ0A  QP @@VA ᎆ[ P0 0H0`@ F `  F0` F@`p FP` B F`` B Fp P ` p< ` <P<P @`FPP [< ((P m@<,PK ;[ APH0@  B B0 B@ BP B` B Fp B< B 宅p P p} << ᯅ<`p ᩅ-P 4P,`<`@,P+P [VZf 4P (< NN@< D.P4 4P<((儵 t ,`@K,`V*TZV:@V < 1  nD  mD e ᠅[ ϠPH0A@  B B0 B@ BP p B` A< B A p P p <@< P4@P<@F<PP -P~`Tz@q tp#p3 01@@D ~ DPDP((  S(QT3 @k`V@T*Z (( <8Dq XRD,D 8 0,8 00     0 0 0 0(0 0(D H$$ @T @kZd@T [ & 尀 D Q!   0 0\1W 0 0R1@ူ $P( QADQ!x ( RߍL>2ꢡ ujMd[a4Sp`_`r  _\ZO-M@Q- y5 PH!8)0PP`  &PZ0PpyW `PB<`8!81 00y? QR@0B#+@W P~{P( p &0pPpQ lwP #JJC)Ѝ9 i[0H-@P( ˒@-)0H-MPp$lVPd8` `0 0r0@0 4/P @2@Ѝ@TH-MPp$lVPh8d d0 0H0@0 4/P @1@Ѝ@T X-A-M`P$|WPlph h0 00$@ 04/P @1@Ѝ$@T<A-M`P$|WPppl l0 0/$@ 04/P @1@Ѝ$@TV A-M`P$|WPlyh h0 0/(@ 04/P @T1@Ѝ(@TA-M`P$|WPpyl l0 0/(@ 04/P @'1@Ѝ(@T`U$A-M`P$|WPlh h0 0l/4@ 04/P @0@Ѝ4@TtA-M`P$|WPpl l0 0?/4@ 04/P @0@Ѝ4@TSG-M(]\$!'`";)|{}0S** ` R#*@T6*PZk Q*W0(PxP  8`6x4x<H-ؠ 8@4` P'x %x<#x!xHPSߍ 0 0b+ 0 0Y+MP}I`!WJDIx < GHFDDJX˼4aͼ|ĶpͶbH- Mlp(  4H-(M$qP `p@P @P p 0 a C$ 0A  PO#"# (ЍAQ  4<H$ K $GG (ЍdT 4T > 0H-P@PL*H H0 0z!P P P0@0O0H-@PP T 0HDB@ @0 0W!T(C$ $0 0M!5ُ ʀ0H-@PP T 0HDB@ @0 03!T(C$ $0 0)!qWI}:00HO-MP@PH?D"D2 0!T D "P "XptЍ`P+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0@I" 0^" 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qgh_p@-@M@ P ` 0 P @ЍpP 0`| @Ѝp0H-@PpFl l0 0V `@TPu  $P0!@T!@0Rxup@-P`@`T@t  Pp!PT!PpG-MMd`p 0f@P# 8  P fP() ]zP UP J  P  p!Ppns@ P p$p=P P|!Pz!PP (9z([l YlWlm!@PPЍۍdM0H-M PU@p   P  ]Tp  @G!Ѝ0O-M`$p@PK Y  PP@MfP Y pPP pp`P`&Y P .jP= `E 0  Up `FP PP k 0ePPuP SSp   pM P^@ Z p`*` pp W * IQ  Tq`Te@P&0 0r`V `V P SP  QQkkuXT T0 0` PG pP$pPЍІ`0H-@ Jk P PEkU 00H-@PP T  0H D:@ @0 0T(;$ $0 04;م O-TM@PP w/? 0 TP@ U Jx/? 0q UX< 8!eP\ @PP"/? 0U LPR@W XhPPo/? 0C Xe,; L`Z4 L ,Y @, Tp@P 2/ PL R* 0P  eV*c C*EL V 0 Rpp00PLO#/?@ 0/|?n 0 X:HH%$PPo/? 0`eU@@,`0L @pP,`Yp& @P  2/PL R* @@ 0`  cU*f F*CL @@U 0 R``0LP@U.Lp@@ pY$P  2/PL R*  0`  cT*f F*CL ,`T 0 Rpp0L@Y.L p@@P p[$P  2/PL R*  0`  cT*f F*CL ,`T 0 Rpp0LXH p @WP @ P( 8/ZP4 H @@`㋐`Pi0< J `&X* Z*@PD`4 pP 2/D`PQ P@ p@W: T0spp H- P@U !P `'p&pW_P !P  0p@-MP@Pi 0 0 ``VVV  P 0#" PP RP P QЍpnnlO- M@P pRR$$1  0  Np! P J `0`F`V @ 0 T 0S $0 Ѝ0H-@DP (rP(r00H A-@Pp``P (kr`P  (]r xP p  `P VVPP p@-MP@P< 0 0 Pe` 0P PPpYP PTP`ЍpkkYsp@-(M $ @T) 0S- P P` EPA FP@@@P`APV@A00S A000SA $ Q(Ѝp@  RRA$ Q(Ѝp + H-p0PP<   p T iH-p0\P L@ <p4,@(   `T@si0p@-@P`P U Tp 0QR @T`pT?P P0 0U8@4 40 0sqAphiWhhzW K-LIqD@!P F 0 Y_t0INH@aOUEHOa!QA0SY  10"@PPT1S! A`VS0!V A`p@Pp1@@S10!Q0(Kp긍 tO-Mbp@Q`Y"2 0||ptQ lh" BB!!DPW:PF W*($"$2 r b0p`h@WP*P`p PW*`p W?`pP3`3p3_!1 0`p PPT1``FNH@!_Op0 \L`(XH`V  `pSP!    Q!p !! ` @pP@1ppQ1 ! R @0 P0 @@dCpЍ g\gcg؋ċċxhllP܊̊ЊĉK-<@P,(!(1 0Pp ! L R!qE 000CC11  0@PP0ฐP ` 1Q` @P0 xt  `!\ oHdud_dĈ|# # TXT@  0H-oP   00 0@R@PP1P@1R@!P@@8m.!D902!A@0o0蘇thlT<D$90H-@P`A\ \0 0FP PP x@00b6bhA-@`PV 0 0#P PpP TP  "PpP*{PupPwaagp@-@P P@`P U =Q@p=Q @p@-@PPL L0 0<P@$@$a```X<0H-@T[P P$ @000H-@PPLH H0 0z8gP Q#00_``O-Mⴑ@ ZpWpX_ ZP dpZ`! Q*PK VI`P@  ᔾP=P= q@W P UZ `    K``P!   :``P E@@  P pЍD XLK-8p4  p R Q A@PpQ P @P@VP  z`P <`dQ 5`X T 4  ^d` (ԁ|@d\K-p@TpWP`  ڽP=P q`FWV K-pP PP`=PtP@T p ᮽP=P ApTWJpp#D @-$m@P @o@-$m@P @o@-$m@P @o`Q3/ BR3/  /A-`V p@ PF4/P aVPK-@T `p PD9/P pP@W PGK-@T `p PD9/P pAP@W PGO-MT  `D ;/P QU  `E;/P@}  0P0Zp  @0p T00   0 TZ 0 PpWpGooqbW@NqY pPp⅐pppp pp@p$P1p%p@qP$PWPP  0Q0   !Q0p#QqppP0ppp@ p$p1P'P1P!0%00R0 V Ѝ \0S  P `VqW@pFob A- 0 DR! V!  Q@P$0 Q;  Q BEpP^P a@TV UppAV /opR`!@W G ppW Q p PPU pT  U   A@ Q"PPQU``@ooQb QAAPp pp^ p% Q`` @@ AAPP PPPpP`pPPP@``Pp@pWppXpp|H-Q 0"!R !R @Q@^  S AA-1S0#" 1@T@@T@ @ ``R   B S+ - <`@R0Pa%P P@ a$0S `\`00 P P P@'\`@&QA@P@`PPPpP'P ap%ppap' 1pppP p0R0p000 @ppRp aqpp`pppP0p%p`'``0&000P \ H-00 ?O 0DO-M- PQ(joOP@ pAAVjOjZ_X`TAXA\Aj넱P `T  P@Q2 @X@P[VP? P @7~@P@P`ϊ0ϊ ϊϊʊ`a0paMj0Ouj0@DZXPTTaXa\a0 /O D<jЍ@@  L A-@(Z _O@p`qqF jO4jZOXPTqXq\q($ t G--P`PEU6PeGVP+ @X@'PPPT@@Pϊ0ϊ ϊϊʊ0pi0Oi0PEZX@UTX\ O-}Mb(Pp`YPo @YPo hbi\XP LŸLL" H2D 0  (i    D@PP `0.0D`Bp)&.`#0 'Bp 0 BPJ ` ` 0 Bp PЍR H-$   @| P 0 S: 0C00  3?0/0 S : 0C01  /0H-0PS08@ C  00H-@ PR08  B   0 A/ 0 0SC ///0Q/0 S: 0C00  3?0/0 S: 0C01  /0 S/1 0C0 /0H-P@P U kqP  >0HqLWH H0 0 U0X, ,0 0 0=====10H-@PP T  0H|qDg@ @0 0f T(h$ $0 0\ =^=|<<6=A=H-P@P# U+ T3 U; q`PG  >qP@ pqP: P. `P4 H/w 0 0$ Ux 0 0 TW 0 0 UlXh h0 0 nP Hn<r<t;;J<[;;$;;;/0H-P@P U pP P PnP 0Hn0TP P0 0 U84 40 0 0Hp:; :::;p@-MP@P$ U 0 0 PnP `jpP P p0 0qЍpЍp$ 0 0 U9:8::: H-P@P U p`P  0 0^ U 0 0T mP pP mP mP Hm89\8899p@-@PP! T) P/ P9`V; T!1 0 FPD <HTp8I4!41 0 T%!1 0  `T V Vppp  0 0 Vp`p  p p p p7b8R8s7:8D8788677 @-/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q* W; 0 0o T@T,  0S  Q@Q  0PU 0UR   @:< <0 0F W@55 !86m6s6O-MM4J`pQ00Pߍڍ9HPP*\*X t`X`X\^Q:[pZUY iYi# @[Z|q0(  @TJ T*0S? (I PWJ X3: Q:[ZPQQ Qs QQ}:@ 0S <( pXo'p BPf [`2Q Z, p500P ǟ B  B4  @ ``   |P p P0!00p& vp P*0 n&w00p `n PppAQ :`&  x60BPnJ Pl*T&@pIH6 02P^JW\(&@pG6 0"PNJWL%@pG5 0P>JW<%@pG5 0P.JW,%@pGt5 0PJWH%@pG<5 0PJW % 5 @G0ҖPJpTppZ @ `X`4 \ 0pP0ᲖPPJYI`pZa0pS\ ?I#s0p P}J| PI:y 0 8o  0`2(P P$0"R0p0P01P PP P p PP0 Q0P0UpY 00 0  P @ZP( @Ap P  DpB@X10  0PppU YpW W WApX5  0`pPp!0 0  0 PP @@T 8p_PSQV@ `P KQPP0O0P @ 0 `*` B QP*BP3 Bp) aPV' pㄏO @  P `SP7Q `V P @P: c 0t 3P @ x@ lP`*l@0 A *A<Ps d*d F*F x `*`O @@*@,Pq a ` *` @*@5 Q9Q Q P   P0 S p SR`pV P,P,PVWPSR VWp4Q4 <@0  P.Q QP PE 4P%Ph `fP F$ @< 0Pd ,PPf $MPZ 9pp8WPM<@0  DPE-P PQ;   4@< 0 . ) L P <@0 PPP,PPVP `P O `< @ 0P ,PZxX%[ ( (t`P% `[ PQp u,< 0D(P P P P  P  B(cS`PP P $O?P @YԀ8pL[PP +ލ Ѝ4P $@$jxp`P pP a*a  A*A `5 P9Q QQ   QP0 S P,P,PSRQPSR <@  0 PGP xp,P[ [| @4!Bdd)d9 0u@xpP"@ ||||Q< 0xpP'PU PPP@@QUNWP pP N@wZPp 0Q0-PP[ `LP @B? @PJP HP tB? .p(@@`P H ppW@/ HP U,PHpPP$ Q @@rNQ@gN RRy QPQ1P.TNBP$ u64 0[1 @4( 偒 @<0@P P> B a*a @*@ B/0 Ê及B܀X& SX `HI L 6P,,1 (@`0$ P`V LP Q @@LQLR@LQ U9 L6P4, !! \ iL ol0 @-@ JPt  @ H-P P%0S PP$ PP+ SQ R  R RRQ/R RQQ RQp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^ 0S D0DPU S K-M`p@P W RTP!P1 0ZWH PPD PP9*P   ~OP P PYJY'yP 0 P P P X QQ P P(PЍ O-\MMXPTP300X00p B 0 B(X@p P W T"2 0W"2 0T@P| *0HPPv  *0>PPh #P P vP  0nP p``W PP P P P V`XP pp ZP8 40 `*` @*@8 dP4PU3 pPU,  P4PU r!1 0YJVP `P Jp@Y  YT4pT M,QhX Q\Ѝڍ@&[MБ , rZLq\BtB    O-M`XV  P@P @@@ 6NpP P PWJ@P> P  @ A A4 @@  AP A6 DH 01X@P* 0 P JP  0 A B!0 0[P t@P@`V`X@ )JP& pH 0P 0L p PJP  0 A B!0 0%P Id1St`)x@d1#^*t R q PZ?