'Viִ gR0aNetBSD/earmv6hf ramdisk 08Rg<  Rg/ht htRg@@<@T 08Rg<  Rg/ht htRg@@<@TU Rght`ARgRgRg$h RgRgRgARgRgRgvA.RgRgRgX`hARgRgRgwARgRgRgoARgRgRgwARgRgRgARgRgRgARgRgRgmD#RgRgRg (08@HPX`hpx$RgRgRg(08@HPX`hpN$)RgRgRgxK$(RgRgRgM$CRgRgRg (08@HPFARgRgRgCRgRgRgARgRgRgARgRgRg!RgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg4!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg B!RgRgRg B!RgRgRg!RgRgRg"!RgRgRg"!RgRgRg"aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg?\!RgRgRg>\!RgRgRg=\!RgRgRg<\!RgRgRg;\!RgRgRg:\!RgRgRg9\!RgRgRg8\!RgRgRg?\!RgRgRg>\!RgRgRg=\!RgRgRg<\!RgRgRg;\!RgRgRg:\!RgRgRg9\!RgRgRg8\!RgRgRg:\!RgRgRg7\!RgRgRg6\!RgRgRg5\!RgRgRg4\!RgRgRg3\!RgRgRg2\!RgRgRg1\!RgRgRg0\!RgRgRg7\!RgRgRg6\!RgRgRg5\!RgRgRg4\!RgRgRg3\!RgRgRg2\!RgRgRg1\!RgRgRg0\!RgRgRg2\!RgRgRg/\!RgRgRg.\!RgRgRg-\!RgRgRg,\!RgRgRg+\!RgRgRg*\!RgRgRg)\!RgRgRg(\!RgRgRg/\!RgRgRg.\!RgRgRg-\!RgRgRg,\!RgRgRg+\!RgRgRg*\!RgRgRg)\!RgRgRg(\!RgRgRg*\!RgRgRg'\!RgRgRg&\!RgRgRg%\!RgRgRg$\!RgRgRg#\!RgRgRg"\!RgRgRg!\!RgRgRg \!RgRgRg'\!RgRgRg&\!RgRgRg%\!RgRgRg$\!RgRgRg#\!RgRgRg"\!RgRgRg!\!RgRgRg \!RgRgRg"\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg \!RgRgRg\!RgRgRg \!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg\!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg !RgRgRg!RgRgRg !RgRgRg!RgRgRg!RgRgRg$!RgRgRg4!RgRgRg!RgRgRg!RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg !RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRg!RgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRg!RgRgRgaRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg?\aRgRgRg>\aRgRgRg=\aRgRgRg<\aRgRgRg;\aRgRgRg:\aRgRgRg9\aRgRgRg8\aRgRgRg?\aRgRgRg>\aRgRgRg=\aRgRgRg<\aRgRgRg;\aRgRgRg:\aRgRgRg9\aRgRgRg8\aRgRgRg:\aRgRgRg7\aRgRgRg6\aRgRgRg5\aRgRgRg4\aRgRgRg3\aRgRgRg2\aRgRgRg1\aRgRgRg0\aRgRgRg7\aRgRgRg6\aRgRgRg5\aRgRgRg4\aRgRgRg3\aRgRgRg2\aRgRgRg1\aRgRgRg0\aRgRgRg2\aRgRgRg/\aRgRgRg.\aRgRgRg-\aRgRgRg,\aRgRgRg+\aRgRgRg*\aRgRgRg)\aRgRgRg(\aRgRgRg/\aRgRgRg.\aRgRgRg-\aRgRgRg,\aRgRgRg+\aRgRgRg*\aRgRgRg)\aRgRgRg(\aRgRgRg*\aRgRgRg'\aRgRgRg&\aRgRgRg%\aRgRgRg$\aRgRgRg#\aRgRgRg"\aRgRgRg!\aRgRgRg \aRgRgRg'\aRgRgRg&\aRgRgRg%\aRgRgRg$\aRgRgRg#\aRgRgRg"\aRgRgRg!\aRgRgRg \aRgRgRg"\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg \aRgRgRg\aRgRgRg \aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\aRgRgRg\ !RgRgRgi!RgRgRg!RgRgRg!RgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRg!RgRgRg B!RgRgRg B!RgRgRg!RgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRgaRgRgRg!RgRgRg!RgRgRgaRgRgRg aRgRgRgaRgRgRg aRgRgRgaRgRgRgaRgRgRgRgRgRgbpf!RgRgRg $RgRgRgp$RgRgRgV$>RgRgRgs$RgRgRgx$sRgRgRgz$RgRgRgARgRgRgm RgRgRg$RgRgRg $RgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRgARgRgRge7qyqSF|N<&4ghP4}+Ox*yuu~zz>04& hSX|vP<{i8 i\fm BiblQ}H <hL_0\U=I-1V'#g%T|W{ vUJrV *PK(2 C>DvN>q0/:ædS_tAl(X loE`Hg5&N?j2/> =5(GngϹ<{3~M<!P] IE9-+6adT6%G8,\]Ӻd ^{N{ON"yp| ZVUЗcK)de3y"6V<䊐_9g7&Lb؈7єWg!{bF!O96|tOjfwr7YaMcv!U)0s3LR@i sI>6n4ht . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4#4 (X#X##Н'Н'(hLL#Н'Н'PtdX$QtdNetBSDpmAPaX NetBSDearmv6hfH-MQ X10 €Ձ@ @PP  R     0R/S SP z\P' `p`pV*0/V:`hX`Xp`pV*0/V: .0&&&4m'(&@&&&h&d&p@-<@@8PPU*P`0/U:pPL&&0H-$@$P@PT*0/T:0̚&D&A-@TpP#`/Cd \P@PHP PQ804 0 0 A/ "| f( A-|tx @lll`PC?pPPU: sP P he f( " !P@H-O-M`Py܉I帹X <b@Qp        x    D , BP,   po`P    1p taP \PDPP$PS << pPU (GP 0P(PP" p p`P` `PP p Y P  X V @`@@@P P X% DP @ X X% P3X;*z P{`pP @P` :XX^9h Pi(&@8 P]`pP @P` XX$P`N$ `pH`pP @P` !XXM ^pt `pP @P` X `XIgI `p`]MpX `pP @P` XX--pF ``@P`pPy P XX0 p+(`pP @P` XX^^p `@Y? AQ` p Qp Q X` X @ ` ` `@ W  p`dI\`pPUP,JD ЍPp@LPزWpU {FP P }pPqJ pj (  PsPPw}PpU] }pPpUvWpf Q`V ~PS ` VᚖP ᨜Q  ` Q}P@ *}p8@Y ?}@Py尺@LPU D}p@}坺`PUqS3}xa`V V`h< 8o(f(Lo(Ho(0o(Do(@o(0 B|p  9  Pp `V @ P6:P:@ /R @ R@: A0`@/S `V  R `s(ds(hs(ls( s(s(ts(s(xs(|s(ps(`( G s(s(L'(   /s(O-M` Pp!Pf @#PY 䵟ԅ Pp@P b٠  Ps ZU 0` @@ P \ 0e#pPLPPZ, P/=@PBP ,0/QV/Q/P@ E0A P:`S {  P Pp/Q  PPP -{{pP0 X 0`P!0#0`(%0#P Xp  P  &:  S) Z U  PܘX : ZC00P%V0 UQ`PA b?2`2P5` PSH S_p2|b Rup[ P  P' rPS 嘘  @&EP   P P LP  PPpPU PP#  _PPP CP0!AQ4(PP Xty  Mp"YzPpEP<"Ѝ yvt 06 E p  HH H0? D  L'  ds(9  `s(s(m ts((  s(   s(G9"A- M0 0@BP   ЍO-M-MpP @y xP, } P xpt @XP hPX`P P`V`U(@c +mxpn  P Q4~ @ p`0 {| (  0$pp  pfy ,`g A`⛟xu @`P$KT4# x P `PP J A,0 $0 `    @TP 况P $D @PighPP $@By+(@wp|pt`{F 0(@(w Zp3 A,`Scs$尀4 wZlpj P  A$D0 ,0    (wPPzJDPG @Pp P(@ YPL8V xp @ Q xp  {wP+մ#Y@ϴP  xPZ ŴPā4@P (P dⶴ(Tw `pU NwPЍЍP TPPPP PW  4wP ⎴PP QPPQ8zxP ``uPX Q|KwPY@s(L' ls(hs(`s(ds(|s(f(, xs(s(1(ts(,s(s(H-@P 0 <z0U0  wP`0wP C`P +`U w`vP ` W PpCU vdvp }C-PP 4@`UP`L'ps(A-M@ `P,^vp U PwP l l P {vP @ ۍ,P XiL'_jts(R0H-@Q pPwP \PPevP <ᙳ0,P 0HA0L'_vts(0H-@Q tP]wP `T"PvP <r0,P 0H0L'_ts(H-B 0f(O-M`!V( 弱Q@mPO =p<5PN `QK   0pPF E 2/`V A $Q B B  ' Q'  Q ! Ѝp XT  < ,@@)`)t-؊")X#=H110)$>H-M0 00  0㩥 0ЍB6 )`)H-M( 00  0㕥 Ѝv)H-H-M8!00 0 Ѝ^)H-M8 00 0jPЍIX'H-M8 , 00  0Q Ѝ)`)$/`)H-eH-M(!00 06 Ѝ`)H-OH-M8 , 00  0 Ѝ))$/)H-0H-M(!00 0 Ѝ+)H-M(!00 0 Ѝ7)H-ld@P! AP R0PPP0PaQ8`)))  /`))H-  " H-  " H- 뜧 "H- 뜧 "O- MP@eᱚ p@LE$P 8$( 8tp(d$ PPHuLP: d,U$P  8$('e@ 08L ,sp(80` ,$ 0 ,3/ p( h$ hz`X @P D` PR`3VP P3#   Q 0`@J!S#(`1#6/H@@@t0@(@  "@ @"@P>G  \ 0R*[ Z ^?`?80 ($03/Pv p@!0$<`_@?``@ 0 P=$ Pb ᚰj  8!(` `1/ $`劰h  @ 0`P@0``@ 0 `8 0 @`P 0@@0@ 0    B 1/vp@ 0y m< @P\UN M`(`)" 6 X'))1) )BB)?))H-  P P> PU5!@  !pP0*B> P` > `Vp  `!(P 81/pd?P 8(1/p0 ꠄ)0H11)))+!O-MLP DCDpP P g  80( @0004/ @p  PpP/ ? P`8@< \P!%# 0@#    *"; pP̑A '%$  Q` $ (  O pWPWQP p Rp0pRp r* @" " A&p  p`G% Ѝh ЍOjqH,D$  $ )))e )))!H-MP\ p@` Qq8( (03/@W>P DqQ>PЍ訃)p@-(PUp@8 03/p`81/(`p"@-M@(8 2/P#8  P 0( 3/P (  01/p>P Ѝ$ 뜧 m8@@-M@$PЍ@4 PЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-M|B p p T p0q<08(4,D"@@$d@Hx,0 hp}!,`P}$PQ@#A3(0 0S/2`r"@/@  ` |1`p!tq@`pdL0 ڨqPUꌑ匡  U0,`00僆P4 `QD@@ 0P JP!@*[6  PP6 E@D6 ``9lPP@ )@)8)H)f(zm))))>"K-pXP @`` Pv O 6式 GXP L Pp>A(?P  0(PJPpP LR /0` ``0`@@5u dd`=ᅇP5f (( .v8)H)@)f(zm)Ԉ)>"0H-@P@4 0  @@0)Ԉ)@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,WL))d' )Ԉ))H-X P 00S S P R )!H- ? h@S PPP'P P/P {EpP p tPl`P hTrLn@k`~h)t)j P)H) p@-@P p|P``P (i哆`dd p8@4m0$$ 4pH)P)f([~"@)8)0H-@8P (PP hgwH)P)H-DD Pnp 00 Pf() )T)@-<<Q@ @0 0AQ00T)T)////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  04oP5PJ`PUЈ)'̈)Ȉ))p@-x@xxPx`t t0````х`Pp<p Lh)d))l)p)`))K-Pp@Q؀ؐl  P `QA3v ``X>P0d)`))h))f(z>"O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPp?/t" @ `P Pd4/H"PP IPf H`P,P(RB  P0,00@@PV !PPP@`Z 'x! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @P.P PPPpPJhЍ PEp2双 XpP`  0Ј) p)h)`)))f(AX[X)\)))z>"H-HL0S0 P0^p)h)`)A-P x xPl 0N^`pAT V@@pW`@V@@P@P`)h)l)A-@!P|PP <`P/Jp!PaX20 L`Gp dPXX ;L`@ :20$, .  )f()[~"oO-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xPTTd 0pQ0W00 pT`R`Ѝt)Ԉ)))))x))f(O-MBbܲP P@P6Pu U0`/pZ Z0 <3  bPC $2 Q `x`F P R R0,P0p02P ``PQPKY  !1Ċ  P00* T@Z%   00 0Q R P0@ 0及 @@8WЍ눆)|))x))f(zt))>"A-@P!PB``P  9P-Jp!P  0S0 p hP\\ HUP 070(, { P*)f([~"O-Mp`P @W% W#Ƞ@P& PWPP P PJA@P*`p P,P  Ѝ舆)t))Ԉ)H-|p@P`T Q @DPp0lj $$ 舆)f(zO- MS`p@p PW%@jP Wژ吣 W0 <` Po @L@P`} `@p Ѝ@ M$ @@PJ肟GYPG`UG P PA p[ᘂ [ ,pPm `T P`p  `0   $U4 @P, KY K@vPPZm/ b@PdN MHG ` Ep[@ 8a [ P E P 0QP @!1/ &%/Ո xxpPED@ 9^Ј))))))f(z>"AO-MQ䱟葟࡟@pP 7p @7Tp`@`` R R0,p00~P5 pQ(A <`@ V .a ⧿*@`TЍ.Hh ⎿\@P0   f())))))z>"!,Ј)O-M`@P ᰾T prhlZ ` AQ` Ap Q; P<8[X -Q` A\P`  @^RQ'p QpQXX\X\Ϳ`V  ?#P 1p @`0AQ`0QX⵿8X X 3`0p &Q0AQ`0X X X⟿`0p Q00AQ`0X X X⍿`p Q00AQ`0X X X|@TPyH` AQ` X X X iЍ>p'f( !CLO- Mg PPr@o䄟T씟tട`@ ~oPp EP# SP`xP sP# pPAP -P$P` ``  02 `@ $P ,P,,,奵`P"QP P !PP HPP,$P} PbqP "Q `X !PPJ P P-P J2 P*JP l|pPTrPB P>O,jP5$P) P`]`Pu u+ u O$P dPPO@ $PP PP01 ᭽,4 ᤽ㅺP# #P0 ᕽp#P !P^ h Xdd {딆)U))f(\)t~/)`((؅)mq))n{)z) )A))))4"H-MX @0H `P JP(%@"% P%@"%Ѝ褆)ht@l'p'H-$Q@0 E 됆))H-$Q@0 z 됆))0H-PT@P !P 8'P /P  @0蔆) A-鰀@P`PJp 0  ;R,R ;Qp R R  Qp)̈)Ĉ)Ȉ)Ј)O-MO 00@ P  00@ R @p=0G=SE`PHHHHHHHtHHHHHHHHTHHHHHHHHHHHHH<HPDTHHTDԒ(H@䏟P8  W !WWP6 PPJ` QpR nR lRg   `Qt 0l0CS  QP`PPJG@oPyJVW`GWq`PpQ nQ lQc`^`pQ nQ lQa`@Q$`pQ nQ lQN`Q`pQ nQ lQD``pQ nQ lQ5`"PP J`PpQ nQ lQf`0PPJ`PpQ nQ lQ_`/ R /P R `, R@ FPP p`PpQ nQ lQ`+ R@ %PP !PhQx`pQ nQ lQ`_Q ` pR nR lR   `, PPrJ`PpQ nQ lQ`P P` pR nR lR   `d UPP@J PpQ nQ lQ  ;PP&J~蟟`PJ P XJ0 PV X``PpQ nQ lQ`8  PPJ PpQ nQ lQ PPJ PpQ nQ lQ @ <PD$3PP p`PpQ nQ lQ`P`0 A R*L)P PA)"P= ` QoQ Q gQx`pQ rQp`` {PPfJm弝p P_J P XJ P `pPpQ nQ lQL`,Q`pQ nQ lQk`Qi "  .PPJ1@P(  rlP("P` 4 ` @P  P ,P  ' P PH wRPP 嘫E PFZL L PPJ( ` P 0`qW`P`Q` QP WP P Px p*PJ)P P} P, $*PyJ, 0RQ Pf PAP PT P )P W  QGpxP P:4 ,9 P P2 9 P P*8 ! PpQ nQ lQ Ј)Hn( P P x80S<`P PVGGGooPPQ Plq) P000(0 P S   PP 'x 꼈)8 P`PJPĈ) 0l0CS  PP P P FQs oPpPJ PԈ)LL PpQ nQ lQ`P PfQ o%EşP0 WW HPYJPILH@ QR XQ Q4P p7Pn")P PTP!J PJP JP!P  [P R Pp@@PJn t$0@00;P PPP]   P<갈))0T[ $Py #Y P Ox#Pj[  PJdQZ  " QpR nR lR  $  Ȉ)PPJ`PpQ nQ lQ`P PwP t  }!P  o oRQLPP^bX ^qY  P Q`AP P<P D` PpR nR lR   `̈)!P  jo oR~Q| P P P TB6GP8V <3PЍ`P)̈)Ȉ)Ĉ)))'!Ԉ)0+"l')L *))!T))܈)}')؈))t~/)h'i))zf(x't'K-P PP`P `p@P  0PPJpPW@@Ԉ))!O-MC儳S `@ Z  @ Z A8 J6Rs0笣@`@dd$ ᣕ`Pe$"Padd1;Z `!P^.Z `GU/Joo[`PPJ`Z7^Z; 0 @ S @%^Z-Z`$ QpP$"P g^Zp-Zp`b`PJLd P VJP<0`Ѝ`Ј)Hn()Ȉ)Ԉ)Ĉ)!O-MY3 РаPpU W pWppW `P @tP  0  0@P pW Ѝ)Ԉ))H-4$HHn()O-Ma圑q嘡@P PP>  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` ))Ј)))))f(H-\ R PP < <0PP( QĈ)Ȉ)̈)Ԉ)!O-MP`  P! ̰PEp @P  @RpP@ЍS됆)Ԉ)))))A-M$R R$r QDbL  +sP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J s3@ 0 S0 0pp pp 0p WP@@Ѝ PtF"s| pp⸳h;@P@ Ј)Hn({)))))f(z>"K-(a@p W\rP" PQ/+ ,BW G 0\S0S0@ Q  j"| \\_TP,e뀉)|)))f(z>"O- M@`Pµ@ P1 Ă弒PP p@Q Q @ *rPe T"Q@H  ` P`@QQq Q @ qPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*!j{ ⯲2P![{ ⠲|#P T @ ЍԈ) ))))f(z>"))H-P D, aA1S000Hn()x)O-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ J̈))Ȉ)Ԉ)))))H-Q:p@0 0S)  p#ʤ P `xPP mP @ᎀP/P /c0 :0  먆))Ԉ)*A H-4Q @0   먆)))O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍK̈)Ȉ)))))O-M  pJ LEpPB <`P,U P ` pP $Q`''尔P! !Q Q %QQ Z= Z, `oP 8$Q`+,% XY pU U ,`oP #Q` PP \R  PLQ p9`Q> Q ` oPl "Q`,& rQQ  R& R< `coPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00"oP `Q' DA,x Ppx wP @ eP!@orЍP<"렆))Ј)))))f(z>")))[)@-@jP 0_x ⤯'f(z>"@-H R <0AT B R @Q:x))H-P  q\Ro MH-M (' 0 0YЍH Ѝ/ጉ)H-,! P P@?00 QQP@T5@1<@P- `PpP Q~jP @@ xP d '0<:o@ @ )w 00(Ј)'؈))))f(z>" O-MP`@ P @P @\P [Pk@PR PQ  PP\`DVPP@@  V0,p00mP PPpP2& S@P"  0ЍOBpw ⵮8PP X  (' (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx PЍЈ) !))))f(z>")H- ʌ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA-pPPP` VP2@5PP- PP%P1 @RDPP P8"P 4PgPPЈ))O-MS%P R @PrTZqbr弲@Z Z 0 <@ mP{ `"0Q@ `@`@ \Q  QQ o PP @PAP P)P P `da\  T0,P00lP PQ;; @,*@P% !9v ~P {+v qxPHЍ @@LsЈ)Ȋ)Ċ)))))f(z>")}O-M @qQ elP 0p`VaJ@V. PVJx!p@`P2 @V  `P$ T@P3"AXh 0(`PZxPl 1  VPJЍ̈))Ȉ))̊))O-Mp`PU  P  01 @` 0ᰁP D `@p[; ` V8 [䓟䣟 [< 0p kP pQ刓pP  0P3  @A `pW W<0  KkP Q ᠒P  0   0PnJ@`pQ Z Q  0 Pi `@ R堡報 R,0p00jP0 dpQTLHV  P (S$P  0Jp GZ  it ⮫1P ߍXt ``❫X P4 )Њ))̊))f(z>"4O-M@0Ps弳弓弃 \P0 &Pe `PD R R 0 p00ejP p$$sQ VhE 0P @^1@Q20@P. bPD R R 0 p00.jPl pHHrQDV1E 0P @' PT T 0 <p jP> pqQ UU @JPf8qT0 a   T0,P00iP PQ**"gs ⬪/P Ys pp➪h!P@@Ѝ)Ċ)Њ))̊))f(z>"G-ؐPp`Pd P $s i#3k\@q   0!؊)܊)Ԋ)f(z>"A-PAQ  1S@pT `j@VAQ4 40$$ 0pp 0܊)Ԋ)x't')Ԉ)O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍx'Ԉ))t'܊)))Ԋ)))OO-M`@P/P`0P#$prEQmKp־br㔒ㄲ ePrPf@PTt<<<<<,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  N뭥@Q 2LP  P  㗥 LP  PPP `P %PP~< 4t"_))))))))`()! H-p 0
af(O-uMM0P`P U&  + Q P $P0T P*^? ?$P  2/P, 3KP   P \P KP   P PP8P4 /P KP+ '   P  ᙇpuߍڍ@+P t#@0^KP H zaKP`P $PVr PVD P( J/ P / P @@/ PppP D [G X Ta  @@  \$c 0Pc IPC0pP   0 qX 尀 ᔧ@P`` @Pp P YPXP   P+JJP L   0p G.NNJPeW  .JPT 8-<="#L H-L="#D4  h)) P )a!)j))f()))\\\ \H-XX0Dd T  V H H0S \\HH-XX0Dd T  V H H0S \ \HH-XX0Cc T  V 8 80S \\HH-XX0Cc T  V 8 80S \ \HH-XX0Ee T  V X X0S \\HnH-XX0Ee T  V X X0S \ \HSp@-X X`p@tPp`t0 T  V  p\\p@>p@-X X`p@tPp`t0 T  V  p\ \p@(O- MP@4n` P  pIPPp`HPf |1@GQPXhT 0<H` \dlş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP KP *\P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X\/PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ6 )ht@|') ))<)@)x))t)p)l)h)d)`)\) ))X))T)P)L)H)4)D)8)0)(),)$)`( 8X,H|)P)')H-" 3f(O-Mp@"P Py P`LP ЍOkpPbPR A娡p@PD,$ l Ee1LP \.PP$ PP " \ +eP SPX  apP@ @PЍ@DA8),D)4))\)) ) 9" 5S \ S \ \  S / S 8 RL R $ /` S \ D)|)O-MQ `VpLPL(P$8<4T HD@ @0, ` PP $k \dppV \.P PPp0PPLPP X`40@Pptp X  R0RD 40R3PP @Px0P|,pD  U  R0H pPS H * ) R,p0P( 0   ᥠx `B?  0`Vᑠ@ oP |@Q @Ѝ`P  Q 㺶H)p)P) L)T)@)<))0)h)O-P P rmP  P `ᘕP|\pPpATe 9x >p UH:>pC0 {=p p` > *` 5[ >p [ U:=p d p>P J p  P[ /pR p@zp@T$ J!t~/l `(! H-"  3f(O-MMP@ה cbp qhPfP hP vP iP4  pp)PEU$AN! dPER>P  P  `+| P ! pUDU븗P Z/P / `prp/QP pp/xPPP`  Q:h\` #P`X@ဗ ))))`()lH-{  0⋚lf( /ᨋ)O-M-MP@P=P <P\ o P 8=P 8`=PG  ya\P=P_ @T@  PJ=IP =P 8=P=P@)`iiT2pXd W`㐄吴$ 0,@  P <p@ <p$@8tXA ,G[=P zy`` c@Pp'pw W  AQ  Pp `YPP 0Dy 글TQy  ;P9p⪋ `$ ;PWP Ǵ A pЀ  A)d 0 L  (r {  ;Px,$ Mpx ;80 @ $;P xTX $;P SP xx@@P<x<P Hx@x@ Y;$W;;@$;P x$;P &-P x$?;P u<P `P PЍЍY@)))f(! .  )))1,%3GT)GA-MP@;P3  p  ((+Z (Vx p R ZЍ;P)  ~p   p R x`0 P  p0` x-<8P p88 80@$o v" )w}O- Zߍڍ'f(8*))$(&7*'`)x7*./(& &(9* &A-~MHP 4PP,` @~,?7P~܍'ȋ)'0H-Mxx @P`P 0@QJ 0~p q5@Ѝ0p)ȋ)' H-PPT4 4Q$$0 4ȋ))(9*p7*\ * H-@P`p 6Pp@DPTWH-@P`p 6Pp@DPTWp@-P@T0 0`6@VT0 0T @  T`t@HH@ 4( 0 4p'ȋ)')'  p7*)O-M−@T|`pP  a6@PpPE`UW@T80 @  @Q *tB[ P@O4@lP4T  07Q*J P0PZ#:P 6P 2P t+P 'P@@!EP@@T JT @PT4T tڌQ ᾭQ llp@ 3 L@ 04 D4Ѝ''ȋ) p))8*!^!';! !O- Ml@PSTPO LP\F0P(!00 !pW* 0〰PPQJ[PWpo ` 0 [0QZP Pxd `   7PJ8@u3 Ѝ't)'))ȋ)؋)'m%"!!O-MPpPPP<PU8찟P@P2:@ 0`PAQJP 0go V 0PP*0 S P  P+( 3PPЍ'ȋ)'؋)Y"O-MMP`VJP@P PrUD3pV C `p~,5Pp̲bᎎH/@@n6pgH/@d6pt ~,4Pr@ `~,4Pp\H /``I6pB`aW WH/56pcڼp`@UI  0_$4! UC lUPa 0q! P 0sH 0P8x`p!!``kpqt p l h d 2p`pߍۍH 5pO08 J0 2'ȋ)'m+#'p7*[#H'(''p'"' #""O-MMD 4p)($28 4p#x2@PPP ЍۍcP02PP P pWWNP 1\2422 2P0JhShchxp{@.P% P   wP l P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d1sP. D 1 1 }1{1y1 1PZ @ @0 j1)@P Q۫X dP @U1?@@109*##|)p)t)|9*(9*#̋)''ȋ)'#3$T$$'~$ $$$%J%%i%<%'9*%%% & &x)y&Z&9&&@-@(p )p'H-@ſP ,( 21舌))F(H-3p H "1c(@-@3p 01@w(p@-MP4@p@PP NPP  P P ` 3p   P `@ЍpO-M@PpJaH0/PjJ 0/PeJ@p PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PP l 0@  0PP P (0/D 2)Ѝ k08*)f((09*O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF  @P/L 4吲" I ЍX''h)'*8*+O- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; M/ Pp[ P P pWP 3/NpP|(/ Ѝ`R X<1/P P,/8*h)'t*Q*+*)**`)O-M`P7JH0/P1J 0/P,J&P)Jn@lPP \L1P D&C/4P $PJ@SP (0/, `0'Ѝè㸰 p @P  @Q @0`3/P 0@PJH P   0@XP P 1P  1P9 dPJrPJ " 00 @/P P@  88 1P P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut("PP p @P E A<  0 @P"F  R.G  R# @0S 0@( PP $ 88*7*')8*)8*8*8*9*9*8*8*9*9*'09*G-AMp/@P P`PaP 圀p ᥧ/P x 0p-PP /P PW( 0n-Aލ萐)))))O-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X "#P=J嘑  Ԍ|NP. (0/P`!P J$(AP C@P   .@ 0@,ЍP帰 EP   0pUP P P !PJX "PZ8*(8*8*8*(9*8*(9*)09*O-M⨔p Za P.J `P+J,0/P&J0kDP "PJ(d P W 40/ `1.RP t$ `ЍCPP\$PJPU PP !PJLi Z % PJ P a.   .p (Pp@/P dP   #TʜP  p  @PP"01,H i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P    q  W J P PJ  P P J pP ,@ L  F 8*8*)8*)9*8*8*9*`)09*8*H-LP  P JPJ(H0/PJH8*8*O-MMUp{`   P `+Ѝۍ@ /PY/P /@W.p#   P'`PJp PJ"PJP PJdv P  `, #G 0$`(+04T@dpGP ᰬaP(  /P CP *.P:  PJPJ ( P  p44 -P` P  "Q + QP0P7F 7+.*PU @Q:P PF P,p 6|pnڰ pn hmf,F R G RzPtQ0P7F 7X!0`*nprPf Pb  @P   ~OF R] G R4  $ 9*@)8*)8*8*9*9*8*8*9*`)8*)b)09*)(0H-@P  R ~ Rڼ~<  <)0lll0 pNPJL P@D0@P  0l7*h)h7*8*o+'̋)p7*7*7*x7*>+@-0@ PR ~ Rڬ~<  thЍ8*2 22!I2zK-8M@0 400 j0p4`j\<800PpP$  @ 0 hP8Ѝ 33p@-XM@F P 08`K\D ;A XЍp2p@-MP@PP Q `P0 AzQЍpЍp@pH-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|.:@-A\Q: 2>. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @8*2H-P(@$q``Q a` S HO`U4`-V$``````V P:VH)R|p``:PXQ! 4``,, 02{?`7*t~/`(7*-3f(3/p@-`Pptt P XX@P0  {P,,P7*8*4f(5(9*H3O-dM/Pof7P `o @P   0U0@JQ_眒ȣȣ|Dȣ̒ȣȣȣȣȣȣȣȣȣ$ܒȣȣȣȣ|ȣȣȣȣT`ȣȣ$|ȣ<ȣȣȣȣȣȣȣȣȣȣHȣȣhȣpx`@(@ȣ[@9PP /0 !Pt4ȣ$ȣГȣȣȣȣȣȣ$4ȣȣȣȣdqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0L /PS0BJP甖ȟȟȟȟȟȟȟȟȟȟȟȟȟȟȟȟ\ȟȟlȟȟȟ̟̟$ȟȟȟ ЙDȟX8ȟȟȟȟȟȟ@ȟ(ȟȟ\T,ȟThpȟ@ȚHȟh BP Жȟȟ R   i `{ `v  `ot lRmR oR pRaR eR8h,|p``8*8*c<N<H-`pW \P@PP` P  spW8*<zf(H-d!PQ! 0 {@T @1`0V (10S Q Q Q 3PP0S P0S≍P `P/`z @/Q @4PP/8*8*8*<<H-@ `p  W P 0/ /PP pWxoddoP`8pP ePCSUS8*8*8*K-P`>Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PP8*O- MM PP `@.T.Pq j.PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K KP ? P  PZP/P wP Ѝۍ .P P P  @P 1 `+VZP P 2.   +c`apW7 @/P PP  l@p.WP pW @ /P P  P P  F @ P.PWXP'><8*8*(9*=G=w== ====>8*2O-MM@` &pP+sX  @'@P(P`'` [h 0EPa V3Q V* V3W V1: Vr P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  >Q \R\&R Z:Jp '@` VBp+ P ZX  T D Ѝۍ V*' Q pP P   '0  V ` P' P   +'' P <<'0 o  o8*_>y>f(>>p@-@P` 0PJ Qp   0pp0H-P@P/TN@N TT 0@ U:UNAQ:0Q0N0E>H-@MP@Wi`X0P8<040>0 P8<04020P8<040&0P8<0403s|ßp tpt, JpP  APjJ ;pP  2P[J ,pP  #PLJ pP  P=J pP  P.J P&J p P"JqP  pNPP p -P @PA !C@ЍdAPP PE/Q *`,V`  U L   /00B B NNR@P̿$,  P qbxPdP+8*f(.?$9*09*P'!''>j 8*)8*X"Ћ)?8*>6?@-hh h0@`TiHP |0P j\=k9*8*{?V?7*8*H-< +P 0%=P\CQ] PU hP  P#=0<BQH 0S  R> F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V RD9*/>3H9*L9*A-@PI `PVE qP= j,P7 #V \V `#P` -P`F(P P!=x(pEaV Q P(P `P@ 4  D9*/>3???A-@PI `PVE qP= ,P7 #V \V `#P` g-P`=&P P!=U&pEaV Q P(P `P@ 4 ? 9 H9*/>3h@@@ @H-P `@V /pW PP`VXpP0 F R :,VU .V+P 'PA`VH(P W`Pe bRCR MR mR cR/pP KR#oLp Q LpUP R  `` ``0  (p RP 0 k-4 d-  @@AJA.AmAL9*P9*@@H-0@PS# p .SnWpk0SQZ`W Qp!@?Z`p@ QI <t ttttPP!@k@d  P!@P!P!@ P!@!@Z p0 Hn(T*0H-@P@P  *P @0X9*AO-MY; CJP5 \2:BZРL JaV p !  !  p`P @&P- `eP% @  `Ѝ   +< A P Q `,^,Z, X9*qvAH-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @T,H,X9*qvK-`P p |`AT P,,@U`V X9*0H-P@P G )P ll `PXp s D 0$ i @0\9*8*p"8*'BAO-MMAQj pG P ,wAT `P  ! 7  P5  IP5 @T &P A` 0QJ P* 0F.*p 0aP  @ x   F @ 0T <@ O+Ѝۍ\9*'3DO- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ q$PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0   $P 0p p ``  d9*/>3h9*CC0H-@P@P = M'P@0p9*DG-MlP =Pp aV  0 $@ Pp(` Z Ѝp9*O-M`V9 @L@8<@P!=KP ! # " # " (0@ #P p P P @(q $Ѝ)ЍO:p9*/>3GDG-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  ((p9*/>3/G-MpPP/P` !`P$ (/#P pᗂP @0 @ `P Ip0H 8 ( ۍ7*{Dt9*DO-MP@T) 嬐嬠`pP$P u  p p~P d(b(@TЍt9*9*'''  Q /x9*H-l0S ^Q 000SQx9*|9*@- Q@P d  ΁P L<q 0D @F30'D0H-@P <P0 Q* P0PR PT 0HO-MP+ P`弐@p@PP P@PL 0<, ,00 0ЍE,7#EQE'E9*O- M@Ps`PJMzI( KAQ:D"D2P,",2   d  l , t 0 |  tpe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ Ѝ9*9*9*9*p@-@ Q P`&peRe #p@O-EMP j@Q dlt|eQ +@Q@P@dT   p d u@Q:P P /@12 d S0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 d0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 tGIpD: @Q :!P.1q0PPA@W@Q: AA0 U(\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 ,1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0    h,'@PJPJP P@/FFEEE9*kF7*FMF//0H- Q @P x\ 'P 0X P HP8Q0  0HVF3F9*|9*FO-MP@PJMInj( p |Y!R  +p/  KAQ:`|#|3kF@5`#`3  + d  |  "p EFzGj  H )n H)pt ,kp   (啐pl  mJP1 @R0 xD  ( cK@Q:gPxP1xP!  ,`Q\QE KP    `@   1 ,  I  'PQ  !&"&p ( @ /R     <04KP4   Ѝ9*9*9*9*|9*G""/G4GGO-MP @Q :P P@P# dPP  @` dQ.P%Q#d@ApQ /Q @ X+TT }XT Y  ſ`/ P%   }A d 㱿0@ Sc`2 375pHlDh1 vX 4H ` &tOI@ XAQ :!.p1A0ppATp@p@Q:& B0 !&&WQpv0 @`qQ :!.`1q0`W`A@p@pQ:P& B0 ! ,4&0I0`< f  |QW:!.`1q0``AW`pI6pp0| 0 PK d h``@|Q :!.q1`0``A@`W@`Q: A{A0 , $p`pfL|Q :!.`1q0``AW`p`pQ: A{A0 ^ l @70 r00F<$P !   0 L`jds`Q :!.q1`0``A@`W@`Q: AcA0 % x#e,l@rlp{@Q :!.p1A0ppATp@p@Q: AkA0  #E0LpztpQ :!.@1q0@@AW@p@pQ: AsA0  |"&!@Aq:P@@Q :!P.1q0PPAP@WP@Q: AA0  "0@ߍP0 㔍aU P  /X)`  /\PP}PP@@Q :!`.1q0``AP@WP@Q: AA0 v  }B@PJ PJPP p`3 P J @ yPJP P@|9*GG H9*H2H*H;Husta F!YH7* cH9*]HA-MMMPM `@.  