[oXp @P R P P pt` @ Vj`Pd P 0XPp E EP E E0S S SK0d00 Xp`0\@00`@X0` 0xP` V @ N`( dP6:0,d` X**V  Z[O`0  `V pWp Pp R ` fgV `Ѝ`,`` VUg@Q507Ѝ   K-XM,PsP @8PP AP A,p<004   sP 8PpXЍp  ` *`4 B*B pP TpPP8P4I,@004   sP W pXЍ4 pP4TpHWfXЍ \O-YMM⼕@P `4CPT pCPL P8`4p @Q @`T0PPQ U(`$p*%5 0$fQ @ .Q@RPP`.@oT_ ! Б@piWp  D  $)P*@pP:D@ @0 0V($ $0 0} rO-MP0 $pp @R P x$ j'MT0H00 X` 0 V7 8N p\@b* `0`0p0p tB0D7`p<p`pn aLpdgehp p|uO0P8p0 p *v wD lb*,P0P0V0XJ0Ppǂ( `P` Pe FmOPteL `  ` h iFx`4 ` gDkH @b ` `  Od  B|@◊ pူ p  w \yH bu `  `"akFl PPQ]O aZ 003y6J7@p@p@!x yD@Hp`dE`p`buvO`PpmPp0P@s @pLPpD[0p@0Qz^vB0p8c9@p`@w yN@p`L8ȸ*6 $7 V:99U0H-@+T PL P R0 0 >X04 7H-@`Qp``+T P\WT `V Q( X`3 $4 b7O-dMMDVPD`0``P V .P pL4`@DPHp$<@X(,Ppp P@XH+&*$0H-M@Z(TT T TPP$T T PPPPPPdPP l T$P TPP4P00 P@0|)Ѝ0H/J#*C]zJ*A0H-@( TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01P .T000000000p0P0H0H0~qsǭʬͬǬˬŬ߬ݬ(8m0H-@X'YP V'p0 S0距Mp@-8M`HP`@4@IPH .04Ad00. }(@U PE W?04P8Ѝp@Ѝ/" ͫO-MP`PP$@p RQP QP 0-P0+P 0\@.P *@q0Q00@C000A.Ppp  p!p >?O p  !.Bd0 p#"0f 0`@@@ Q *PP00@@UP:Al) Q 3T Q*``V 0  3@ V`:A@PR 0@ 0@1`00@`d.T``  ``i O   @ Q  P* P B `V  30@PV:IU< VP * Y 0  3@ Y:@R,  0@@.T P,@1`00A`d.TP`` P ``  O PRJ!.@P!.A` Q  P* P †P@T  30@`T:EV T@ *PU 0  3@ UP:@R  0p.W p)@R P90p1`00A`d.Wp`` p `` O p!.A `P@ Q  P*p, P @PP)) ) + + + ... P @Ѝ" LW O- 40`00pppPqp@0pG``rg``p@@@ @PA@p0@D```R PP@ BpEF2X<`Q `bfqoq' 2X c `bfqloOq' G2XY`pQXXXXXXXX\XXXX\XXXXXXXXXXXXXXXXXXXXXXXX\XXXX\XXXp!pPRq `0pF```.UPu``) `dPP@]_OY PPBpp@  @ P iaࠔ` KP0EP E`PP@ 4 `PP@. O-DMCQ @@R  `*` @*@̀ !scp51 Bcr !51Aq%!E"d Rf@ <8 $p 0P a@)bpE%!Aqdbed#p 0{P a@xp*bd%!AqdRfC#p$ 0ZP7pW& @Z4 Y 0,8gObA00R0PQb$8cs D(01<000!pa `f 0EPW@#?n`H0UaCQAWU"/"bAY DRBZ/ NP@ 2/r!" bSPPVFSo.eP`U2?2c1FVR0FWo`P2`1FB /OY +Z +W +DЍN 7M 3p@-M`KP; P:P( Q@0@P0SP?83j8V3jaF``P+0;  0@P.U QR0*A0oPPB P.PPu ,( (0 0PЍpIK- MP"P] lG00@@04 P_ `mP% Ѝ(H-M@PkPK kxaP`F tykPB `skP> LmkP: 8gkP6 $akP2  ^`pP,$ pp .`PV3opP $0<H`pTvpЍd y ܘ "cH-M@`PkP( Q PpP pp W.PP U3opPpTupЍt ` p@-P@,Pu`Pu` V Pn`p 0R0p0Rp \ 0 /n0H-M@tP 0Q (PZЍ00H-!Q  Q  P@@PPHP0@@P!0 ( @-@<p ,X0@ 0H-P8@p0,00H ` p@-`<@Ppp 0p@8 H-M`p@Pp 0@<8 40 0  p0.ЍGЍ p H-M`lp@PUp p 00ЍGЍ4   / / N H-M`Tp@P#p p$ 01ЍЍl <  H-M`lp@Pp p 00Ѝ.GЍ   H-M`tp@Pp , (0p0CЍ GЍ`   H-M0  02Ѝ H-<p H[F   4 P G- M@ἠD`Vt@@P,0 @ p   H Ѝ O-M M@ ,{Ⰻ[ Pl R!P W  (@@G$ R `P `U 9!PiP `\P P .PP `FP V& V*  (@@pG{UKP! P.P! W(@@W.pG{`KWG(@@ @ @$E.PPV5*W$ ':f a 崋X   P?05/`FHV  P* {K|WvG$ K {K q PcJ`W [ * ?007/ @  ,(nK`[EP0`G`G`GL@ X0 @ XLX`Gdx`G <L`G`G`GX`G`GH  dd `G`G`G\ `G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G0 `G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G$ .$ ;P Z ' `V`FPT*o` Dd ? 0P Pr h P *l hp?07/ @   . ?#PJo`w +R 9   P 8 4p$?07/ @U   Pm . ?PJ>T{*o `6T*o`1d ?0N@ P  P *@ <p,?07/ @d     >0@ P  P *| xph>07/ @    Cd > 0@ P} s P *  p=07/ @,   @T , (o | @@T    d 0p P. % P*  0Pd 5/P  Pj*o쟟N `_ @   PR* 0PJ  P* P  P4 0p7/ D $@폎^. pk 0PkJ P   P  ?007/ `n@`   yt ؎ P X$pTR d =0qP P  P *  `=06/ @   `VvP J P*X@P i @+;4[@ P* P?05/[ @V  A  .$ ;PCJ P   P  p?07/ @`  `  @ @ K @ F [ t@ PY*p>`0IT*n`t  . ?PJ  `>(0 d @ P  VT*n`K TL;+4[*@ P* p=0 7/[ @  E t@P  m@ +( (=00P1P P0  P *  p<07/ @V5U5E   H!R/0 SNQ:H,A b+ 'B  @ ?up .$ ;P$J,Q* p_   (QJ  ԇ+ ( [; P  , ?d 0` PC : P * @ll?04/ @  Y   (,Q:l']X ń  0` Q 폎⻞.$P pk0;PJ P   P  ?0p pp 0d @ Pp f P * p>07/ @T  簋k *V):d PA 猭  P P p \ 07/ @D@T    P* kⰋKP A .$ ;MPJ HQT@! 0R 1@CŸ `+ d d 0@p P   P *l PXX?05/ @  T ` ꩀ XP npT*o` T*o` O~ P~}} H~ .$ ;P4J P   P  p?07/ @   =xl? 0d @ PP F P * p?07/ @   =@? 0d z@ P  P *X TpD?07/ @   ~=@  w=P  p=>00T*n` | P}X@ @ PX   P * p?07/ @    @T1*po` | h| { t{{ z{zy Hzxx Ly =p P  =`  > !0d `` P  [ P *h dPT>05/ @   P8: <Q= 0d P P   P *  pt=07/ @   <= 0d SP P   P *  p<07/ @   W<d ? 0P Pa   P * p?07/ @  .$ ;P3 JX : K'P  P# :   P  p?07/ o@`  b F v w ; + 0; ?0d P P: 0 P *\ XpH?07/ @X :   HPJP P:   P  p?07/ po@`  ]uX ut tbmsh s Tsr `;d > 0%@ P  P * p?07/ @  d D?0@ P  P * p>07/ @d     >0@ P\ R P * p?07/ @p  p  P* ⬯_ 砟 @  p  Pq*d 0n` P   P*p@  04/ ( qq( >d 0@IP P   P * `?06/ @W    p_l pp@pW     d 0@ PC   P* 0`6/ o`o ,p0n Lo :d ? 0P Pg  ] P * p?07/ @$@ p  폎^. kq/ n lnl{m;+5-[G@ P* p>07/[ @ > 0+d  Z@ P   P *H Dp4>07/ @p,  p  PA*ԝ _ m`l ,mljAk< k6,QjL jV+qil i <9P  592 ?0XPP P? X  P * `?06/ @   . ?K P J +R : `P  P h dpT?07/ @p   . ? P J@ +R :   P  p?07/ @p   ⻞ 폎 0 P J@N +R :   P  P?05/ @  .$ ;Uhh hg  J8@  C8P  <82 ?0X0P P X  P * p?07/ @  .$ ; PZ h$` Q f8T:K3ff fX P%JP PI :   P  |pl?07/ Po@`  $o`Xo`U, P*e 4fddJ@  p∀  Z P  ) )@@  d 0D` P   P*8 p@$$?04/ d e-dc PdYc Pf:(  @@0 )   X MPJP PIX  P *  p ?07/ @p,   p Q"* o^NP:@  ⴀp$ ;` PJ, Q:P9*c |c[o` P 갡 caa0@0PE[  Rp P+  " P *d 0@L4/ @0U  p0p P X  P*  0@ 4/ [m` P IaD aLa 0@0PE[  |p P   P * 0@4/ @0U  p0p P X  P* 0@4/ `/`_ P :)  P  p?07/ @  o`T: I_D _U^P ^2]] ]\3]T: ?0d P P ; P * pp?07/ @d     ?0rP P@`   P * |p?07/ @d     ?09P P~  P *p lp\?07/ @   PP  ` [\ p\ PE:.  P  p?07/ @  V9[4 []ZX  Pt-  P D @p0?07/ @  3U  PN  Q  p>07/ A==+=C+`k0 4~/ =pSoZ`:k0ShPAx<@A@@@A@}@PA%S@@Q@@@@@@@@B@jyYt Y@PA%S@@Q@@@@@@P@%RR@@@@@@M@PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@@@A@*W-X( X@PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@P@RQ@@@@@@J[UJjРKPEkS[ZKV:J`0CkSVZo`쿟 P V 8WUVV0@0PEZ  -lp PE < P * 0@4/ @0U  p0p P X  P*h 0@P4/ 8 %UUQ @4* P: @  P  p>07/ @  . ;\9T4 To`?Tt/ 0H Fd P P O᩾ P * p?07/ @   P"*lo,`ꡬtSX IR Q%Q@    P*?d 0 pHZ Z 9pYP PY @  8@pU OpGPF = P * P?05/ @Z  t P!)  P  P?05/ @.W  [ⴋ.*X:.gq   P @pp>04/ O pG@W  $ P*j PX  P  p =07/ @  =d 0 ZY0 0,  @ 1PPP .pp0S PupWZ.pO 4P,p@Q x P*( P?05/  @j>O 㴋[`[<ON O[# PO:   P p lp\>07/ @  >0 n`[n`,)NM Zu P:  Q  p?07/A h07/ @   Qn  A 0+ B 00+ Q+T ) )@;  A+U PJ@ P *  p?07/ P@T[Ⱋ*U):d ap 眯   P p@ l 04/ `F@V  p P* [Ⱋ,VH* p_   ( RE ( [; P  , Ih?d 0$ ` P 幻 P * @?04/ @  Y   (`,kV:;+#[᪹@ P* p>07/[ @  ) G;+m#[@ P*P Lp<>07/[ @    F( FE F . ;sPJ P{*FV5U5E!R/0 SX @PrJPQ P:   P   p<07/ l@`  .GE3EX; P:   P $  p<07/ @  [k` P yDt DB 0@0PE[  Bp PA 呺 P *X  0@@ 4/ @0U  p0p PX k P*  0@ 4/ [ P?* Wȷ B,C8 %BB AA @PACUD  P 4  0p 907/ @   Q"( A;  h* C ;.+ Q+ ) )@;  A+PJ@ P * p807/ P@T[Ⱋ8*U:ķd ap 笧   P p@ | 04/ `F@V  p0 P* ?@> P?=>>> U  P  p607/ @  Q}t2y:@A+ 0;0r5F0+-+ Q+b ) )@;  A+cPJ@ P * p507/ P@T[Ⱋ9*U7:Xd ap @   P p@  04/ `F@V  p1 P* t>Q$> <t e<; \<w:̯ U  P H Dp4407/ @   Q A 0+ B 0T-+ Q+ ) )@;  A+PWJ@ P *8 4p$307/  @R+  P  p207/ @T  尻ⴋ8*X):hd PA` P  P P `p  07/ @D@T  `0 P* 㴋ⰻ;0;\ ::X1  P \ XpH107/ @   P: @+ m B +X lPߍ ۍlB2ȧ ,3n1 1904 0( 10 / h/- .di /U.u,p ,+ \,*| *\fp +1+-5( 5 897ܬ @8570 75ܪ @64]05 4| m3 O-M(`,@ P0C+P:J@ pQ pU `Ph Q p\Q Q .QQ pG0`,@Q W UQQ.Q  R.p Q*p.@p .QQ& R * P005/ BwPL L0 0-ЍQ pWpG' |'&''O-M`P@V:"pP D @020|!|1 0Zd?`!`1 0LQ*0p@P`qP  Q8q\JPqP    0PK` U "V PPP`|`PP |PP 0`F V``3 `Q ` X:Ѝ[ $ A-P`HpUg 0 0+VX 0V@P`. Q p`0V7@0@3&b`7@`` V0@3```@V@ õ `M/ o/ ///ᰈO-TM.L%)$Bc`$H P 0"  I J㢕  @Z :M F32 W0!P PP``i KP$g  A$`Q 2D0p2 @ PeL KP"pIX 2H02 @ PI/KP@aAV 1M02 `@ P)KP @JP @ZWXV a`P10S02 @ P``"P``PP  00P ppWJppppA EP QTЍed 1wv 1vu؂ uh  ă H-p@`PP(U  E PE Aq 0 .S R:0pS\WR: S\R   . A-MMx`P$`@P J$PJyGoBPЍۍd̀ @-Mr @ 0IPJP*Ѝ +Ѝdp@-RPPp@`PP  p@<p@-RPPp@q`PP j p@0H-@PP  0Hp@-Q P@J`P ûpP > p@0H-P @PP :Q QP h0蘻0H-PQ RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0!00H-P @PP  D`P @00  X| O-M-M`@pt@% P}P P P P0 0 00 0 |@x@D`@P DQ:*T T T 3+T -T/@T 0T+ xQdP 0 ` Cp t0`pm` P t R h5 pt;qp xh0hw@0T @0H Q40, 8<00 Q ! 0B ``0 H R *Q! 00B0 pX R `PPU `R ` d@0X X' @ Q ` (p` I0X  ` PP0X  1`H Vp`(3*0H P+0X  ^P a P p0 aPp PPU   `P0P Ѐℰ (p(ppEWO@VR $```P+X -XP``0pH W 0X ``0^ `F0T㄰1pNWppDP0NP 0pE W q0PH0N UP:L$`DpLO^^pWDpDW$`i <V :VP p@ PQ U S/ !R a@ p0K\ IRk80TW (PV IH%PS@DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD nP$ @nPG0K\@pI8V/W WW&`Z` @@DX ` Z` ЍЍ@8w `Z`@ o% fW_ F$``4 R Z , R,[V<'P / ! a0+\ PUG MU4 P  V:_&B`PP `T@  a0+\ v, )pfP $/ ! 0K\ P 'U,   vWn'Rj `|/, ` ^P   a0K\  , 0 $ mP# `iy<@ P(PT$nP4` 0, @P ˟۟P4 | Pw q nDn n0 nn0P D0!  ⫬ PhrPt poP P,lh p@@0(6 boO0PPS o`FO B S060000L@`C`$0@@0C X ``V`Q oP oP PntPPHQp@PD Pt@D Qo P JQkp8 P{8DQ @_p4` 0Pp4`D pPP  p<0Qp^P lI C X /GJ `O`A A5?55?pg lK  KNN @ `   Q @,P |G@PR<B0k2@&00U O-Mp@P?!1 0ಯT P D P"PFX]`SP+V -V `0V xP p0VpTp0@ Qa@"Q#;*Pp`E@PE"   `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍЍA@QPy00S O-M`PpP?"2 0(U E"P X Ѝ@ƪP+T -T @0T xP `0T`U`0@ Qa@"Q#m*`@P?U  p 0Ҫ됶kU[ @pI" i!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" Sʐ @T "/P  P" S6! @T "Q/@X QppЍA@Q~A rQJQ H-X MH-M  lЍH Ѝ/G-`P+ Y3 ㅦ0@FQ`V kP>`pVPtP.  ѤPF 8@T'B 0 0)YC 0 0P@F  ꮯ @Z 㫦-i^p@-@Px@ <`>U  > p@fO p@-P@ Pu`Pu` V P>`kp@-@PP6L L0 0ත `@Okd\H-M ? o ЍG-MP`0@P% @V 0 0   0 P p; 0 P1ЍpЍ%=O-MMCp`PW@X0tBp#p3 0O`Z Z PPPP\U ۮ֮/q. P1P 0 <{Ppఀ Y  .YQ  .Q P.PF :Y  :P:YY   :Y.Y Y Ⰰ  P.P%`Q,P `\($ !1q 0 p  lAQ@0!QMߍV A\`@P s:\p XQ\j ` AXXab:   P! H`X `Xa彠PXN:  ᐢ` X  H Vz\K Y@K H ; l; I K-M@`p4P P0 0@@ЍЍK- Mp`PP`\!\1 0@HWV W /@W 0P 0S+ R)PP( p@P 0 0D@@ @XQ  Ѝ蠭@ Ѝp P`pP P h8 ux8 O-$MMܒ`[ "2 0ԫ PM Pip0t" p:zP^ pcPX ` 0p@=pY--  0`[$XT P p@GP9p  ᏡPU R QB@"Xq`@Pp 0 D:P `V *PEu$iP   $Q$ЍۍhU @ QQ  lE `QA-HM<@PTD !1 0`PP!P  .0 P p``"0 U  !Q l   PcU D QHЍTdB 4I$IHafO-,MP@Pu P(p {`Pz  0p `Pf p , 0 pPV  aP  @P1 P2P ` @QLCMHH3@0 q03N 0k 0 ?O@0 `PP PPP P PP` P` p ԫ,Ѝ4P% ` ` P P P Z: P8 J `җ`P  R @*P@`  B `JR:BT   @H@T*P@` F@ӟ@ V Y @@ aPX:  ὟH@Z` P/ -rEV\K-MP@P<8!81 0Q `Q6 ?P( p(P" P  0p`㼷p   0P #X  `P`P` `Ѝ `{O-KMMXLp`Y@(4 0,0< 01TUV ,< 0&W[WP(P H` XXe`zDp@PpP\P p0  LPJ@P @1/P L RDP4 D0HpP p LPT0 p0`*Pp@TT$P R*<@@D ppcP0@J`D4@8PooLPPHP<@4 P$ L@1/LP `8 <@ P,HPp@P RLT+GoTe<@( P%,P8'0  PzJ@ 0p@'1/Pj (LPXP `V*L#0pHP<@D PWA DWlWW5P 0% x P @P FL`@ `SP2@'@pGJP.`P+' PKTL0pHP<@( ,P8'0  `P J@ 0p'oP (P'P@ GT'PL( @LGHPP0@DO`L0`% @ X( L0p P/W ,P,P,p 4@0pP@͛@$ Q*RX*,@$  ᕝ LHP@wL0pHP( J WTHPQ40P0p `%  L( 88G, @PEJ`  P= ,(LPW4P7  Q : `  P A`L ",L HP<@ZDTB8R?*0` @G p@@D`PZ3, L T``CP@L( 44L0pHP( WSPL pC@L4 PLL04P `$dPV:4QSDQP4 Pp b00pS QhAlQPT  V Q S PRQ& 4Q#P@4Q Q0 p `Pڲ@0pG`0CPW@ P P0 `TUP `ᮚPO@ JTJ屓 `   @f F @JQ* A@   `\$ 00@PBJ@ Q*`(P KߍۍRPP09.7: ˸Ѹh: 0 1 *ml/ p$/ O-MPp@P8^4%45 0 Wp W (`P  ` `ഓP ` \P P P ` P P`@P @ @oᠢ@P P Q : jP  A  ` `ZNTY ` P%H`Q* P  @`\P ` `!P#XN#`P  R:0 BpC0R* Ħ ߍB@Xp` `pP R? APJ@XPp(`Z*PP EU@ X@JPq`Z: JAP@[X PP ` SάH-MP@P  0 0త`PppWP' pp Ș0 U   Q   hP U ЍЍ萹u///ۦp@-M@P`,0)(0 Ѝp..@-M@ 9  ЍX.d.H-M@PpP P0`L0 @ЍЍ. .0H-M|PP@Tx@T XPPP @<  9HЍ0Ѝ0T& t-d-O-M@P`P U T P P Ѝl6h!h1 0UPaL!L1 0T4b0!01 0أ   Q `pO pp P  D `QI[ Y xMt t0 0ণY\NX X0 0Ѝ耶Xr0J*h;@WO-$M$T@QP  Y T Ti P $ЍOI#3 0fYJ#3 0\TXO YW `Pp V @ :V:P\CPX@ p  ͙P  ƙP  WB@p `V1:VcW P pPlp p P ^ꨤ/p[HD"D2 0Y,("(2 0W @pT?QpP: @ P+ T: DQ(Q:  0 pSpDS=  pBA 0W0@ GQ .V@T@QpP pTp ` @QP P$ЍLPpPPpP 3PpPpP 0p`C0`V p5W1:PPpD`0*g0S G*BQ# ˵:׵W3}y8 Ug\p\! h < x A-MPP: XB @ `Ѝ  00T @ xP `9T pP 0D P p@qp` 0D P:.TQ*p@p`Ѝm 0 0Xn 0 0T @ A Q  ` V3VX  0Ѝ觰43( O-|MV`@QPx V$ T, TaYg Vo 0pX&: 0PTPR*: tH%5 0໡VI%5 0ౡTY%5 0ॡV`%5 0P 0 @ @@Pp`0SwpQ 0 0P o0R/`!h$4 0hVi$4 0^Q P Q s `pooPpbp0Ps0$ R q `pooPpæbpPq  (0S 0r `pooPpæbp Pr00 ,Q s `pooPpæbp0Ps00 R q `pooPpæbpPq  40 S r p0oP0çr0 Ppro0Pr00Pr S  UrpJP.