P+㞽 U UX K<0 wMލڍ |v^"9*9*H0H-@P P 0HjHH-MM A0 S0Q \!@ 0P `.p*V ?V.`pp\pp0` Q0/P @0_@P$J P0_PJx @0|_P JL @0p_|O@ЍڍHn(#I.I!f(1H- ^[f(xIO-MP@X`pi'TTTg\pp 5eP qPrP vP xP0 VPPP RP fP iP! pWP dPpt p x`V`PЍPQ+pPW9 P7@Q  /Q@ pPP/Q /7Pp.PP .PP P ZQpWPP4[@[n(PU e,再p@P Q jPA P /PD +?P@ 'P< =7Q & k. Q0$ R$ $ R Q  P   P  P PP QPt ;PU\3Ls P0p XWP@ +P0@kSPPc䲟p`@ Q @@@@@@|Pg X Pa 㙬`Y4Q X PO P P] P 1$QPA p.& # 7 0PQ* lP, '|P$P$ P?P! X $  & DQPP PQP  <`ߨpP~rPP  [%P !?P PhrB%D0 r 9*9*I9*9*9*9*9*`(J9*9* 9* 9"IJH- \Yf(9J /9*G- M@P \A@P$P"D`P2 P P- P( P$ `+P`P @Pp P Y@ob ЍpT PP WP4`4剈 0{\9*9*9*I!f( IIO-OMM`@Q  p  P rp PP Ѐ # "!Ѐ # "  Pp\P 01w pQЀX` XPzp X PX0P 0 &ЀX` XPzp X PXP 0ЀX` XPzp X PyXPq 0iW WXj`  PR  OpWPIWyPA 09РZ{`)V`: ZP `j YPZzJpp`P TTpp: S,,pp:kOߍٍ9* G-P@T #q` 2pP pP4P* Ppp/P PQ P p/:: P W r"`( H- ZWf(`JK-P3rP  pR吐G';` ; ;DG!0 aS P KA:*9*:*H-@Q  0Sdd`P@' @qW rP `pPA9* R 0 S$A'  A/A9*p@-P@U  QX`%#!PP Pp:*:*H-lP@hp`Q `'VPP Hg:*9*:*H-@PQ  0S``@' D @qW P pT `A9*@-@P@K- aK@7:P 1S ppW1 0'PR,PP 0 0Tp ` _b AQ y]`@T K7: :*9*~J:*J'p@-d`P@Q  R @RP'Up9*O-MAaQ8 pW4 ܐܰ@ =P @{8P P ^Eb AQ ] HH w^pWL ЍC*J''J0H-`@AP aP@00P@P o @ L C*A-Mc@ >3pPPQqQ Q, Ql&]Q] PAU@Lh $@LlPP @G "p|2   Gp ppH04 G@ @8R %p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     x:*Hn("p:*:*:*JJH-M@P8`PL㔹P  IRNP  ㇹpP  べpEPP@@@8PP8Ѝp:*x:*t:*|:*$K0H-@YP )RR0|:*H-  7t:*KA-P$@. `p P Q @ AQ /9T@Q@ AT  Q 9P`@ Q9@7@@v@0 0P\o '|'C*H* K-0M@pЀ,(e`TV F P :(( 0$@P0ЍN@PWV  F008@P( `0CV ]:*G-@P넠 %Rpo`#&P`DW@ 0W J|:*@K:*@-@Qs@ |(4X|| Y # qV PL 0v^R R ^" #o( ?@ d2 0TQS?@2 dS TQSQ!!R .," # 0)KKKp@-MP`^@`P T, TP@ |@PPP |P R P    RЍp:*H*'r""K!K-@pPh`P7LY@0 0|:*:*K-MP@#` 0BS0P RpToo "WpP 0Ѝ|:*:*K-(MP`@p!PW$WD W_ WX 0p~'GP:$W= "WA#PukW9 WoUC ЀEVeUFaP'WP'pWAp&P TFT 0o᠂; 0/Ѐ 0(ЍK'FPvU Ѐt`'V'VT PlT [ (Ѝ\K|:*:*NKwKO-M8ȰȀP`pB@ <  0?@ DR0 0SR* @Z 0pD`PP PЍ:*|:*`"G-Md`B=peP P,PU& `V+ pWz Pw @᯶pᬶP5` D D#᝶ $P 1]PPL-PPE \AP@.P.PP/P, ]P P# ` PpN5PJ  P  Y፿Q Bp  t`PhЍ@0PPP'KC*:*LL:*A !$LĐ"+LKp@-X`@PpHP < 屮PJP 4pp@:*:*=LA-@PpMp,`PP W p6QP XXVPY@ P@P n:*:*':*zO-MP|sUQ$CP lSPHP FP  lZ hZ@ᤵI4Ȳ"b@/Q PQ P@PY5@UP U/P@DpWF 8R8 PQ /Q @᜾P P+  ᔾP& @P%5@/P @P5@Y\T1T   t/R@pWT p@-^5p@P4@/P4@P`P -t3x  Yd Y@PDP Ѝ:*:*'|'C* !:*:*:L=L:*@P/ 0RS /S  00B /:*0H-M@P P/Pl|p wp 0#" 0"#oBލ0!0H-ALPd;pPP2LUk7PP0P$ @V! !{V AQ ʙV V0t(%#!둤 C*AL:*UL'vLp@-@ \2`㑁P 83"P P2`20p@'3TpDL:*H-$Q  HX H:*=LLG-rP`V lKP XEPo`Vl P @T7 \T0@a DR01d2,3 2l2t2 2 2 2 2 2 2 2|2 2 2 22 22 22@3\T1 0T `@ P0 BR6!Ar@q#\@` P,  AQ U `V@ @ @ @ @ @ @` AQ ʿU @`@X  AQ ʮU U! !l' LH-P6 I:*:*H-MP |l   DP 86P8Ѝ:*:*A*' MH-M,  0 Q :*@-000@Q#dV:*:*MH-M  0 H- p:*M0H-MP@ 0] p@-`@P PQ:Pp R* qV P  iVV  oVT J^VTJ p|UVx@ AQ T <00 p@UQ PU':*:*'a :*! 'p@-@P` M@-M@  0 }@-@w M@-M@  ݿ Ѝ@ Ѝ/0H-@Pѿ 0Ht MH-M   iЍH Ѝ/ a@-0P r R P  R @ V@܎":*="  0/:*:*:*:*A-P$@0 `p P Q @ AQ 1T@Q@ AT  Q1PPQ1@0@(:*'|'C*:*O-MP @0 !`9pP P` @U ^PZ  P d`P09PP! 0V(ZЍ=H*l'':*:*O-MⴣP@`^Ug P p0댳儓Q<;t<<<<<`;;;P<P< =0=T=T=h=T=T=T=T=T=T=T=T=T=T==>^`P ^`PPP" ^`PPP}lP {Q^`PPoP PU[Pm0U`aPa``]P YQO /P KQP CQb9hP :Q0`!*(P *Q P !Q9TWSP Q ``3o` 0 /P QPTP 6 ЍQ`P$R'$E*:*:*9N'lF*G-MPPP !GRRpW A ` MpWpRdR p`%FP D@KP R R RP6P3 -@p H`PP  UKPtP P ^RP\R,RލE:*'H*G*IN'N:*N:*:*:*NK-@pfPP) !)G4R2R`V Q 4M`V%RW!RQ AQ R XRdQW'`Go"D(P W' UPPf'PWPP ^H )PP KWPP 00 FQ8QKR'H*G*IN']NlN:*:*:*pNO-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍ:*':*:*O-M@葟 ^P9.UQ`p`pW  ^P `!00[P p paxP& X&F1QH/Q -Q AQ *Q =|Q AQ Q VQ S;^PP P P [PP, @ -Ѝ':*:*:*H*G*ii 'K- MP-a   p@W6 P2@PU   P PUpW P @PxP^P@ P  @T P^pP $@@- ЍH*:*':*O- M@P ꀑ&&pPW7 ``P p? R &PPP VtIPJlIyVJ`pWP %c'` RDP ЍVJ^:*N:*:*O-iMxL$/? c,@_ aT  aopP :P  @T p_W _O`:P  pW p!P pppH,tQ t 0t1 t帾>6 (R PpPt(ptAtQv dDO|QU2 D~=` @  AQ ʅO @@4P @O AQ oO ``OP @UQU dM`  AQ PO `OP `U @T \`v AJP@ `TL AQ -O hOpVP[ |PK tL`Pp eP$PU<<`!RIpt1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ pW@ptt $pP@Ft V$0/P t$` `Q @QC*`PP?P PPXMPxRjG$Tlx lYp&PP Tl!$P l8JP8 lPhdT P wLxxP x d P P dhsGxx@Q *hi`P Tp%Px @ LPfD80!<( p@ @`DP80P ( @ `6KHЍ 'OH-M@P`pW'㫘`qpG@z)F  B+@   D6P0P ၧp0Q P.R 0r0S , \@ЍN@:*6OX O-MP@/p 0P {PP 0S럴P U8  Pp:9`P㘰WP 08UPP }P y P p PPnP%  8`pGP> ER:UU ~$ @0 :*:* H-`@PcFpW BpV T{% +_C*:*O-MX) pR%pPPP :PW @`Q &P`U@  ከZ/P/Ѝ p WQ:Q:Q ጦ@ЍO,%'|':*O-MtSp`@5-b@Q'ggdgggdgdgdgdgdgdgdgdgdgdgghhdgghp`@PW2 ` RU pW P  ,RBP PhhhhX [ Z V pWdpo 0P PPQ PT P P+I !pW=oT pPU Pjjj(jX[ Z V poPQPd|Y:T@HP 8GP PPЍ;OC*`'F*:*'EOK-鬀嬐@p PP `Q QQ`PP|U:P P K:*:*`':*K-M RlkPK h  p"Q 0'P P Px'P /P  W YA P p   PPe P ~+P 'P #p@ pY( 0`@U0 @:G7 p$p@崐`W pp@o p@RPP W    Ѝ@崀`pPp@op`PT@D!!bP pP?#, F*O`':*O:*:*O|'O'[~"H-`P@P `pQ%V SP pP@蘙"H-XP@P `pQ9P pP@訚"0H-8P @PP@P0訚"H-XX 0P R RQ U 0|S:`':*K-@܀`'pPQ Q:P P:QPPPP %Pv'&P`:PPp@<@qVQ`UV Cq `F*O`'A-销P`@T pPQ@p@T`|V:PP A:*:*:*p@-`@sPP PQ  PpP p@p:*:*0H-MpP@l0>00  HP P Ѝ0P Ѝ0H:*':*H-0P QpQwO-MHT`p@(oPP VP`ppP vP@0cSo  S R X s@@ `@YCZ @` QP4 PP8 @ `Y \EXC ちP CIEP B AQ ʶC `Y ptCTCP {0 `@ P5 @ `pP{| |0|/7P$ P0 ~@Y&]@YECY|YhY <D @@@P .*C@XQ&YD@ p  B`@DTYPDhD@ `Lp@@Ѝx`pdd cS OOC*x"LPzaPoP'PF*PPP PP P)P>PPH- ~H{|'G-P!`1 @`!@1q`!A`af dR\0P0X PP= @t AE ap` ><p p` W p'ppQ*l  Q 8 C*;*;*;*;*';*H*'|';*@-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  $  DP`~P  Qp F ␄   `P<UځE P#`TttTĂ4tt p U :U U =UPqpPp P ᙟpP D AApPPp PP|{ up<pP p@Pp=P pP Pxw`P0< @Q)pQ&sP] PTSP('0PpPT p~PP=U PpP FYp Ap P; P:9  p. P lp P'PPp UPppp Y P`pЍF*'|';*H*C*;*;*O- MD@Pu 48r0b@` P]P @Q9:P @P, T/@b PT3  U3*@T T`` @yP% H P P `PjP PPU: @ UT PP ` U: PpW pWQ P   Ѝ;*F*';*"G-PJ 0Q$a$(@ >RR4 *R[R?R p P - P Ӷ GPP P P  R Pp@@T:*;*;*:*0H-P ,P@@@@Q0;*H-t@P hPh`ppP P cP;*:*:*;*O-M P bA_B2p☠P[ 9[ ځKQ:[ Q W [ [ /[  AQ c1EQ ЍQTQ ]P YCP8 ~EP టpZ y P p P*p P PPPy/PU/P_|';*'C*A "O-,M P( $o = @    P&  OP. p `( ( * `Dp6PR0C$ V7 YC0 |( @ eC( P `p Q( @P50AS p*P@P p R =p$P^ R"Q P PQPDV?<Pj( `F0V0`,PQ^ԔU  `p P PG( |P:( PPU`F R (,ğ0PC `倐@ c! !@PP ` `@BQ7*$Ph  0 L tXU o `Hu P ,P( P( PPUKBQ0``````d$pP XP@2$p!W( pP 8( V%-( 10p0 0PApP q|!a 00 A p@@ A ( R @ 0S S@`VW   S S00SP,Ѝ  4: 0DSʌ, R #R  d \  C @ @D  0딘"8G*;*|';*C*"'QC*H*LQoQ1Q;*O-M \#\TPc0P0 ß( @ p#E2"Y p  2倒p唢`<E @@PʼPoJPDP  OpEP TPR p@X X@`VPPV A E@QPE` `@PʊP@D`T`PʠPP  P p P *p P@@PJP P PL E w4PP0P Ѝ':*|';*;*;*;*:*C*":*O-$MXX'D PHP@c`@<Ap`pG崠  BQ = @@ 0@S "R   @ $Ѝ;*|'C*H*H-hp`@PP Q Q (`P @P;*;*K-$QPD  P aP p@@P P VP P`P  Qd`dp@@QP 3P P;*;*:*:*G-Pq Q:PP U PE` p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F P`@V 㳥P蔘"O-MQRp `@P   pV p  = pAЍV P (` TpLL0 0뻥$$ {<';*C*;*|''zPĐ"QO-M((pB`PW*(QBP   WP` P @,dPğ Yp `P^V`ZpW:!pEW}: `PGZ`@P wQ  0S Q:ppW*]pEWY: ^P:GZP wQ  0S Q:pp`ET<* APZ Q@EP`0 D` CW P@tPl`@Dp@@Ѝݤ';*C*;*|'O-@Q:   `p[O[ `@<ЍQ"p@-M`P@P*P@P9 U6 P2P/!P@P@'0@@ P#@@ `P=PPV HV @0U PP @ЍpC*l'C*O-M`P RP,P! @ R0LH@P% ?P -P@TXwaP P   P@TXl`XpA0V  0S0 q P P! q0S L"/LL  ,Q!p4     @ i!