` Y:ZC y Z ZZ @TX*Z:YW W P,P4P P 1@F! /P9P7P 0 pD!: /P% FP"*:ᬍបPy [P*:Q* JAP `J ᏍPP`tPPxP|Ѝ_J| xe3P,k2C_ v 3FKҪ( P O-MpP@PG%5 0 PTC(Y$ `V$ V, VTו + 09/p ! 0XQ <Xꉡ5w1P`PpPPpPTP^PpwP`pPP᫖ Y  RP P   PL U PP  Z   09/ p 0 0P@%0pp,RP <X8 0< BS0 @X0 pP ) U& 0 U  EPA0u0 !1 04PP @P  ]La? 9/p 0 P @ P U ? \PP'*ȔP 㝗PЍ 0`9/p 0P @ P g0 P $}@p XT T0 0Ǟ@hPq &   ?ZO-MP@pPh#3 0ञU `Ŗp@Z xX]pZ@[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ PZ  #@pppZ㻖@> @V[;  P6 p @ W)  0WPpp_oWWRUPU U@@ U@U @ U UQpPPp W @@P@ ЍnJЍ& Jp@-`@PP T 0 0GFkp 0ap|6x x0 0࡝T`7\ \0 0``@ ,TP(p([39H-M  2/Ѝ/p@-M@PP T 0 0g`P" P P 2/`\X X0 0NT 2/P `Ѝp*mџ֟p@-M@PP T 0 0'`P" P P 2/`\X X0 0T 2/P `Ѝp*0H-@PP T P P P0 d` `0 0ݜTHD D0 0Ӝ0 0H/fӝX>0H-@PP T P P P0 d` `0 0જTHD D0 0ࠜ0 0H/᚜rp@-M@PP T 0 0`P" P P 2/`\X X0 0hT 2/P `Ѝp蒛!p@-M@PP T& 0 0A`P" P P 2/`\%X X0 0(T 2/P `Ѝp蒚.p@-M@PP TF 0 0`P" P P 2/`\EX X0 0T 2/P `Ѝp蒙O~Țp@-M@PP Te 0 0`P" P P 2/`\YX X0 0ਛT 2/P `Ѝp蒘Z}Ǚp@-M@PP T 0 0`P" P P 2/`\aX X0 0hT 2/P `Ѝp蒗s|טp@-M@PP Ti 0 0A`P" P P 2/`\X X0 0(T 2/P `Ѝp蒖{p@-M@PP$ Tq 0 0`U 0 0P P P 2/P ``\ \0 0ޚT` 2/P `ЍpЍpjy\ziʕ zp@-M@PP$ T 0 0೚`U 0 0ਚP P P 2/P ``\ \0 0T` 2/P `ЍpЍp2K$yוThyp@-M@PP T 0 0e`P& P P!Q 2/`d` `0 0JT 2/P P`Ѝp? xpmp@-M@PP T  0 0!`P" P P 2/`\X X0 0T 2/P `ЍpAwvNA-`p@P* 0 0V4 W# 0 0֙PPeP P# P  03/P U t0  03/P U < 0 A/~pvJdDH6K-M`@PP T! V) U/ V7 P= PD P~ 2/Pw 8^!1 0wT_!1 0mV&!1 0c!1 0ZVpl!l1 0P 2/P; p` WP5"P P P.W$ X`{P  6V QP````X  ``XX`ЍΏt~Ð֐ZLt2ir[0H-@PP T  ;0HFD@ @0 0T($ $0 0֘r܎drJ7H-M`@pPP" W* T2 V: UB W !1 0൘P@ PG P\ 2/PU ;PL!L1 0W40!01 0T!1 0V 0 0~U 0 0tW 2/P  R Q  R 0S R 2/ЍЍb؍Tq:`‹pƌG-MPP Z' @T `TY_ Q`pT) T TO` 2/oP KP/L!L1 0 Z40!01 0 2/P* `P-V+@T T! T$! pY@@0P p  pTPW  Xppp QpЍ,,Bp&ыoJEm0H-@PP T (#0HnD?@ @0 0ࣗT( $ $0 0~5pmV H-MP@P# U!1 0`P5 P P P p07/P  2/`W 0 0`U` p 2/`P  2/P`Ѝr9dlډH-MP@P# U!1 0/`P5 P P P p07/P  2/`{ 0 0 U` p 2/`P  2/P`Ѝ&k0H-@PP T 0HND@ @0 0ٖT($ $0 0ϖVFHj.0H-@PP T 0H}D@ @0 0ൖT($ $0 0૖Ƅi}0H-@PP T 0HD@ @0 0T($ $0 06>(i0H-@PP T 0H5D@ @0 0mT($ $0 0cꦃh~]@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /  / /0//0/O-MQ p\ Q* P0 @ P*.000@@P PAS0P1!0P*@P1AQY YcY !P*\ `x@pY: P PJ`EpUPGPP` ! ~S p@"0D:SG`10S\*@AQD!0D^S:0SO*)0d`cͰ lX #V#6Fnea\`D0~Pv` e@@e`P3*@ P|`  -P$J`p $PJ@p \ pQ PR . P* @Ѝ(Ѝ~$"0O-M@ 0`pW  \W .W9  [* R Q.R @[W+  ొP sQp P 㦊PQ ` 㞊P Ed @ F!p W`` X*p@]P LQxQp   (@QP2 U1*@0/R# ]R* PbS````  P0R| z ^x@T " @` Vh* Uf* 0pS P[  `N]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Q(Ѝ RЍQ X* H Q@(@۔@ؔL o A-R8P0U9  0 PU. U'*PP`@V VAU`PVQ!P`V*UPPE`Upw`VJ@@@@@`ꔔ(C\  H-MPЍO-MRB:pR?* `V? 8@ G b P P @PAV'0PPQ!P0[0Z1*` Ẉ  Q*?0 0P `T@@X`V:(@ @ <00P0 B  t@AЍO-,M`S PY 0SPP  0S*p@WpAS@pTq!pp P SP@ P@(TYTpQX @QUAPT Pq!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$AK^AL 2P 2 \p R$ PR@PJ@p P-*@ (`W(p@xpPP Q* H P(P}  ( up^ XYU(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P ,pPP Pލ;` H-BMhp`@P 0p(p  0!QBߍ|; Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S̒(00S00H-Q 0S AQ:Q B诒ꬒ(G-@pTWo᠂P` P0 P1*T`P yP@pTW|(H-@QSP`p R yPpGP`W@A-PA@T  UQQ*L(Ap`PJPQ`@8?@-Q 0SAQ:Q @(@@ MH-M  ЍH Ѝ/@-M@ Lp TЍЍH-R0Sb 000S 0s 00 O-M`PP$? " 2 08U @ E @"P̑XЍp؋P+W -W p0W xP `0W`U`0@ Qa@"Q#L*@`pQZQWVeZUP@@D"ꉑp00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRe@pX QЍA@Qfm$hG-MpPW$ U, `@a$A AO O | 0xdA`A\Aqpq p@!Qލ9HFD D0 0xU,G( (0 0n jKjmi#jB0 P MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/ O-MS @!1 04Z@Yː@@`ЍpP0Q  UAp/W LP%p@ ᕅP@UT@p`*VJV:@V@3D    @P @`@V PKii\H-`p@P 0Pj0H-xp@P@ ddXPP jP P0P E@0< ( Pv h Yx 0H-@P+ 0HH-`p@h dPW  8 0ஂ Hk< _G-CMr@PTp,a Ui @  PO  `0P!0D 20|" 00@P5`P A8@P+ P4PD (", 08 P:,܏P4 ُP*  03/$P QYP@,PCލ8H~D!D1 0U,(!(1 0ᨏ$!  P  !0P f!0` B` 0 0 {@BP ( R $2/xP rQ D0 0{h dddadd<8X :ffs |r X`O-M@Ptp!p1 0`q`1 p0PR0PD 4Q0a0qP,`(p$ X0*P        ЍO[bcc+hbkEgbbb7bH-@P`\!\1 0LP P`@qpP( ` PV: ` P  pdP q0G0 PP Q `ApP RV pKdEaaBa$Hp8O-TM`R  &#3 0࣌xX+ Y3 pPX pP3 pX,pLQ2 @T PQ$$$ ( T&a"2 0lYb"2 0bpQ t"$0p $( 0d\ 0LH" PM ZR P@p@ [J VAQ@@0! PQ 0 400uP  P QHH0S | 3/@x Q@Z@tpP :$Q(( 1AWpTЍQ_ ``u^-_F_M^_-_ m m Dm l X\P  H$k (k k  O-Md\ p D@ D 420S$DPq QPP! ``V*AT pW W P P U \pXppHDQPP `4p`W*V P  R  2/P U  @@ 0HQ 0 0ytljЍ\j $  i أ H @ $   x h |h X   T  g h 0H-P@CP00HK-MpP`t@ @ \00 pp2P `@F`@\"Ѝ G-MpP`0N 4@ 0p @p P `@F;@7"ЍO-|M`x$ P V %P0, %pAUW@q(HhX ,lp|h4 XT ` X$ x  0 < D 8 0 0,0UQE@mW ` 0(p#/~7h@JpJ.mPSr`U)<S%mu0Q#17pP%Rs0pPn3Sn( `ᓴ0II;U (Lr E! /@!B BpNp T(T P(JmqR3/>`%)<#"mqr0Q#1'p0#2r pPnq3Rnq P V: PD P@!gQ VQH@, 0  V4* P `@\oIHP% V&: P+x V,:E)@P"d cspgG'v2br r#18?Oc0Q ?H@ 0_ V*P `@\/ H@, 0 A V*P `@\ B/H@Q 0@ P ,0   Vs*Po `@\H@, 0  V[*PW `@\H@, 0  V@*P< `@\PH@AIIP(@!, 0  V*P `@\H@ `P IIP@!, 0  V*P `@\w$RE)PP"d cspgW'v2brpwY1(/Oc QTdp=H@ 0xV$*P  `@Q` PJى @p Po P V*Q `R`Έp=P8 V8:$ H@, 0 4 V*P `@\ H@D,  0 Vn*Pj `@\H@,  (0 VT*PP `@\H@,  0 V;*P7 `@\ B+H@Q 0@ P , 0 V*P `@\H@, 0  V*P `@\} V* 7 V* P$Q `\h$C  apH @0 D pX \0,)2@ c V*P `@\D V*  V> H@D9 P 0S V*P `@\# 0 {`H@8  0/ V*P~ `@\$ HH0 U`HPPa)pEQ"d aq0cw#6aq r1OcPd PBJH  `@p *` Jd @JG*@ p/ JdP `*` @JG*@ !   p P$ /1$ $8 V*Q `\P d0p"sgb {tgYP#c  sqRdP d0p"sgb {tgY#brpwP@dp 5H@ 0vV:*P6 `@Q`0 $ V*Q `\3$h V*Q `\%1x0OQR0d Br V*- Q 0` V 18 ?OQW dpGw V*- Q 0` V $ Va*Q] `\18R?OdAP3QH@ aB0  VD*P@ `@\Qd@RQ PH@H3`B 0 V'*P# `@\hUW  PCdpG; w9ʠ V|*-Qv 0`Vq o pSTxTm |2Q 0 Q!00C -Bo R `V*02R,0 R `W`H@HR2/3 !Q1IP2aB%d   , <0` V*P `@\0 `81H@ W0 pgBpF V*P `@\`0H@ W0 pgBp. V*P} `@\ `w `xP|Ѝ/#Os ?%[P;ZAɪ?JʵѲ\ ~D G-MPp`^@ @ p 0p pP `@FJ@F"^ЍЩ H G-M@pNc`, 0P  0p PpP `PFP"-Ѝ 0 @-0Sm& h@T@R @0S\  H-\ m60 R0\pޅ@-$@@o@ꜧ TjH- oH ,j@-@@@H O-MrPPp@ =x P|3P hgPЍ|PJT@P  P  -h0@Y,@ T1T0 M 0SKQ-pmP`lh0@ 炁  R 8h` PQ 0SQ( 0S%d-h0@Qp aW ` `aP Pe PP UWQ 0SQ P"L  ЍH `,PT p ܣ |$ 0H-P@P  P P@P0 A-@Q `P& P P:P  PPP `phPFWMwPpTP|h aUPC@ DPPPPVhp@@_@E yPp`V +:{0 O-MРP @P `PZ Q  P R `PZN V P [ P X(P  PZP p_pqa`ZpppW RBah P, P^ lh> m  X ( R t1Q0!M`!a GZP`O 0h~ h )' 0 Z0v @0pZpppW 0 P 0 !P R P0VP .0@"0pZp S  Ѝ  1 0H-PP@P@l400 0'@0T b\ 0H-P\@PPDl8 0 @0 a 0H-PX@LQ8 0o P(0d H@ X@-@ _ PT  (@-@XvPQ<m40 0? P(訝  (0H-Pl@V`QLMD0 0 P0(T$  (0(  p@-`lP@0\QH' 0 Pp$T  (p萜 tl pt0H-@*l2 R 0phQTL 0v@4P0 ^$ Pě  t @-@P X H@Q,$ 0@I  @-Q @ R TH@Q,$ 0@% h` HP 0H-PP@ D<Q(  00H ؙ O-M@PU8V pP I0 07 @7P `0P? 0 @7`P 0P0 R/JY( QN@? P-@, $PN/8P(pplh0@@@0S0`Va`` `V0pP@`P8Pߍi*W\,07`$m& PR Sh@p@@7`8P  0Aop,m&2 0Q 倁S h&,?o 2B(P p 0 0`Z @7P 7 0M @7P 0`0PTPTP@`И K-8M@$p aP G 0(P 0,Qc 0PP7 `7P p 0 `7pP(PJ`p= PJ eJa*e DJA*D8Ѝ ԕ p0H-X \ @LA@RP pR0H-P@)PAjI|P X0" Q `A B0U0pPUO t T W O-pXB`Q ЀA`FPR Pp`oXPQ @APE`\ `pPP\`U`pX@P\_`Q`+PQ@APE`\ `RPR pX@\OR `\P @QРA@DZB!% \ !$ R 0H-Ph@\PPiDP  0uP@ o0 T O-MFMXP`<-  p:Pp/PP,0r?@PV n&o/Bp ` @ .|rP P PP/Q.Q .prPEQ/Q`P Fp*@@p$`& `+P p@@PJ o nT8h<hmHP`-$3,, @ (xP@wHTX`p@0xph@u}P@v7'\~s0u`@ 8vP4w@0r'Ty`0dpQr84z` 4p0{`41W 1PZJ\pZWJ}WQJ1QSJSUJU@L00D@4#@0>#0`,0Y}0NX?o2  ,<`(0 @ Z4XP{ ^|:wL`PV VpU UmW @Pi$ P@ \p1@P W> 0U^`s@ 0UhpUtU40ȟ0UhpUtU4U0UUhd `V8htX p4P'T10@R@ `B1@0pT p\p X   WPU㤇ZL` H00 S0~PpRPZ,4E@PL`@PZ0p@`PsHtp tqRp @R0  T0@Z@PL` @<T T*0@0P00h~300Q1 : P0` a`V E@PTL`0 T h>0P]0p P BPD p0 0RI \ X` pV `(Pp@$ Ϡ`(Pp@$ XD `V(h d `$<&̂TX ` @Pv($  ^ HW@PL`\ R P A0 R'P80pqR V 0S8pS01R 00 R U 0SS0ꬃ}P ߍFۍC&l P Y` PI` QQ` 00  P  @Z5h`P\ `X\p\T Y#XlTp㉁hP pAyP pTpp1[ThP@\\ Po @P. @0p0pW0@P  Q >X p0p `0@U0P@!0P`00@pW$ ` `1@0P2VР`F0C T T20@/%o0% RJP!! R }P\p|W `h pW@00!@PPꀐ (gX ̊ ̆ d  O-|MpPQ <Q ` RV >R `0 A R+A"Q#:Q`@PF@Qx/P W APDh @  "q H  @UP @ADhpQH@X @㰡Q <Q,  R >R0 @pxl0t`hp  0p@Z P p 0 A R+A"Q#:Q<@<J@QQ ,Q;QxAtp\8 0 RP] ;P,Pu`p,0Pm ,QjLPe Pb8x@0t d@Gb0p0 dpET.Ao% . /O/,,pWtJD00SH000@@vS00(0hDA7P,0m&0ppq@T 0St8,8 Pw|Ѝx3haxPH*0@mD4@0P p  R H A K 4˿ m Rh&aHp,0Dp,0 k  8pt` (@ @p@P )@L!(<2@a!Ra  @P3  /'0'PJjD00QH00a[ 0 `00$@ L0 00P ),@"L,(,"@l1S00 ' l @Q3" ! @ P  @\8^6GR@$ `(00 ÿ '?'Q JD^H >P ($0?''P'JD00^H  @@$@< \@a(@' 'Q J0(pSt$@00P8 ,0,@ CP,0ɡ$c@D@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s Bz?zT@^ l @- MR JRQ@@00 C Rj n! 0 B Rj00@C T:Ra@R 00 C RY ! 0 B RV00@C T:RM @ .RS00 C R? ! 0 BR@00@C T:R7 @ P.R=00 C R) ! 0 BR+00@C T:0 B@ R* 00 C R n! 0 B R00@C T:r  /R@1yyyT ,@  K-P8 )|5@rL7#(lb@cqW w c2p@S30S Sr10@x\U@QEjd0UnJ @Vr`: :BSp?01D@COR@_gf0@pPcVp@CI?4I2ISCA?1CB@X@BY(1Pi02@ 1P0I`V0S@@\@-Ԁ`LPV:P[P;2Pp@JcpW*d d`V;0K0 p@ `rqP`V0# > q?Op@;P7&0^0QQQQO-MR`Xp0" Q A B@pT pQ0 T  P< 0 0@<倁@ 02s`.LHn౪lW@RG8?hgBh/ B  -) ,* -CR BབkCBx/ (( BSw?*f 0 sp)` O0Pza`r."b@(97dd 0=]%.0`Q5][/!@ `@ *),8"L\?H\_UO!Q8 5@!.+N 0#q"!? 0U(<2@0:.+NQ( %@!".  pCP  @  3(@PMSK@P@ᠯmP2 ʏpYPyd 0\'.0@Q\@Pyc p0 y Ozr@.0tr@P[p{}P{c p0 { oar`.0[rvl[ & &J/0 !!0@ [!iIIQ p@A!AP{d 0\(.0@A~\wTЍp{d 0'Om\@D.0g\ pI>@HII%Q 咓cAs AB@  @C0p 0R00p Z *) 8L\?H#" # N Q @ ao"!/\O P( @  : NQ @  "2p C>! Q  @ 3l0 0W ` ` @ 1pG@W$`  @ЍH(O-M, (  $ ` $0Q H1R/@"b1Cs@T<00< 0uq `0QDO kq* *BS D/PBl?H?U 0 0ot,pP- `Z_P) @!FPJPU>qppp  h00`\Xpp@ p$0(,   0ipЍ8ikU TT dU T 0H-@P<;8 80 0nogPhU0XDcp@-@`Pc RUP TPOep@-R@Wp@-@PQ<!1 02o0QQ eP p p @QdQp 00 B Pu`Q  VdQppTbp@-P@`g( 0@gphR O-MM@P`[ 0 U" 0QpP _eP Xp l 3/? 0nU/? 0n8` PIPE Uㆀ/? 0nQnpf,v(vOlvhvdv6x60k,08D Hvp& ffpPlJcPllX@@| tQ垏c dH$,p<4dh0pX(Pplp@@D`UV%VT- lppW Jd BQP :[ P  bP |/|? 0nP➏0lpV EP۰@ `t P *`@0`@0D P:$Ttt @ZPf    l   X`dx    < |  ddxd   @  $@*T 0D Q `PP@0D Q:xh`Prxt ( @p ph`e[ P _]8@ `Q QPMd D`@0@ Q#p!`0@ Q:+31/ @@@)ʌ'  ˌˌp$PQxt ( P p  Q PQ h d̆ h  h {kP@0 A R1P@0 A R: $QR xt ( `W p R PR h0h0 0h0P  p    P h p䯟P  h hl hR  @  P h Ph l0 h 05P hhl hl /aTX0 x0P p Q0TL h `^`C^D`V㐯`CP T h  0pPW LXАP PX Id`<`J      @|  Pq hq `   ; ~ QL hL`1 XP @RP h M  i " e Q4 h4~p `\%P hP h `P hp  ,  B  > P h>Pp B`P AP A@ A0 A  A B A hT@ LPD@Q\E`{P+ h偡   0d`PL pY@<AqXP PXA TpP-hhPpX\NPE`T/ ` BHQ  0GP<  P rY@L 3 P+ Q-Aa P\` gcPfFQA110@000 B0$POB@@$ `D``T\``P  H`޿AR  P\V pRPn Wl@0pG R` @0Pa W^U-0EQ$0Y AP\4 LD@E@j  P h@d  P  h @^  P hQ h倡Q h倡P h偡P h0@PpL d`D0@@X`0`SP h  ]Zx ~0`ڀ^@`.Ppp A` @P @@ @0 @ @ @ A`80.pQ:pP!xʌp P`Q80.ⶼp LhhPD@Q`P hOP h HP hR`P hP hP h p@ p5P h qp-zp>P @ @ p @0 @@ @P @` @p A A8ࠍs`pJ PE >Pp @ @0 @@ @P @` @p A A8ࠍRp' 'Po hoPp hpPq h op0`WXp`p ^\ J` n_P `@\Z `\p&/? 0hhhLPD@M GR,`H 40H  -8% p-`p& p ꨂ R  @F P @ 00~ <T\ 0 ^ L dQ R R Rj  *2 !2 @!S`+  0H`R#H`S L 0dH p@ ' `TPH`RH`0Q l d Hp` T`H``@eZ-h\hLPD@ ` Y  RQl [ TJpK]W[ W?P00 ;:pP: QC p&\P=  D T@X/  P :pP$ / ? 0gQ㞏 p[P t/? 0wgQ➏P*    Q  :pQ P p[P C/? 0IgP➏P     0 Q :pQ^ Pg p[Pa [_pWm W?P00 ::[M QV  v[PP  D T@/  P :[/? 0fQ㞏  L[P !/? 0fP➏[ p|/|? 0fQ➏ IRGR0?P00 W:[ Q  [P W D T@t/  P :[/? 0tfQ㞏  ZP .0 ` Q4:`[ /? 0IfP  L" \PQO`   0 S0刯 :[xt/t? 0 d lPvX<``L@@PT@T`Q@:pQ/? 0eP paZP~ yM`0 %, `00 00%Q. S0娯 0`.:[/? 0e\`OPg  0Z0P00` /? 0eQ➏ G e@GL\`@G/0  S 05:[/? 0e\Qr  Y0P00l r@ p Aၮ!q @WS`0Rw 0sqP@LH`` \L0<S` A   :[/? 0CeQO  Y P  @ <FPQP'?R0000M:0`[/? 0eQO7  ~Y0P006 @F V` R :[/? 0dQO  UYP   001f@0`4S:[/? 0dPr  'YP|➏@< 0J! ` J0 s% ` ``pT `0 R : 0@`!p J00 ``0bP0`S 0TS V  0Z0L  g 0S ` ``p➏P @RR$>P00 C:pP.> 0MdQc pXP] 1 D T@0.  P :pP -= 0&dQ㞏 pXP /00㞏 c, S :[ -= 0cQG  _X P A A➏P`dP @@D0TST , eC `\@D0@@ T0CdST`@@d @@RD0 d:pP +; 0cQ p XP qhC 㞏dL` `FV`VR 0`:pP@ <+<; 0mcQ pWP V`  =B 㞏d@PP*: R00 u:pP *: 08cQ `; pW\ P 㞏\x F V`  R :pP )9 0 cQ㞏 ptWP     垏&``d\!A\L0V``` `p5@e\@0, Q %Q.0 :[(8 0bP  )WP q➏l H 㞏0s`cs'ڨ7R00H:[|x'x7 0bPB  VP< te\?8/ D T@ R :[&6 0`bQ㞏  VP  G=> .  >d. ➏ X<` @@ T @TQ:[LH&H6 0"bP  VP @md=➏ JRPRȥ 5P00 F:[%5 0aQ1@- 9< D T@<%  P :[ % 5 0aQ㞏  5VP UL< F B W@W|$P 4:[M QV]=;pD T$$@  P :[#3 0}aQ㞏  UP 9Q+ [ #3 0^aP  UP O%:#3 0GaQ  UP垏Tp衟 X@J m9pX@P [ "2 0aP  UP lH pX@"pX@0 ( TlX@pX@p@ pX@ؠ E<9p@㼠 b lT h@lPlxP ]Plߍۍ pX@@p@ |8a   $  e\5  / A/ -$6 M64;I@3 E1T ul20.  ( IŸ,ѸMD-\ 5* + +* H-`@PpX 0@YO-,MPPp(( @00 @pWP  %Pp R *` A 0`B0 @ R :$Pnp `BZVU AL L L L L L L L lL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L hL L `0L 8 L L L @*P2 0 @ p R0 @ R:}`0A P2@!`0A P:$Q?V*:vi @@@ca [ YWU`0A P:!p`0A P:$QJV1:O$Q@V :  p00p (Vp^7*^ :  `00p (^ $QV :(  00po (Vp(^*^ :( `00pV (^ p(^*^ : @`00p8 ( ^*^ : @`00p$ ( !^     c^*^ : @`i00p (^*^ : @`V00p ( L : K \  ^*^ : @`700p (   , = ^b*^ : @`00p ( ^O*^ : @`00p ( ^<*^ : @`00p ( ^)*^ : @`00py ( ^*^ : @`00pd (^*^ : @`00pQ (  e ~  @ ^*^:^*^ : @`00p( ( ^*^ : @`y00p ( o^*^ : @`f00p ( \P^*^ : @`O00p ( E^*^*$^~*^ : @`400p ( *^k* ^: @` 00p (^A^R*^ : @`00p ( !^(^9*^*^1*^ : @`00p ( [^* ^*^*^: @`^*^*[*(@PTTX :PI ``X:  00P0( !R0!hhhh0 P0pp00 0 P (@P(@k,Ѝ@H-R R RT 0p Sppa r A`PqQPBVS0U0 P0a0p , ,L"!1@00a$gF fFF PU:PR0^Ba/a`E0p`pf pSW Ua0`V0]K-MP`pV`U @ ^@ ^Q Ѝ p@]@]P ]@ݨ]@Ѝ g*g @*@F]`ЍG--@ VP P(0,&/O0dL &  */O ( Q!UPUpppP `UG\ P Gr`GWP  !G@Q@W"Ppu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P:  z\`p*%O-M-HM<Px `@0pP P> P@ P0p0Qq   JG R    @ P qWp0    HЍЍO0p00W0H @D40vP *ʠ* Q0  L D @0OSA$  8AC@ 0+QA 0p1+A; q+ `+b p r a @  0C  AR00 `0BBD (q`a`pS$@Jp`Fc U@PU  BU@PR80, ` p 4X8\<`P<Q<`P<`CP/ 4, [o Q Ѡ 8V \   !,H "\ = l0 "Q h( "2-  pQ0   `t   Q T-0  pS  +a Q:a  ZVQ@L ` @ Q +`q1 R %B1 B +PP$ ;P+  ;r p0a :Z0.(p$`yPD?aCoc?`(?+ pa @ (p@$` ; p@  b0  Q + ` ; p@ *0 P+;qc $.+QA;KraK#JP$ `@ Ka0 pa Za@a Z (p$`H ora ZPUPE0P 8@(p$`@P%J\#ʜ (p$` <pQ* A + ++`b+x@+;pc+NAB000@@+\ RJ " BQ D3$6PaQPP @ P@QJ ``1P8@ P 0TRT B@DPES Q" P 0UP p0Y0p, R[ [ r``P0pP (P  Qt P 0p,Q!4QX QI o  pQ ` `  `P:@0P @ <P8T; ZZ 3P0P @QP PPN [  PF  P**0P/(p$`Pp9Q^018E808U0PWPpR0P PP' T`y P[ HЍЍ,P,P0P@PJ ` (pP$`8pPP`@0p0EP0PV 0  0P `FP  0P 8@8P    PYP p! MP 0@Px` @P~ p4PQ @P<@ 0@Pa`0,[ @o <4PJ,P P PP,PeQ `[XE4   P3 @  0@Z Y'   P Y  0@` @ !HPpP 48 Q0@ (pQ$`A 0nP 0 P18 04^(p$` PUPE0P z(p$`@3'Q? [=LP 0 P2/ 9Y 1*9Y(p9$`E'% 8 0@u9QS1 8 @P ?<P1EQ 9Y 1E p@E,@ x H-MP`@kXpVUMPPP Q:RvP PQXpЍLXPTPRR:S S/*/*/0H-@PP:P PQ~PP@0H-P`@Rp:ppPgP p@Q   R@U0 12 O- MP QepB`  @ S T@-P 0@` `0V00R@P @ `PA ` P @PQ@JP@PP J0 `P` 0`PU0P0W Q @ PQ@J P ЍH-3A-RM(P@VD@, ` ( JL 0 P ` B` ?W2WԋTH-ꃈH- RC/A 0\R#R! R/p@-`@Pt?p p0 0UPV P PVPB`P  Kp8l/p@-@PP:L L0 0jUIP#`P  aKpH-M؉ЍP H-M D" -b@/  މЍH/0H-MP@P\;X X0 0,U 0 P7ApЍ0(]h0H-@ 00: P:P P P! J; @0000 0S P/!C/H-P@Qb  @P `Q P QpAGwUGV f1 O-M-MP`d0@spH  t p l h`Y NR:*^ ^ ^ !+^ -^@@x^ 0^ xRQd xl00Ph@xh@xI@x0^ 0 H 0 C R`\@TP X ! 0B 0x000 C R *X! 0PBP  @XSD R p`@@T `R0  x 00S S B0 x 0X pP@LpK0S p0pxpp0p0S p1 CL R@P2*0 C R*0S @ \` p1 V P 1V VpW` ` p `pVPV Ёx0P@Lp pPppEQPPP x0`+Sf -Sg`bhPr X0h\ 0 P 0P0a0^ hx0Zh@ P@@X T P a@ p0kP 0kPLG`P05Q ph pQ[ [[V`  50DV h0 p AX6PP px00C Q0Se0x0 0R C_pxPPPH0^`? T: IC%P7llx P x@xx PpxTx\@BPd p  04PEpG 1BpQxh@0pB@@`0D Q`x`0 0C0pB Q@:`F0P{ p&@ h p%`[h`!K a `pp  p0d 0P T`\@Bh@0S)   a p#W /#C HSDt0Ctp P t`1VW0A@p/ps0c    p#W /#C HS`|0Ctp P t`1VW0A@pKt`0# tVPpAY 0RN   a `0OR F~h@Q@~QpgPcx P Xpd0x (Px xXT\@KxT\@t`0# tVPpA 0R   a  |< Pl | `@ | pAW@ |@ | XpB`00VpT`\@l0ES"XdWO HP> lPC@@`V pBW>l PlG D IpD h 08@@m {k Y. DP ``,($@˰ ۶7l R0 @R"[l xTR Tl ЍЍ`W Lt r hp n $@ P  ! $Gl P lP Pl |倀@|H  P s P qQ ' Pa tlT  l  P`l W. pg P`l  Q `A@`TOW, `pPpF0 W* I4PI R `A@`pT*8@Pp@@ l|p|@@Il < l Pl@ |p@|@@@<0 <PM4 | `P/0P, J+h  hb#J`#` y`ZT1D wPlg`@ @plHp|@P @@@PlT`d@P\@@@ T`\@dW U!W]}édU!4PW8@ R - P h P=U W2 0l rqR#*`v PB PUAU9E P49aQ `pY "@@U!@ 0"@PP!@  eP X!@@@ Q @Q K"P@d  P /K-`p@ R 9C P0Q @P*  YppA PI`V0 A P PUpGpHY pY @D` 0 @P @Tp`0H--M@PF  B ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A0PP@Q@@ P :Q```F `F`PU PPR*  T:  @ Q`Ap bpW CU P(PࠁNnI0S " R10\  R/ R /@%'A  A4 !#Aa0 )A#/᰷ A-`V 0K@R!0 R1*@Q c@`@6`V: `0S00CC X* 0# 0Q0!p1S`0F`C&11T&11210Q1:(`Q1!ppW a DX 0R: SA@-MQ @ R @P:@ {@ЍH- a@`P c TQU  t㰎PU P I xtPtPEQLUPP $)d | $[ [  0H-P @!P:0H9dPPQ T L0!S A0,0H ! A0 $  @-  #"!rQo"(r^2"$^@\""0"!0S    O-M?Y a_ pA pp\0[ `QY `H8P `! ?=!P : ἓ6!P: ᶓ`3Q% 爡0!S  |PPQ s`0!S  `fh! Ѝ$`! ꤱ \    ,P31P"0"11P 31P 31PA/A /0H-@PPP@0O-M` @R@` [P4 P[ PA@dGZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` L P@P &Pq r&apW!RPP ⺠qpW EP` pqpP ⡠똡 猁PP$ fPG pT !P:ᩒQ 1 0RA t  A@[ p`WP bpW3P pPP HPQP LEPЍ<Į ܯ Xx 8 \ P d K-` rW WPl  V:RUPvF0`! fP@VPPS5Q:UP)p`V AA Q*pV` `F`FP`pPp0p2V1 :0!q1P fPU @^pS:YL! !P: lPPQ \ǟT0!S  4统$!  ܫ | 0P/00 R @A P/3/G-P pR 0!p`VpA BQPJ   pp3WAPAP0 /0A P`p`pPpVpp PpW: p P*`@``PVP@0@P T0:@ @R p@- P`03P@P3H1T"D1"1T 3B1T 3A1TJ  R @b@P SP b 0A5 S>0 R N+b S 1@2@@pK-- |P kQ Q*Q&V  KL&a@R% 0_G"!0Zv@T0Oo&8RspWB#4WB\@#2p@#1#pW. @`T+r0S`?o"hBvpW2&dWP2U0&bp0&apW" 0 `T @` `@  0 @ 0d302$`R` `Q 3$A5d# 0 @`` Q20DpQ031Q""11Q2 31Q 31QJ ```C R/  R/H-M@Pp U sE@G(E$!$1 0CP3 ` @jxP3JpQ Q& yp%   PV3P @`  lhP`  \00@ 0$( ,@,E)EOЍA BХ p hy0H-@Pl=h h0 0sC;P@PP<0@+X@-@PHID D0 0OCP@@8@h@Ȳp@-`PP0>,!,1 03CaP rP wP9,/ < 0e@CT0APx5 S +S4 ; pDp @;@@@p@-@P8!1 0BP3 ; P0 QQ 8P Q 1/pPӼ G0P @ P ?0:0`aaU;`O` pBD p?3?@-@P`;\ \0 0B0Q QA >B>د0H-@PJ!1 0rBP2P HC @H0P @ P َ0<PPP80  8P%P9 PPqG!$P  5/PP0 @ P0==T h @-@P8;4 40 0A P@7;6<H-M1?A CЍ0\ \ \6@@ HЍ6@@ eЍ6@@ Ѝ  //O-OMPMCYPwpPP @[Q    wP 1CP-CP(C[ 0  p x|Z : `,DpP (8 4 E$B[  RwP P : `X P 1 Q P4P PQ Q$Q4@>P3  P!0! P$nP 0 @, !P2#(0<  R5PX Q [0$4$㺇P P"Ÿr b 2p `0P @XA/QX ou123P7` 5 602 p37 $1$(1(,1,010414818<1<@1@ D03?D0 @Q0?7@6A5B4C;D:E9F8G?H>I=@ J<` KC0P ``  LB 0P` 0 `P  MA` `0 0PP   N@`0`0 PP$ E O!0"`#&P`Fppp DPE@G``G`@Pp0`@Q0`A/ —p APP`P@U 8Q 0,`jP ލ?O>,ލ,O-MP@ ! `2/,V( o0Q 0b Py  @ᰀX]:@ `YTZ :FW P*Z 0 plPy@4mP1   0!P @ `㲀VoY ) Q] QA0 )mP ;@ @P Ng R  Ѝ 'eP  6g P  eP (@Y TP ( B  ($ @$=O-MS @T5p PW` , P  A P,  <O[ Їp oʇ Ѝ 2$p( q"eH.