/ J @. P@@P.@`:- P P@Z  j/JpZ @Z@P-`@P-|@P-X p< .P@ / TЍ0+"L@*5rOt'U&U+U4U9URunningSO-M X`P QP NPv,QP&@ p`P P T  Z  Pp`WЍX@`,V `(pGj ,'p'R @*@*@*O-M좟RpP` @pwPP ThRhh"`VpЀP PD 0S8` ` pw$ Wp P pW \  \ `YPp ppWp P  Q: ``p[ RPR PU:` 0pPQ" P P 6 RP QP`  R XP0P Ѝ:* @*@*A*'':*lF*0H-dP@P @P0P 0H0:*:*0\  L\ \0 R\ 0 Q/Q Q p/ ,Pp//O-$M@LTPdP nP pP[@ X[  .P 3PPXpsP#0 `V ``@`0 P``P! P`P PP `PP pY P` PrP($hp R 0  R Rp AQWU Z Qpi pWZ  p JoP  P2Go" [ Q 0QA0! 0& pZ  YY P[ pZ  -p[  -l6Pp\*p$Ѝ4 SSC*C*S@* @*@*' SA-`APpiPP gPPjP pP`pPX*pPQSP@W DDTD0@ V P   Q b,PPPp`ЀR, AQ `V 0 0 *` V 0 0VP,HFSC*S@*5rOT0+"q 'S@-(@Q3P@`@*XQ @Q 8  AQ /0S / @*@*@*`6QXQ/HH0H P@ 0 S0 +'A*@*5rO'VTG-0BP P `PP`FPVܑP P RE APQP @:P|p`ۉW  0P R:{PpQ! P0`C0S @0GP%PP c@,.P0   XBPP$P =@* @*@*:*:*'?*H-Pp`D{@P t  0 0B`TA-P@`Sp ' ! 'dWVV47(4(UP*{"P'P  NP UP(PPCVp &&W p6P &&&TLt$ _/+A*:*@*?*'p'Ri!Q@*A-`@PpPUU@V  X@p8NP pV pPpA*'l'H-@tPt ` 6 RN`P2`Lp`P.@*'@*p@-@ddaPP rQ $Mp; P !DQ 2 , P Q0pT 4sPP0SQ PQ Q㥓P PLP p赓e ,:*p'R@*5rOt':*04 N RQ Q  P Rh'@-@QhQ XQP 0S 0RS Q  <(@* @*@*@*qTA-MPP @0P R0`TPp$ L  (8p@HPX`h P1 PpW SP pWPVP PHP4J0P Q P sPh|s`hP<@ $ HPSPT`V qQ<t 7 Pl`VT31c$-+Q PPPPP0S `(IGP  0s ڌ @( P`2PЍ,*ЍA@*!w TTTD TTT k_mNTT P TTTii T I!TTTTTT %!TTTT! O-MŸ` 0QxR| <[ځpK W$@Pl,8LX`` #[ $['[ =[K \[ @[6B"[V\@/`  PA@0@D T: PA`F@PApA  b@} "DA @ T`,A) @ " @"p0QGT@p[@Q$Z @ P@ PpWp@ @[  "=@A: }Q"A0Ѝ@*@* Uҏ" %!UUH|"TT UUp@-P P`@PT P;8PUp!O-MP L <P ,$R  PvAp` Pk pP` QP/Qd@PJp!0REPBP@LaQ* PPP:PU aPP `Ⴥ Pʎpᝃ t` P%` AQ ʪ%`P@ ZЍ: @*F*F*Đ"(@*:*HU'|'C*"'O-PP TP Q TPTn RT`TPK50!(C*C*'XXXXC*0H-lP6iNk\@P vP럻(0( P$ 0H}0'x@*!XUA-P``Q{P PpPp$P@@ @`C*A-@P PT@ TpP @7TX XT@R@LBLr`PE0 W`FvB AQ qA ` Q E P 7`Fv]tq`Q ểP `VH @9X P  1 PUR@ap@ Q` Q  R `V@ AQ j T 1pW`V PAPPU RpY'X YX!XG 'Xj XY/Y0H-l 1@T PHDQ R APUP0'X!Y0H-@P P PP0H0A-@RP Q-Q\P9 Q-Q5U5PBQrQAP `pQ pG`WQ PMpPI -GH@DX4aX< XBJX@/@ 1@hpp!PU:1S A@  0  R QB 1Q  PTP 88 C*5YC*YC*:*:*YFY@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 C*C*YC*YP 0 @-T@H<QPP d:*C*:*@-0A Q @P  @C*H-MPDP0 \ 0 0ЍbC*\YO- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `Q1 @  P@@1  3!?`PP0p @ P,` ` PP Ѝ:U H  `:`$PPB'YY Y Y0H-@P 0P  PP P!P P@ @P^@P0 l'?*ZH- H?*O-M \ @ TS P @ T*` @,P( PpQրP pP ĻP @Pw [GA@T Ѝl'! x"O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍpl'p8H-@   l'p@-@`4P P`P `0pl'O-MQ[@ @` P     @  B/o"D`fp @  pQ  kX  [Ѝl'?*"p@-@MP@ Q `v P x "0`0` 1"6 `}vTUJ(8 1$ 0% Pl'"[[[[\A-pP P@PT5@DP pd9PP @`PP%Pp`P @W !l''ZH- 0l'\O-Mw D @ P$PP@;5P)))))))X*)))x0x0P**x0x0x0x0))X+x0x0x+x0+ Q    Hj w P KPEP2   ^P5P!| P  sN&Pj  `PP p9 `PPU pP pQ P,QB HT$P Z6 P -P 08A P0`P    ` P\P Php~P pQ`0     Rc   PQJ Q0P`p  4P1p QQ@p`0j P @Q* P QA P8 f  0P Q,QF Q"0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  @ Ѝ}P PܰP0`p  ` P P ptp @R*PQ  l''06"p'ZH-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8p     F  z   P `&l'F[@-@P@ 0/0S/00/ᔘ"H-P@-@>(    @ l'O- M Q 0 ``hR@p` P'0 @  W p V @   ` R =R    QW0p$@@#Q 0XQrPK(;=<=><==L>HP>>;|;PP< @PP\ [PZPW&PPTPl&U0@ET2*0Q0P@0Q~0P@/ P Q @@pT"0`00a 00a!0a!pf(Pc`P(V@A" @T"0` 0a!0p 0a!AR P p@\  Rx Qx< (7P9 6TPU @DP)P @PA 0P  @QZ @P@PP{P  `@{U@#P#P}P@)Q PP T PQ PL0T000 00! 00B pἩy)Pp! B!w @) 80R8x,p!R\P`P?p@Py  0yp\ ER0p@J8S8S8S8ShKBH8SHI8S8S8S8S8S8S8SHK8S8S8S I8SI$II8S,IU@"P $P }PQZ TA 0P@T @@7PU @D4Y p %@ @ TE Ц@P@5'UP @$*(PT ጯ借 U "U `p @ `w }PtP `` N.@P`PqPc0E Q.@P`P^P0@ P3NK H`@PMPCPpQ pAA\ QAQ A xAAp50!1 ( *-@Pʉ`p=Y Y}U ,P@Pwp# #U%U #UPP\/`L:U!p  pPP+ LPP UG @D@ ]  pP P+@!R P IRt+@3KY PX@LT"1`Q 01 A0 @@A@AP `"Y@@'U UUp`P P?@<P*?U \U\PPv   p@P0@ QR A@Q7P@a@Q1WP@pW- vl'@@Tj0001|9"000a!0a! ꒗"|''d'""C*UP$ 6 P3 Pʡ`P[%@p?P> P<pA5u P PB\P 'P< P pP@j@d?*' P@p@P'PPꐖ"%P%? %#@Q Q@ p B [%P%? %&@ R R@uV%? %)@ R R@?0%6A R RA?0%3@ R R@pA ?Qm Qk p B  dX `@ꔘ"U]J%? %,@ R R@?0%9A R RA?0%6@ R R@?0%3A R RAp@? P P p B  A??P p: P pP p:pP@P P P P@P` @pP<PT F ,@  PQp @*@QPЍP P `P wpp "p WWp>U WpC!&P |P >P #&P >P <P@@m ` (-P(  @np PQ$` @@Qrvn 0 oP*ljblfHdPb@`4^C*|'d'l'"""Hn(C*ב"?*\\\c\\;*;*[[|@*@*z[O-M|P  P P<j  4b4r4R$80P@@T:T D P@,TxUxUTxUxUUxUUU PpTt 0\T P! R0% T T  :;T" |T>|P%0p ЍOt!)&P&P ;P    Ѝl'?*d';*;*"p@-e\Ppx@xPx`_ P08 0Q 08  N\P pb ip@DJl'd'?*p@-H@8Q 8P` AQ S`8  R8 pl'C*O-MM0$`(@0  0A,p PP!pFTW0A @00l@PP ܶ`Vu ttpPlDlt(  P L `[P \P`[P P $P1  P  `  &`P$-p!\P `P  0 0$  ""P` P\P\@PʷP`@PʮP̂(p`EPz @PpPPtVP`?V P   }PPu PAP`q@Z   lk똁@ 0@P\P $ 81 1SP  AQ 6 @B AQ *TP@ @P @PEUMߍ 0 %^0P 0]$0 l':*|':*:*'d'C*?*\@-Q @>@Q0H-d\Q T@PU U U <04 P00l' ?*LG*F*d')\K-MP@ 4@ThpPU ` jЍ`uQ X<P ```'|'D*D*A\O\O-[M `p吡<րu|TP@7P T@րL4`PD PD ,> @`@`P P9& P P Q QV  d`!V 0\X1hAp@րn8T`P[ߍ˴:*':*l':* " ]|' R/0S /<\/0S  R 0/D*A-pW |@P`pQ@U U p 0PZrWD*H-p@PR T%'&`W VU QV\Q@v$u0( ჴ=  0|]]x'H-p@P`A @P`O-MP@   @ *3 U ppcppWWpP Pt ,P @T Q @P Q  R XF P Q?  ȧ"P|C PXP 㳧@pI ,T @TJ 㥧@0A p ȡRP W PU~<P QB 8P Q  R6  ip3Lt P PP/ Y@pT@ }ЍQxtppW XpQ < l~/`(]t~/Q!"]!^j^^@*|@*<__,^'P^O-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP 0 @S[U H u<ЍOpЍ' ]!" 8! Q!^ p@-@Q? PAQp`R @P``D>Q <Q R <D@Q:P P r d' RHp@P-"  d^p@-@PP QU,pP Q  R עp `Ѣp l pU o UpoW ( Q D*D*^p^@-@P @(#P lPJ!0H-P @PP$P$ 0gP0^_D* A-@Q @P) x`xpP  ?U U @P P@U蜧 O-M@P PP3, kPP/PkPE kPP#dtP@P TQ <PP A@@T@@ U`tjP djPpPU`PEjP I:lPPEYU@U%Y cēSă@p WWp@WPT W0 T@Lp@@WroᠢYPi@YP P @㰲bR@P*pY Z P  P dDPwH D GP @PeP P W q|PlP tT |8Qthah@pP P T j T@p@Wp@@WT p`@P P wE@@T@Ѝ-PPUPv"O k_$D*:*:*$E*^_'x_;!z' `c_! m__H-M@DPP 8U`Q U PTT TTNPP UP`P`TV T6`P`qT`P PVЍ xmp Q8NQ> T<'8 :V V Vmp U`V D?P:]m 0p  @P6QHQ `6QP`$E*$D*A*'C*(E*H-@P`pP P `p W:8 Q P HL:*$D*$E*:*K-Pp@HoሐR`P P F PP %`P:XK$E*$D*:*:*HQ/8 0S 00S/ <R:/$E*$D*0H-@lPT P Q& P$!PP tQ PT TTT 016P T,PʫlP0$E*$D*'lE*lF*:*:*hE*p@-H`@PP@Pp8lUp(E*,,PQ /PQ/$D*$E*O- MqQ!1`Q@P(QAT  J{P;pD\PP PXPZJtn\PJZ]Pp @%P`P5 ᎓pv 勠@UU)~%i`  XY`P RP:9S`P pYDA\ |\x@pZП r"pb'Hn(zVbv"b6 !"!bH-M( 0  S㱟':*b@-M @ Y R 1P ! PЍ bH-4㌟b'0H-@M⦯@T P=gRP @TÒ @0@ >|| :x@p 5Wd0d P` ,PP, (H $@Ѝ0;*;*40 cY'Y!XUXcT@- P  }@t   Q  =PH@HHH H0 0P N :*;*;*C*D*l''''''0H-)@@副L 0@S @@Q*lPJX R@@TP,P 0H:*?*'l':*(E*:*0H-MP @  aP   nPЍ0H-PW a@PPK xLxxxxxxx`xܺܺܺܺܺ((ܺܺ %  pW pW Q  uQPUPU PU ("p@-P- P`@Pi甽@X @G 6 Q  00S) ! 0 00S p("P/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /ṯP/O-M-(MP l@U!%TPP EQ [p\  q%Pr%P  tm*Pt km.X @*P|@@(Xm@X `Xp.aHP@D@@@$`P j q" tV P  `P AHPT@|<@@@IP $'Q"Q x  A tH 1A]p$⦤$@ ` P  L q t# L p t  4+S +S t  0[YXX hP`P ƮO40S0 pQ Q Pllllll0a,&QQ' "Q& 'Q\Q ' P  M   Q?^n vbtfreQ^@-hgP`P TpP MPPP \R R PP0]S 0S MS ^R+ -R PPP^S" cS} " &PP0@pp 7TQP @P%PPPA P cl Hq+ t,  0l$5P0p 'psp dTt  +S+S J 0Ft  @ PDdPTt  2/ + p@ T@ x Zs0p w  0 0 wg   'lp p|#pP\P PE `@]P 0P" MP^P -P `^P cP'   `#@ ?P `` 0pp 7S00CQ`n 84aR 6 kP \P ! A AQ ! 00 nP Pfpp$A AQ  ppR@!/  =`p LPpp`E& #(ЍЍ%XNP pBT ` !s',H*(H*z "`(4H*0H*d[ PH*H*8H*< gp8;"3 .`KP% KP5  㣠`pO"P+ 4   O"P ` _XJ XH pP : /  P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMo<pQpXPEpUڈQWWaW&00;p pT&,P  ₃P  PG@P* lDU` : :%@5P0|p P PqO@UB<dU PP`U0P5 U$ Cp;PP@GP! &U  pQQL  U @PTf/BT $  㶭@P @@S#h pK tp@ -4Pp 6N#PP2(4PJPUi PJP oRUW ,PO Pf2MC` V PPb LX B@P @  @P 1 p P NP Pπ]A!XPA` d2@Pd@\F  P㭀FBWD8<@ PPptn*H*n*H*H*n*ikH*H*2l\"gpVpqkH*H*H*H*t~/kkk kkH*H*H*H*H*H*'`(H*L*vmdQl N*f(j a!v* vv!vpQ!(v?l lkp@-@P2IP  PQl `U UPT`LPLPLOo0BP 0@ p@p\"nnH*n*H*H*H*H-x`xP@tpo QQ P 0D;Q0 T c@n*n*H*]qk G-M\P`L@XLLPp  0` PVxz "zf( @-M" @@(P l+d!0!@"pD0" 4;@N]@D"t匞@ЍgnР"p0H-0@v P P$0H$!0H-@ P QP ]P3 yP 0H *p0Ȩ"PCP PPtPS@P@  P ( P0(H*edAL*rH*4H*H*N*rO- MP|0X@ K Rdd!PAP( =, @90 458 (14 -40 P"!"!4S !4S !4S  !4S !P0S d!T0S lP= 4TqTa P1  0>a0p 0 0S !S1 P   0 Z: ᘞ ЍO?ruf(u"4uuuuumuu uuuuuvvvvР"!BB0v+!O-M@(P* ,P) 0P( 4PٝPҝ8P,08<Q4<P (RGQ D弝$ 㴝 Ѝ㭝P (9GQ 壝㟝8 R*ᖝ8` aAQQp@BP p``Br 0~v0hS pRa`P R (vm<Q ve< Qv[P PU*v` R 0 0R*0 Q*b ?p pR:ppW:|blqllllllmmH*mImmmnJnO-,MM  (P P pT8P@lZ@[& :'=P(K (( YZ`V ( sFP  nFP9  iFPf   PP PXV  8(@`P Pg @`\V:  0,P 8 ᩜpV* 8JP% H`( ܣP  ףP  ңP  ሜ(p YXV @P T  0P 8 ap\ @P({h@x(dV`(d\ EPd L EPb < EPj , EPx  EP  EP  EP  EP  EP  EP  EP  EP  EP  EP | EP a`@VP x  HP:($| @ 5 Ө ޛP 0FPFPC ?( 03P3, 0&P&8 0P0 0 P L< 0P (4  z4  0P  0P  0PXs  0P e 0PPX 0PTKV*V:   0( d"( Q` (  (dVV $fX(VP \@`V F; P P  EP @[: P ("! @!;`(dP# <,X(P  04P X ᱚp@"T:@  ᩚ4姚@@ @(t PDDD( ( =tP P(  @(l!Q P ( y(@!Q qC ( k @(!Q P ( _( Q WC @ (R( Qpmp,Uo,Ѝۍ 9pL*vxPR" &wHw>(!Q|twwwwwwwwwwxxH*?xn*Р"Hn(vxxx_x$xwWw0wȂ͂wC""vp@-MaP@H.Q)`P @9pʚGP GPQ  &pڄPPH8 p4/@Ѝp$$٠L*WEVH*gdqH*yqmdQl'H-$00S H{[G'@-@Q f/;@L*%C@-@DGPP PD P P00@賷@~]r5rqq  'mdn*O-MS+4 *0` R PZ8`KO놔X @+pkB I!  dfQ f/g;P{4Q ,P(P  Q "1QPpQ: P |PM 0F\!1QA0DP= H 05 P  0P1 n P! @  @< f/:PɯcP dڶ ߍN*H*n*rVEWN* }}"sH*WEV+sH*ssH*f(H*H*esrO-M`p@ PPP@,r P4UP6? QQQ Q Q8/PP@Z Y  QhP h F@ߍ8P 0iP 2H*=tSttttH-P L*H-MP1P  㿖p E"QSЍssH*H-MP0P  㤖p E"Q8ЍttH*H-`@PspP RR! P0R* R v LL fQ4> H*n*N*L*tH- 0,S PH*p@-Mh` R@4T[(萢0PЍpp4   n*N*9uutH-MPRP@ p`pE""Q  "QOQ QQ @ЍHn(0H-PP @P <-P TP@P0xG-M@PPQ 0/P $Ѝ /Pt` 0/p8pP 0,`pP   L*xn*xp@-M@PPQhX` 0``P $ݖ `Ѝpvn*x Q 0P #:r/ Q 0P #:r/O-M-1MPlTኟ\h0p!X (  P p ((D `6 P> @T1P@0@aT=:aP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ ᪝P `"V< QX " @]0S  3/?`@ " A@ mB*      p P' AP@haV :GaP @< |xP4"*  0"q "Q<!Q* , !A@ m  B*     gpK P <0 A { rL! H!Q <0  S(! 5,,C $ P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍY{l{T"p_!w{D" @QkH*f(n*ʀM0H-M@P 0֬\ さP Q Q  9Q  Ѝ0HЍ/f(0H-<<<@P J PQs `0H@T"p_!||p@-fMMx0@+p <4< SP* Dc 0 P yP<<fߍۍprdA|!}|p@-M\@`X\ 0S  P nP yP>Sۍpn*8} 5'0H-@(( XP 0Hf(H*H*O- MMS% XuU `P!TpY P ?P @P @T[YP:8”  @@@  0/p4 P  㨡  MT̄t `@(p P  P tThpt `@( p P  yP l(Tt `@, p P  `P S,S堃s `@0 p P  GP :0`S<\s `@8 p P  .P !8S؂r `@4 p P  P 4Rtr `@< p P  P <DR@r `@$kpp P  P Q嬁q `@$RpW P  P QHq `@$9p> P  P 0Q䀟,q `@P  p% P  P P@倀` PpT P : P sT Ѝۍ6f(H*"_}}}}+A"}} ~#~F~f~~~~~4Xx9Vp}"p@-M0@  0P  Hۍp 0 XH*f(p@-Mt@xpt 0S  PC@`P @3H3@3H3WQۍpn*G H0H-Mh@ PP yPP 0[ Q4Qۍ0裀qO- M@P P|X `@p`63P@pX P`P1 .Hj P`H@;TP:daP `pP @P` XXX Xp A6c Z*2P@`pP @P` XX @T Ac`@P`XX  Z Ѝt@6f(媙H-M@p $PP7 oP`P_ bQJQ#KA P[ (7,87,8,8,8,8,877kA P (7,87,8,8,8,8,877D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 0':ă4#p `V00p d%Ѝ@n*ԁH-P@ R!~0 y0 t 012X   0)2X  0!2X  02 8( `P, TL0 HH8 <D4 0@< $<$8$ 4$0$,P (T $  01l!R@p\`Pp  pWx 01H3ꑂЧ"G"ǂ̂Ղ%4GP`oɃAR"2!O-MpW `S 8@T,PU5a 0@ !R! @ Q;<;<<;<;<<<@ IP P=,,3: 099G9@:"T@ 0@@8p,P9D9pi:P"@ 0@pn0@a T0@8"  g8Q 9 ^<P@PPY+ .N@8 D -:Q TTH*TTD  8@9  @ #< P @PP+89Q @PP* 00Ѝ++**  Ճރ0"A.  S[hFH-`@\(PP9 00P p 0pW:H1n@-@< 2/R f/820WEVp@-Ͽ0 3?0/ 4@04@4@04@4 2/4 < 2/< $/$$/$$/$P 2/(0P T 3?2/(04T X ,P0@?Ͽ2/5_4O4X \\0 D,PT0@8@4O_>8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:pH*@-@8P wf/1H*@ 0S3?S q R3WEVH*G-MP)ڤ 0P0 Kꈀ刐@p P pa 5`;`@P`XXX ypGwЍn*"f(A-< dd0@T 0/D DDP`H0p`F vf(Q̈́" K-M@`8pP Q }8p||`   ;P`Pp  `2/ЍKo    ̈́"n*n*r* K-MPJ@P *PC* ) PA*e<  `P8pW< "Rq1*w1L<  ㆞P&><"P p# 0 ` pp qЍT  H `T0 8$0  օ"ydr*Tn* :|O- MMP@($7P[ 7P 7PCgpp   P} 开帀 Xpp Y Ġ ( P [(DC QLP XT 0`pP @ppW` 0QBBR}  pp X  p@ 0(X RXopRZ` 0㴑`Ao pW X9 `XP KpX~P&;$ 4 p  0j,'n PK!/ 0ᖫ 0V`pX Ѝڍ ` &t0(, DXv!5!r*f(ކwdn*xd %>m ( &!Xn>@-MP@  g(P*DD MopЍ,0( Y Lr*{dЀn* p@-M 3op9    P @`           t   \@ Ѝp< r*td@n*· +0X|H-MPxx@ np P`T 0 `<Ѝm r*zd@n*وp@-MP%@ np , npxx塪@P ` 04H L0C 0 TЍp7  r*d@d@n*,>p@-MP@p`5PP X5PHo"@  jnpЍp$0  v 5r*wdn* O-$M@䑟Pq` ᝡqP p eP]PW儑 @ @@3np аP Q P*ᧉP> @p  np )Q# )0 ' p0R0P P`0p   `@V:Ld$Ѝ(( 7l~/`(ir*|dn*{Tʉb ۉl@-MPH@D m8p  ,Ѝb0r*d@n* p@-MPBPP? @`4P 4P 4P 4P)` h `h`U\4P`HH smpЍp00, 5 * r*udn* H-PM@` (7pP( Smp (7V V(  ` R& ;mTp` H0( PЍ(4 @ ;r*}d(@n*C1[~"@-M@ P PPn4 P<<  mpЍ 0  r*vdn* 0H-*JTR0O-\M@PH7\e\p 3cPQ@Q:aPl@Q UZUZUZUZUdP plW ER W rGoldW .kp acWoW$PdWc lW Q0 -PQWD RWD SWH@ %  }lpMpWM rW @( 7 %Y   y%P@ @P `PUpP@N@UD`@< Jlp(XH@ R% ;lp  @ E% .lp>pᖂ@ᔂXX"P m Hl@ j4"0KjP{Un jP@Qi姃Pf T "@7AT `>Q吱 `    H.P& @p @.w| P (Pn ;0@P pX  +Yz\Ѝ3X  T 4 `` 렊t~/`( &}D7ER!yaratcidf( e|D({Dӊ~DŊQH-M6 ,$0    ċf(O-$M@P5HXA  d$  Lkp= `P7 p  ?kp0 P/XpP`Y ZU'GT  0X[Y$Ѝ Dn!! όČ0H-P? @P{ P P P P2r P P)} P0HF@0H| 00HPTXF{P0`{4 scidtcidrbmngntsyaraloob {c&!O-cMPo/00@ϟ娯00/0p☏嘟o40,00000(` PTŚHL  R w  ?B   Pz:g`P /O(P wpP  pI 0W[ /8(P9 `6H@~D0 #FP hP6J#jp  4` V. V. *hP UP# h D`P  p ,V /'PP  p (l 3RP!a@QjacXceec^e^eedeeeeecceLc^ cee^4 0@Q&A@Qbeeebbeeb/800lP8P~QxQ|bbbbP <<Qp ʃSP  `/X'P p x p`/K'P @(iPH  P\8 Z<*?8P8P 7oOP0 PEucߍld/pMPQ+pQXQ@4Q@Q9$Q2 4 0 崆 g<( R( R Q(  /o"Q`嘆EQQ! P-b? p dP @b? p\@( P D@qhPH  P?l 0[pno"@PT fpt~O0 ; p3P"+w@|Q@PhphOh/ Khp8XD8D/Ahp.4uIH!L1  |p@p   + R< 1>R B ?0|(p,00 4p.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rl 0 P H U,Vfp  ã4M`f @ T sLP 0-P P ]Ln/'o,U  @+2,| ,P P <|l\ PP,0p`0p`}0  P  P  P,PJJPU@P Ne|ߍ@|P pdR8bp? p ppp @P 1!P !Tʘ'<QQQ<P`@Q}(*<0@DЍX\LY * *r*,!r*ڣs*)*r*r*!s* ***%8GXhtO- Mp @ R,PQ-t ЍO<PPX<@PbPPʻ 0PUP  Q Pᴻ 0 T * 0 ЍOP; ;tQP5|t)`p ᐻ W  0*P Q}@  0W   0*@plWP " RJQQt;dOP ЍL ЍODr*r*9 * *HR x՟r*۟cH-M<<Pp)<,!,1, 0@L0$!1 0@$0ЍH  K;0P@ 0` p`P8;|||p|` 0p@@ PpXX X ЍHr*''0*4**,* ֬***8*us*s*ͧ˦* M0H-M*徺@@PP|P P p @P Y@oЍ0H Ѝ/ ]f(G-M@Q/ Q, pP`% P%& \  p \?) ) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ Ѝ%s**Pr*uO- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ Pdv(#B\S BPTv(#m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @sP4 U ,   %Q QP P댰Pꀰ!R$ @U @0 Ѝ4뙥* *r*ܥ*os*W30H-`P@T 2@ z $& @00*O- MLp`, 'PPؠ*@AP 0U $ 0 W PPPP@$ D"U U E㊴` ,\!` G l$!$1p @G Y p@A p  Q@( ?D+! ?8  Ѝ*ts***O-M p> pB1!?! goP 0'p  R,ЍOV)VP 0  !  PG,P UP Ѝ''*EO-kMM%嬵u崕eEP-0 800  ṊcPd @R/0猫`(0lL8lPP- TPoP :` p 0P @T" P" @9   8@$,  @   7 pcC3NPQ nR R oR|"sXCP   L sP@Cep# U A`@  ᗰpPp/P P"2 Pp/PP&  wPi p\@P DP 4P\  0P`:AT @PY.;㜶QpA  p]VP .WVp7 T^uPa@P/"P,*<Y+T밐(!(1`kߍۍX9 < 0xd... | |>!H*P*X*t~/ `*l*Q!pd*h*`(8!K   zd@p*edAد"L"/­H-`@Pᆱpa^  p H-6! 0F'_f(d"A-`PV p@ᅱ( `0"/``}& p@-@P3 PP P P#`V PP `VpP \P P`V PP `V@pK H*l*X*O-MM0@TP `P `V@@lPd \ Q vT p װ 0$Nឰ @P8  dqP0 Sp@`@ F[`P -P = qP p   L q;qpP @ @  a "V  ᙰT JpBP ᏰW P=Tp @P8 P r rV @ L岐P q qЍڍ p P P!pP哐 ,QP y  Yr @ P P7 ?0010A4,Pp[`  ӯ P [  U Q0SPPD | ?p PBT@T P* !h*!Q!`*85!@"@!a! "NH  0/D*@*/@*/H* M@-M0 @   e [rXf(G-p@ԐrQUP 孯`Q P墯 ty`喯UP VUP @) $ᅯD*@*a L* Y  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ۬O-uMMرNRSp@ @, Qp ppJBSP-JPJn@  P*  P oD )pP   p ƴpP' SPZ'%8%<5" #ݳP PRp   P 8D4(l uߍۍH*! P*̮ܮH-M P DD 000[ 0 SЍP*1@H-Q 1/ RС*0H-N0P0 @1Q@BP0跰"ԡ*@-<@:2@O-CMM@ (000 $4t0 0尀p,TP )`P 4/P 8gP P0P  >4PY  (`  06/PR $P , P ,W WPYPYs C/; 偲 p 8 P@R`Pv ᐰ ]H * @  `V P  PP `㷭` ᒭ0ş 17<0A 41,Q,! ∫o8@`P~X>@Pprp W  AQ b P  mWNW YWyWnW Y@BߍHЍ/**ְ*f( 5G-MP娣c  Q.o M@p P  M@PJ4t P  تP ҪtrqPP\"QQ;+\0/`c\p P:P   0`X  0p \l`M PU:P  +`PkP+`P^ `WP* \`KD pP  @0` ;TkM SfMPЍP+`xpW"% %UV ( PP ` ` ` 0M`Qk0M D***ܰ`;5VmO- M0` qNP pW Pup|ptiPPip LpW!URQ Ytk`l @THP yPLQ M 0 Ă1@! PX0@0 ,+iP #iPDpQD#Fk DkBkXYx `@@ P ! `o 0D p Ѝ$^$(* X+HP#,30 40805 00 C >LP;L#HCPPP , (pPR #0 U($!#0Ap 00 < KpP30P<@/l X X $P, ,  RTPL@;DPB QB* " ,B.0p40 40   KPA O A cP3 X4A P `0 R 8 `eV#P hj fj "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@07RRaArrAaSЛ!v(Y@߲H-MpP`g@P p00, 00 " 6KP0< @0!10 00  KP i iЍ07vO-$M`lp 0@P PR0dP p  P PP7 L P p@0 @P} i@0@0@@] LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:hph$Ѝ];tG-M@XpPAcP  d 0!  X IX Q $ h Ѝi0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! M 0<P | cVP/ p5/1/ 7y"O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍ@ 7y"ĸ+H#5Л!@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍеD 7y"K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q `胶O- M`XP@ `P Ul L p $ P&#t S H0/LpPWPwPP    UfPQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0  !  PG P @@ Y:@ee@ Ѝ轶O-MPpP@P;:`@Q  Q P`V:&   0\@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P G6P PP:"R PVB@Ѝ4-0`Pl`<@Ѷ Л!">A-P W@B_`V` _@T@ |P p!00|ed(K_P& (KfD8Q:PQ*" P:R R 0S% r:ddl\`8P $ 2 p p p **(* *'~Pֹp@- @T 0@00T@@Q p 0S @0S0S8P8@@d(`d@@p*,* *(****G-`x0X@XPpP  0   p  **,*O-eMP` 1@P S:PS*h X\4P`0$00d@PL@D 8`DT0Pn `0`0C !Pa@p 0O ! (@,`a YE P[ 8`p YH` HPd@` ( Q Q ( T @ YK  @P/ (D (JHT` @LP`0P_ VPa `8P0  P*  P: ` Pp@h P(` @((` dP<@@Y 0Q$P  \04PSXP P K  P d |@ Q@@ P @QtQt <X@< Q.  0 p R0 PMJ QKP G @ I0\0 oS4P0 XX`P 4PX\  PR4@@ \ @LD 0@@HP $d` X PpT  Z3q@ pq0Q \4Qp\@ XLLq   0 T P} ,p0\h`QlPp3 `T4`` p p\PL`pp @LD \0`d@@d@0U  4|(]8`QRX\` P|\`\X XTb \  D $ Qa*l 0l@ A`PpWPO pE@P?p pEPT0U: @ T@:UHP8`>*  @A0`PpWP- pE P?p pEPR0U: @R:8`U*HP p0SP 0pW?p00P  Q:$X< EHP8`<Q*Xz@\ X4P Qz \P  @\P @P`\` PQP`P@\XX ` dyDZ8`Z ddP"@P[ e P L@@Lq@@!Dd @Ad@P- P < P, = ?LPP*D  QT0 ;O Db V %P v :D% ` !YP P>@H\K`HPQ<D`PX@8`w+P! Xd@@LLp @@AdPE d X \HPddAT:LPT*D  T/ HPT L PT*Dd#P @PP d @AdKdX\HP @?HPT* !0 P $ $$$A@ DLd Q: g P LAPdQ*D`P B PR:dd.Q H P) `@TE G  X P6 3<veHPPq  LLp^" WXP HPR8 QW  Ll;PH \HP d=KZ@P  K/@P HPZHPP #@?*DQQ P LA@@L p@@d \<(d\"\D`"Lu`PHP8`rddLd @hhX\<8_HPdL@dDP5 D   ,P(p@` 0 ! qHPeR @P^dD `  d`T0Q:P`Q: 0Xp!\Q僒TE궷D Xp\ PQ4@@p`=@@@ L   0d``d`@@ LDP  ,p(P 0! R @Pi\eߍxl 0 *f0* ,@iʼѼ(*,**uGkCλO-OM@ `P ܢPC RpWdYPT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $, ! "d  7@dPpPUP q P PUPXp`SxOxMhKh % @! 0P` d 0QP,Q 4u f    0 Lp0  4 4    P ! Dd  ?d`P 0o`Oߍ诺* ***+A" *޺ʺ@-@P r^*A-ppP@/`P `F? @DTdPU@?d0*O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0 L ! * p V?P" [* p 05 ! l P !?P T D 0BT Ѝ*O-ML@P HP PP+ Dpp ppJx?P-JPJn@  P*  P oD _pP   p pP' K?PZ'%8%<5" #P P.?p   P 8D4(l uߍۍ<*! D*̮ܮH-M P DD 000㑚 0 ㉚ЍD*1@H-Q 1/ ?ī*0H- 0P0 @g=@ x P0"ȫ*@-r @p  h @O-MMP`pl>@PJ   P)  P/ P rQp#0@p2Pzp Ƞk≟  P `pWiW~f Upଝl~|>P `n  - =@`PTSJ>PNJ  !o P?J040 #XP6J=P2JY"N 0֙ <@P!J̑P~  X>pL P<!0ẙ <@PPZ ` P [V >TJ<@ߍڍ   P ` P _0᎙>@^`{F~=PgZ<@`s[ ,P \^/=p P >[X =ꩾFF F@O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q"X3\cs2/3?6o7"X3\cs ??j  p  p , p $ 0p ( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,ec@ 8p \< Hp UD`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P: 5!0!+0A-P   P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 !""D`6oD`#@`6o@`#H`6oH`L`L2/3?6oLX8<\L01`\XM`Mpp` }}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p 3D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,~0ЍTU  +0 BR!q p/G-MM`RQ:@ + T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  cwP{` Vl# 5_ Pf \ 0AQ p Ѝ˾LABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o?T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# l@1/p7 4P0PP R000 >@ 0@@ ` *@P .^;  Pppp ЍۍQ0߾ح*0**(*****<*O- M @ ` 4  R000 =p0PpQ  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`ƯQN ULVI  dPB0P`ᱯp`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝ0*(*ح**D(*H-M 0ЍH-AM`p(@P/N 㞔 0P@AU:P: @;P T0P ?s0@p:48 S /$/Aލ Э**!!G-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF \@PQ u 2/P Pd;P Q P wpЍT D ЍG8 P wppЍG갭**P**Ы*!',B(**O-|MMBNX ^P` P /r 6* R . c pP dP`5 L$D:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3 03p@$ P$`4 0S R AqR AqA"tvPQ  a  0 [ Q p  P+?PI p `@  0 t `@P:f V<S @  0! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-xe 0P0p$h`S?BL? @GR q?p9?   