<<P<  p-P ` i-P pPH ` B; . ~ X 0  L \ $`###؃  0H-@Q P.P 0<0A-M@`pQ P.PW k<PЍ P ` P r 0!P!@ P U.P O.O-M ЍQp 012A3 4 HT:b"2 0{:  R RP qY P?0@2? #P0ppp0P0@`@`  @ @p`Pp`P p 0P` 0pP`0  0@ 0@ @  0 0   00  00  @ 0ЍPU qQO P?0@2? #@@@`0pP`0Pp 0 P 0 p ` @0 p ` P @0O-M  QZ @@T:$b # 3 09  Rz RP qPY@ 0P p`<0P@0@P`  @ @`0Pp0P`p p 0P` 0pP`0  0@ 0@ @  0 0   00  00  @ 0ЍP. q PQ/ @% 0P 000`Pp@P`@p 0 P 0 p ` @0 p ` P @0012a3q Ѝp@-P@Q `,`'`p" ,p P R P KP Da><gm`P`pp@-MP@Q `R,`T =:Ѝp & $   +P b@!@ @ b b20 + @'@",;,P Ѝp  ЍpR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/@-Rq0 @8vrspq pp @R*R/0Q:/H-Q  0 th\PD8,"0"0"0"0"0"0"0"^ O-MPR pW9 Pp6!8A@TTP#P3 07 p0oW#@a@T( pP `P TDpo@W ! q  p 000e  pWpW 0pp @dPu0S  @!4q@W!1 0U70 Q  ![+ @p0@ | P"PP 0p @jd@P4@ @  0S Z`a `o 2 cPppZp ЍUH-  0 A1à\1#!K-M`qWWЍ@P OppW R T T  0cP U P i7.ЍЍ 00 !     /p@-`*k@p PV lp p8`.k8`pA-CMHaP@`,[lQ @!!P1 P00,w P:7?- $ j,Pp ,6lp  jp T Llp  j 7@ jj7@P,PCލ:o %O-DMp` @@Q P)P XXwP 0S@PP%7@ QDЍX(P 7 8p ,0 0P(p4( 0S #p $80 P8 ` 0<  PX  (P 1 06pC 0oPQ (P<  0  0㰱A Qᴰ2:Q+Q,@P :b#3 0{5p P +PJ   )i䱄 P[   )  - PT X0P  (HP        A Q *0  0  DP +hL0Q :$$"$2 0b5 0S* r  B 00  @ 0q P ( PQP"!@P P PR P@U:b 0 04 pQ!  e( X    bPH $o LLn   `h 3pP  &뼑Y !Z0Y崀 pJx !1  & <&P! `W pG & *&P `Q:i P `@̑ QPU(  &qW  2! &P `WP  y&qW@ Z01崀  f& %`P娀Z崀p x pM& %P `@X:p l0b 02 =qw5io=qw!'eagO-M(p Q R Qv @P  p   p  E pP@  AR 0 1@`@V:b$4 0*2 $ / Aq R* q`{[@0 0SOJbcRa@HVMJD\ /0@S000A(@ Q R QAˁЍ ( UWd Z J   Pk @@T:b"2 01p P   Py ZS @@T:0b,",2 01p PQ P$P2 @ QZPX  E%W㰡  갡    0P((   0ᰡ P Ѝ((1Q $P @ @P@U:b 0 0U1   P  $(( ( ( $ 1ekI}O- MPp,AT  2! A$P T`@ p@ @Y:TbP"P2 00@ P P$ P}P w  p@Z   AR 0 1  > m$Q@Z:Db@!@1 00% Aq R* q{@ K@00SOJacRa@HVMJH\ /0@S000A@ .$P '$p pPPpPp Ѝ p@-@PQ #P    $Q `w#P    #ppp@-M@PL5H H0 010 0PЍuڨO-MM`p@PV?"2 0 0TUP WJGO PJ P1? F @Y:@/#P 1@P Ѝۍ @XP>%IY*;F  @qYFG    U -Kdp JT$ epD?1P P p尀? '&P P0PpP~eP! P1 /P HX\e/P   P 0{y0@oᠲsLV !TF\`tU @-R@QPTPC%H-XMppT'PP@ ` A  a@ *` @*@@ < U TPXЍ,rR lS @<ArP. p 0Q  A  @P    4  0!@ftTP@` @t ЍuK-`pP@@U:!1 0=(QuQ P@U:b!1 0+( p 0 R0 U:,b(!(1 0(@!pPpB W:b 0 0' p 0 R0 W:b| |0 0'    K[`EyA-P` @0@p00 P& P@p  A q  Y P!   7 1  Cpp<    w(O-$MH`@@ T :$4 0V' P@U:b$4 0I'  t|p` w|Pv*Lz^@0^{ 0 Ri* Rf ^  @p  pPU:#3 0' {QT PC     BR0!@d000000000000` ! 0 @` ! 0P @0@ !``@ !  @pJ@zP :\X"X2 0& H`0 ( QwP"!p R*@z^PP@w`|p VM*p@ w00@p*`@ppv P- uV pP@P7@Pp      Wtp p0 0,&u Q$Ѝ-'Z,MSux O-$M@PpQ `` UJ EP*(EppP=$88PPSx'p#p  0p p P !0! 0n pP `UU U UP U, P{ ($gP @`p  A PP p@W:b 0% ^ p@W:b 0s%@  ZP:<b 0`%, pP صԅP @`@V:b 0C%  u! 0`a` 㴐0 XPPtpr&p pgUU UZ(Z@Y:b$4 0%xQEU,`\\ PuQQ U E  P0 `PU@Z:b 0$PP@U:b#3 0$pPq(PW @⼁`(`pW%Q`P 0q (r =Q(`   p!@ 9$Ѝ 0pu 0 PP1001   `P  Q`U-,`QUE E  ~P `UP @4 ` PU$  e`Py PU  VPt `P@U: b!1 0$㥀[pbp㼰开  !q0P0P0  P> `P@U: b 0#EK Q%Y_e]_m!U[p@-@`PP Np (aP(pO- Mp @PP} `PE  cp@Q  L@崀X  QO R  8 PQ p@W:XbT!T1 0w#@  + P( 崀@@T:b 0 0\#X @T  PxP! P Q  ᴀ@ ЍQ  eO-MPp, @?Py ` n{ 0 @㴰1001    "`P[ `@@T:b$4 0" @tᠰ ἰ P P@D@T y[I  (/ @@T:PbL$L4 0"yQQ @P  Ab Q0  L뼐 @ЍQ P @@T:`b\#\3 0" 5 Q9   @  弱 [s 2! P `p[@@@T:b"2 0K"pP/ @弱0@[/ @  q Wu  2! QPp `WP6 q@W5 [@0T1崠 pDz! @ᴰ@ #PV `W pG1 @P@T 01崐 ( ؠ @Tpq洐 y pw P `@Y:XbT 0 ! `@)/ٿ ѻ!U[0H-M P,@( @ @WЍ0000/ P LP(  *aJa BH JA $8 BX *@ B @/YO-0M p0$` P (,pp `PD@$,  @$0@  $iA`F$iK$Pq (e+@!@ 0S (p  @,@0(Pp@pAq@$ ' sdy'A'pp@eC!E$L$   (`0Q @ $@ @) @ p$cAF$ cK$ @ ` pP@0 ` 0ЍX8XO-MRV `@Q @Pa(UA (F`@D @T,:(P@0p *g `0J` j` j@ @ *@J@+@@D` ?Tp@T :@p@@D ?TpT ( ЍH- M- `@PE РP  Q (p7Q7a(!P\X(I @9 @) @?Q ?!( !P 4 @ @0 GD(@(P ( P2/ PPd @@ @0 @ @` D FP LP(  *aJa BH JA $8 BX *@ B @/UH-'H- P# PP  Bp  B 0 B  B  B0 *c  B  B ϊa0JcJA jb@ AjA`*@ B @/TO-MhX P< `T 8 H4L0@D(< P40(\  $ `L,0|0 00@@\P@TXp@Pl ` 8$pxp,PP t `p Pph @ @堐` 吰l 9)7+g i @ @ ')) #;4 "+9 70&kd0#`0 ` p`0t` d@` @ ` `0b  t%n0! 0#?'10&l@(c0#`@'.`$O%A" "LC "t@ ` 0|0|x 0xZ@t@@@tdd `hl @ ppp堐0xP!p0||@地P#t_b@p%"T\#'P$,0 %P@@1@pPA琰A&pN) "Ay#3%#"Nv=P@P@'p0$Q0t@P+7 P I)GP w)y 9p$KDp'+I G0#KDt0# @ d  0@p @ p0@ @0 0 0xPB| (NhpP%Pp %_&Q p"P$LCp% @&^p'OR(A@%\S@$P@ p@pሠ@@@P0x@P^PP|PP[ @PL@p*AP/o" . L Q (  QЍp | |0 0Ud` `0 0VHD D0 0  Ѝp_`l______< p@-M@P1 0P'b0TabV `b0TP OYbbb0UTXa 0UXX \\\Pb0aЍpx 0H-@P 0a0TQb0U TPP b0 TX!0XXPa0舳 @-@LP0a0XQXTOb0@a 0H-@xP00PaU 0\Q\`b0XQXTOa00Haꔲ @-0M4@@,  P, Q0Ѝ<봲 0H-@PQ09, ,0 0,D 0H$=\ ]p@-M0`(04@0`,@ 08PpЍp O- M80`<@4P PK!1 0@p[tMp!p1 0WpVpT D#P:P<e`cD0  @ZP VS`P Q Y8

> TK QJJTJL= L= t< 0 E0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   i3dQT  Q 1/T  S3K4d\ @-0M@P @,D?P:XD   1, 3PC0Ѝ萐 @-0M@P D?Q B , :3"0  PC0Ѝ@-@4@4/4 H-M00 004ЍT MH-M 0 00ЍHЍ/P /Ȏ  H-@-D@@4@@p h@T @ //////7 //O-4M@`QPPX`@sP!1 0s딑␱އq A ap@`P x @lPP: 0@PQ  0S0 0@ 0R:,`(P A Ald X    (4/4ЍtpVDDD WD~DC\/Z/[/O-M4pP`@Q T +; 0U v(` 0PUP %P T4 $ pxZP00000000x0l00000000000H0000000000x0000000(00000000004(000((800dH0X000h*XO 0H Q 0H Q: P Q 0A0@ Q:   y$$uyri$$m$@$i$$e$ $a$ $]$ $Y W$ $SlQ$P $I/F$   p, @ #p$X 0p(?$$n  c pl$9 $ 0fPp``R`bJP p@Wp$k  `  pp`T60&c0p(( p$0$_  T p `pu5x$`0pp i50$U  J `pS (@p%ppQ `-`C  `o p$E2ppV%5 0 @zp`$ @zp`  @z`$p r $0 RD W W% WL *"&"@&bR  0 1ᆮ!@aR$ 04 0Q0  Z:p  0! J0  Gc z `:  0apN R $0$0  p p$0s   $Y  R$0 P 0` T`F04V 0Q $0` T`4 T4  R Q T0` 5 4 RX T B`4R ARd T B`4R< W` T 4 4pW$ p X T@04P{ppp pp TK \X X0 0vSrTP Ѝ@ BBB7!8[}<<\[m: @ A-@P:| |0 0lPX P`ppGX`WڼP 4/P777 K-@Q" QK QH 0 Q0B pW pBqW s`V`PUpW`W+ qW' `V$P P pP`V QPP R R R RQ O-MM  pP' @t P@IY  0cQJ`PUdd XP  F?P $QЍۍ~ } O-MMPa@ PU`p Q RЍۍ ' 2 ' 2, qpqpQ&`0HX& 0acPJ`PUHdEd   0 `qP`` ``} p| `| O-MMԏ@`Pxt ! PP Pd`a @ Xp0 0 Uh\d尰[m PbpPX` R 0RSR R!RKQ F!RA P; p* J.^/P0JP P  Q#Q Q QQ  QX P  P Zd܏Ph%dᴏh P!?