0T- p  0[P{ x갭*I!P**SЫ*'_]u'T*ƿ|(*ѿЭ* 1 O-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR .B(Q 8B r4 0S @PPPPB9P  @ pTQ p H24 P0`   4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ `0**ح*0'*H'*(*'O-MMZ:`P 0Z0*0V0: V* Hp@J@`` T)`pLWpPH<0@X@0 W t0 0Wt  (`_ 0+; W X  Fp 0W@X  F@ 0 T Fp 0W  F@ 0T@ FH >:G 0 <  @<@4 ([@  P 8   & P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE m ( 0`eb$ \YV p78 p(,tP 7 `X%p 0 pR" 8 5h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg J0 ,07PPPT JT0P q0?Ds`Dc00 Q(`  D00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) ZPW$` QPN 0 8@pP 1qh 1H!0` R :P7h 2/$B2/$`P $R?0, h PƟ$B0, 8 ; G)P 5P  xd@-d@ QЀL Q 2/00  R ; Ѐ谭**O-MPd@tQ pp P p0@S//0 B?0r 0/3? BR p0|0t R :D @ W Q(QQ@Ѝ谭***O- MPX0pK@"[ 1 /r  2 B`0 000`0P@Q@%*R# GP Q' pW(,P^`S pP/P pW` `PC L`P <pp偍 Ѝ`P PJP PPp[ Ͽ| L@P  L @@0p@W0 P`Q `8`P PZح***Э**X*H*XO-MMM08` ((pR   05P@ T  `V s /r  : S\ * Rx% (%0P?Sd50S <PLRT hA TC pC,) 0pTVp 0 5( d $ $ 0 pB?ECp( p[ @  HPH(08 ,0 PUR 8% -L` T ? a0 QSQc(0U    R (0 P Q 0H $pR,,HP+W( /@  8L'3P @" 0R Q 1/ XQ   T~ PP 0p@8 X(0W  }(00paP!C_@XX   ! R h(0 P hQ 0$  0 GHPV /  68&3P [, @t 1!`V'(0P 'pp  Q@@R PPD @@  Mߍۍ茭**0*4*(*,**O-MPPa:P \:!p  U :x`U=:@  0`?ᐦ#"$1&(\%R !`0Ϡ&쐟b! x`E`@| doĀ02 T2Q SR0000 g30x`  U  0DD0Q0Ѝ  0%Э*ث*0*T,**  /,*O-,MM`HPP1/ @ (QTT ``0 3$JZ0tP@ɯ  ` @ᒕ0"Q%* ` @ P 0^#0 U1S ' P P `P$p,P`V P $!2/! Q($ 73` @ pQD tQ> ̲QP $$! ",p> ~7P P $@$$ PtX$2 p PIP $  ! R  $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R bP_PHA DD  \0****(**,**O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0踉`? 6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @y\5)S A0 0   QxP v``\ p?L/ 0M0 0F Ѝ*0*H* Tl4LO-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰ?k#"\5 @++`#S !p0ϠB'`r! xpHF  d0! T!Q0ϫQSp ee7 @f"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hp oPp7PEuPp7PEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P  T:@ 0  1<0h,Q ЍT0"****0**T** ********4***G-00`P@ < !``0P0p P`H p8W P5a <W0pT 0P `0p@ P` QP  0d"8b"0*ث********* ***@-@P DI*O-M  @p WR 0 `B? P``P0V8CP]  ?t V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q ppGQ d 8Ѝ !댭**0*X*L*`*\*P*90H-PT@ ?@P !# " 0 0!X*L*Xp@-`@P TQ HP`@HV*HP|HpL*`*P*A-MP@`pBW(P q1 Q! !G`P H  R0Q  L P0p`` p4P , p-PPh o3T  $Ѝ谭*!!P*o(***x**,*H-P 0@ᄆU :xP:@XvTP HH Pp Q 0AP !  Pp P 1RPP qpHP @`Pp P  l01P(Q 0!4H"uЭ*~T*** AR"P*a @-p @08@ T 2/`@0 &  t  D ;ЀЀ谭*K-@@P`V DP pP 1QT 2/ЀX:P 6oV P:pPa갭*Э*0H-8 B@$|0@P@00H-M@ Pd$0  P @ kn2 AR: Q Q Ѝ0! O-$MP@` P2Q P@Hv U *@2`P P@%$y 0p '!% U R-: Q ``W`1DP p  ! /P* F00 R0uP Fa1`$\5S !0 0 t  ?[- H嘄Q P QP T  \ P PP 1 0 [p! Q\.0 p؃pG pL$  Rp$4 G  $*/lP  =*Ds  X  X  X80 p /W "pp R } z溯tQL 0P(r z溯H<emD Rzd (0XⰠd!Z !? T pb;wr0 RSrQ 0 Z   0   p3P(& dⰠpdP 1 ? T pb;wr RSrQP g 0 0  ph||| 0Ѐ Q 0 $Ѝ8*Э*0*p*Tج***U *<****,*O-tMPs0P 弐D4#@`(3\%R !0 0 S  ?, Q P QP kPP X@Xqx dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , P @ P$0`PQ d h0PpppP PK1P  R0V : 0 pp!Q\.0P p@Lp$4 pp $   $* -`P d(P P0@0/ PtЍ(`a0*8*Tج***U *x**,***<*O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  P%ZP YP" 0 l? `R w Z2  R4 @00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  pQ( 0 Y *NQT 0 J w*  0P  0q@P p@  0zqP 7@  0kdP`0 9*JZ0 0PP Ѝ 0***9O-DMhh` pVWP ],PV@Pp0 ` W ` p G  hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R ,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `T Wp   @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R  0  R  9 0 ,  $h T 8P `",00 08?R00 "<@ R l40$ !   ),@`(  07P  0,! R G  0Q 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P   0倁, P 8 0 4`(V5 0`F4`P@`pDЍ@@Q 04 $Tu  0댭**0*Tt,*0H-HP@8+  0 t(@08@00*O-MP0@,$P #"u$4dpppp WTP!a@Q'tw x@xx|{x|{|{|{|{|{|{x y|{$y,y|{|{|{|{|{|{4y@yXyEP FP PP$UPl XP BPzp8Pe (P_  0pb X p mPI x hPG hc 0XP@8A&p m0  R *tpn  ghpaLTZpTdPKpp R`Y P  `P xA`pPUW PP lP U3@Q]뤚PPXX  0/ppJk`"T@bT@X_@JZ@P@Ѝ+LT$*P4*0*(*$*,*X*M*L*t~/T** *P* 'sH*:7=D*N@*<*!8* k`(8,v(*H-~ p|f(p@-M@P` :_Q QЍp  0 O-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0k 0hd@!!P 0`4$03 0 ̳~cPe s$ @R 0   ~PP 0 ,po0So7W'|c4@`/8P@`u/@p2'P# ` X0u'  0  }P }PU B }PU }BP }PU B }PU {}$"0000pRP ]\b @04*<y(0P # bP.' ,P ApQ > ,pW:>1 0 S P pVlP@P& PDIP 4DP $(⛷P (  00($0@$@ P P)@ЍۍP*H**0*&;@*`*~)d*H**cЭ** H*?D***<***(*p*F(*v!!O-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@]HL$00P(Ο_^A`NP`PAUP Q pXo, tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  Q P QP  hlQH@P  X pd,`<4| 0` |0PPVX`Az T*d@A`07P p(@p,ppu`:hp(\ l`pQ @TQ`P 1`P  (l0h T0  04%TP p` p*hpPW "POK00!  Q :0QQ: \RVO:\P P 0{l`hp< 0o\@$"P Q, ,+؋V@(0 ڳhpPX XҳPS l@0 C}"PQ0 @,/-h ,` DP1  @@pwQGZ"hPBl pR4 Q% 0# `\l`dPY`:@hPQ c0 ? ? 4`_P`LPp0 B?aqJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@gz( QT`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V? P pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPN5P> *l`L@h0`P`D 0>L:0ST0= P!  P   0.* RT * P P   0 yt XR 1 y  P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 0*8*ȭ*TPtXdpP4 `P TP0 `h@ \R 1Q RNQ  0 Pn ?PT@\TPX \Q 0PP  TP0 @P@PU  8****p*f( TR\ 0\% 85 =LpT ? pb0 RSQT   % R <0t p2/ج**@TP@ P 4ᒡp  %PP l$ R hp 갭**DhQ 0hp 0! +  0 P?P l!`bP  PQ # R P**Q 0hP 0 &$( Q 2/H xx-x*x*P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,7Pr pYXP*(D p/H*;oP P$ XP$\T T0 P@T0AX`(*qX@`q,@T:T pk@T0gp` @0b P8Ѝ؍| GCtX 0( 9H J0**U ***P*Ip*bx***x*qH*4*H*(******@*DcyYx*O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;2PK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P `t`P d lP@PPe<`P  ЍP t*P*(*ȭ**D*@**O-lMPX9堡1 0 X,QZ x@P Q  pd,`R ( 0`vQ4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍ@*0***f(**O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp Ѝ萯*D*O-gMMm"AP С\P\ v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPrR , , MP "( 0|Y|I,x9 G XT!DP8 78 X(p$А?@$P `pH@Qdभ$ 0pup(P `P4`(PE((PZ4(`  (RY Q_ ']A_  !'( R   GP @@d(P@6ET(PP& (R Q Q  Q      4 ;84PU [ (@ 0 @[- (@0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  Z X (@  X (@   (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd bƿ0 **(*Kȿ*`*P*ܬ*f(ح**P*B* H*{00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V  PJ {Q 0KQ!(, HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  (@p P   A  PP@p`Y`Q 0\yQ!L(,  (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qGWpW P/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0tGP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h`A >B&PQ `@p  pP  0 A@ 00 R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P THPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  댭***Э*!( (**AXdr H*NP*Ga*i$8'Q/0/ᰭ*O-MpQ\`s/0 AL0 Q @K `PDd֧ 0`oP`(  @R@p00R 20S20S W* prP&P#J@P`  PT 10S R @ p a:dqY+ 댑PX (PXp    `" \"t!`"`!Pp R Pt1d0"ؐP#*Ptdhcw |P "Q M\@LEpK[5*ߍP*`**f(P****Ы*S**\_?`O-lM@X0c,Q B Q pd,PQ  0PnQ p@U|:LL2 0RpS R0t01\1RX0d0`1R0t0\X0d0```X``A0V_,@`V )P tP6 h!R0 8*HP'  0`0#`&0 Q#P P  0m ` 0`0 5/ Pp@Tx:,`0@,XO:lЍD 0!0**gf(p***H*H*O-,M<(@p`P? $P4\%R !0 0 s  ? Q P QP |P(p(pP X0P YKp$P BpPo" pDa P P  "0* M Q$Pd(pU  ?6H0P?