` QP0QaRpW p g @ d`p  PDQ `U  dVXT `J @uf【 D  a @ DJ XKQ U  A`FU  Jd `T @ XἏh\QP\P,dJ(<$ l_P H L Qp @ Q Q 0lS!S 0"vD!<8p4qpl@x`W )Pt  07/PU qPE_PPd` l  40PX4 05\ @DPS@ pP p8PsxP<`\tPPPPq `\ 0㓢 P P``p ]L0 / f\ 0pPX, PHPa8P ឿ`J(V0`J ЀTt$4J  00`XT\P头PPdPpЀX 0TP pd 0d. |#DQ@ (A)/"| ,P P u&Jh0 +P Ph`P\p% aL  _PX01 JP 0 !\h ,09P`aL  P_PHX0 aL x ^PX0 JX0hY e Le! ,p `  +4PJ`  X0" P0jv對+@P  kPip` BK0 ``- Zpf\`'LFNPL``8 %K0  - .`  Xๆ \L($!  X0L P`` J0 XX, `_ \ hYJ d\PP  P0HF \$Pp` J0 \\+ ^p\h l " XP\ 0f 0Y  \LhPU PhZP4  `  XP 050Z Y  PN  `P \`L  L r\L  X0  L\\P  @ 4PV@P8Pこx XHtP$` P PD T<,| 27p  $6`pX6PPaP6J/ | |J+PJPP PPP | P( <P N PJC  4+Pu7D  ) WpPJTpz_J^ 5 X-d  )PP@` p`hPq )PfPAh_ Y`` y y  `X00hPq R :q )PPAV hI q  RJ,#e)PڴAXh1 `a  0 XP 00hY F$CPAp` I0 $ ไ(UPw x $`\`p`!! QX0 `a  p X0 R  ` "\ R  T qW )P6t xl0p00 07/PU qPEP P: $`SPw $Pp` H0 # Rp RP缂hf-$Pp` H0 ``" +@Ph d Pp` {H0 ! p$`$ 0D m-vj`QP X ($@`Y$`刁hQP< H  H R\ \$@PLP V<+P&p( <@U I@F=P ?>P<`` HX0T  ഃ-`< @| &QߍۍbM(d s)   i`0 Xr@ T@t(BsPz VPR 4  ,0 7r@ T@ _"sP@8T0( @P @, 80( H@ `V@P&-  P  D 0,,   \`PP( DPP @x0Pm@lx<4T0,Ɵ c\ \% 70 U0L* P  RP _ P0A06P PQ `;Q`ڧq@v0vPTL0 <R,0/   R& 0`AS006V ``P``Q `;Q`ڧ0q0vPv0@@P0\ A6P\T0Q p 0 P :RSGß 0 xP h40v`^ ( P ,40``B6P @R P ;RPڧr0u`u@S P,AP;` 0TL[@%ЍЍAЍЍЍЍ压P* @P P p圁 p`V *PTЍЍ,@BЍPl5ЍldTX<$& ' & ' ~~~~& ~~vx&xVyy0~~k}}yp}l}\}# % v}# Xyx# 4% vv  X  d   P Dk$ ||p|t|# P||, uutuLuo#l @-@P !RR  00 !0!000T \hhA  X00 D008jDjjjxjxjPj4j jx %P/@-@\P PQ@  P E+@B+Qii|i:+@-P)    , xQp  !R`!X 0@L0H  08@,  hhhhh h  P/0H-@:  R1 S 001l000dd0A0TPP 8  0H/Dh8h4hhh hgg8 ( H-PPU+ ``AT& pqP **Vq Fl  QX X0p 0H``pp8  ,`gTggfgH f4 p@-@Q:`APP pPP0$P8 @(,!P ``  R  1S S 0``01`1x````llPAP\00`D  p,feeeeee H-`@Pf$P pU  PlhAH-@pPC$P `U  lPIE|/ /d / /\ / /, / /$ /8 /$ H-@@T ppQU `aP )pp@@)a)P |0xp t`0p@p`@PP\@@PT@@PPPPPPP,c cbbbbbbbb,  0 'H-M44  0(   x1Ѝ h <@-@P@5< <0 0`@k_K-Mp@P 0`#pW# `Pl*LP00 -PPPPP`P5 `P  Q N  -0P P` Y C  0p P(  @cP P  dPRx|\ xgPG \ @P!  !@V89&  @  CP   R @  W ! !2/p @Y `@Ѝ   | ,   t    0H-@Q PP!0p0K-M@PQ `p`EPp$444hH4\pWI`K($p (?! !`2/p9 rP W! # `P- W+G gP P( ( 0$p`!@`  !2/`P$pP`ЍA-M@`pQ PPW `ЍpW W !` !2/`PG P p 0`!@` O- M@!R*%P4 r  W W( Qbyp `V rpV "PP 0 PpU W 53 3 5 ЍO- M@ZF*ȁQDpowb W U Qln%P' H\ap*powb PE WVH P   0 PV Z Ѝ Ѝ   ЍO- M!R*1%P/ b R ["*V&*P !@0p@@p@W*Q0`P "  0N P [b Ѝ Ѝ   ЍG-MbV* BR P*pQ pTpG  0 P ` VЍ  ЍЍH-@P`Q ppV VP PP2@ P. ` 7oP"U'(xP $ @P ` oP"pU $@$ P K-P`p 5pm  @YVp:|!|1 0P `FQ01P`@V:,b(!(1 0t@@`V: 0 0cF" q R* q`K{@0 0SOJbcRa@HVMJE\ /0@S000A@A薻ϻ׻+3p@-`@Q PPPp   P UP  @ pPPpPpO-,M@P`Q pp U,ЍO6 P Q !P2/p  0<P ,Ѝ !$#p(  $07/P0    $ Pp  07/P p  07/P   Pp 07/P p$  0 p 0P P H-MP@S  `Qp#P: q `V P! @ #r_s 0ZQ Ѝ1Q"P ЍЍO-M`, :PG p  )pP4 <@@T:XbT!T1 0  @q00r@qP0U0 P @TQ[@ ! q [ [ `[P@qW YPp FЍ`[` 2! P W!000 LqWvՔ۔G-pPP GR`  QE@AYt  @t4tQ ڰ 0@T: 0 0]8 00B8E  00B00B Qʲ`0V0B0O-dMP 0` 0PZ@Pr p 0DPi @  ( R p <:,`P `Y 4 A8(<4 7ⴠ X&*PDYzp G,@ <寘0P 0F Gpw榾Y `@Pp`P ` BpPvU#3 0@F`  dЍ P  {0`@,`  000($ AQ7x RQ 0/P Bఀp@p@uTS"2 0E 0PᙞP @Q@ Q]@0($ 0D@PH0 S DpW LP{ (0$pP!Q#*xQ:c 0R @qTrPAt p@ `P\Xp0PQ:  Q$(kP8 P\T C(P Q:  Q$SP P\T +$P\T &(P\T !$Px0S* Q*@@@Q @$++{8A-p@ `PRl 0 0 PEuu pPuRr 0 0 PEu`p`P@uT@z< <0 0EPŭɭqG<O-MpPP% Q *QPO  R Q  0ꀠQ @ `Q< 0P uPP/ pQ: Q pP PQ: 0  Ra  0kPq\ XWph | R 7ll!d1 0  @p pR !1 0 @p欼 @ 0 @0T 0 00sF㴠 Q8 8 (4@◜pP ЍO+Ѝ;ߩ1êk֪O-M4PP34 p `Q `$0@ D`32`A6r6S $^ `` @`F V^P僁 @@PY 8P P ` @"P 0, P@P Y  0!Y `$0?=2Qa0s `Qڿ` p`R pR  @?= 2q"! $p@h# P$ TDp aP T R @C Pe(7R 1 `D  B P\ WD1 \~P7p/-"1@P' t 0P p  尠`  PᲐYHD!D1 0@᱀PIЍ@^P(  EK !8DVT` !DAP @P`곦Ǥ$/G-MP @Ppx(Q`P` #"2 0G P @  c`S <V @< Z @e ? a0"! 0Q#QSS R-`p0 P P O(,P `P ` V P1P $`Q   PQ/ @Ѝ ``P$5 0 0'3O-MM`pP  @TOz5pg PY6 88I[ t Q    P2/ Y <WP b@#  PQ/ @ܰ Y< QU B@u ? a0"! 0Q#QSS  ,qQ O QЍ؍Q|i<G-P P pJbA  A  ഌ8qK-MP$ Q @p@P$p7`A8PP$ P 0,PP p/-"1ЍK,RV 0 0ϝ۝O-MPy ,p($b$4 0@`te#3 0@p@W:k#3 0YPu @@`@Yl wY  p@w=qp`pwAP@U:0y,#,3 0hpP  P Y)`ಐY  Q R@p P p@wpF PP B  App@W: " 2 0`@p@W:!1 0 TЍu`TU wPTPTPu@ `p@w歸qp`pwA@X:!1 0Ypᲀ   P  @`p@W: 0 0ЍЍMRvݝ1jG>י*YoK-@P`pVP& W Q" Qp  RpQ R  0P ᄘ`U Rp Q: 0P0  A P0?CAX : 0 0? PVrᲀ !UU 8@8荘 O-Mp (P @p` V P P@P ᚗP" 0P p PEP @p` VU zP ЍЍЍp@- @P0`P P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0Pῗ`PbQ 0PᰗPV 张`Ა# 0S 0[p0G ) R-$p q(9 ᱐0㲀R ἠ቗P/  Hp 0,pp% P  pQ 0pfP  (P$p q$pЍO-Mp` @PP @R'PP@P fP> [+ (P  0P(P . P$ $ 0PP   0PP@P P  ᝶w Ѝp@-M`@ PpPЍpO- Mp` PP @0P0P 1 @P. 0 0P% 0PᲖ@P 0 0P P  ; @@ ЍO-M@P 0 `p  @<p 0PrpP  RQ 0S R Q Q  0WPwpP f!1 0%Y  @000@@T pl!l1 0 0 8`s0 0`0`AsY@0 :}!1 0@岐P:฀@ ᴐR: 0 0pഐᲠP` pḀ<`QpЍ%ŏNgM֏cюZA-MP`pQ @N@!P VY,\\,\\\/H!R*9PD 70"A+(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍBP " @@W 0"P ! G 0P Ѝ V Vp$p  0 ЍO-$M`BPp@ wQ @p  p U U   P 3 `Pa @pU Up `V P  pT  wP `A Q*  0PP% A`P@7`2p@W:b 0 0U* r  B K 0!B p@; "   `D@@ P$Ѝv  &ggH-4QP p H-<Q $P pp x<@p H-xPh P PL  R 400fRvHR0/0H-Ml  P\0X@0  P 0Py, (0PqЍ0蠟<*x *HA-0S  pp2l  P@`p@@`p R *PU U @-M @2&$& &Ѝ0@-MpP Ѝ T  0<@@ p P OЍd/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/x[ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*/*/6*/*///*//7 */>*/ 4T*/@-@h@*/*/*/*/xGcps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-p] directory ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20250218092744Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfsflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Reading `%s'Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %s%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES ntpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.0--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.0 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.0 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timeread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist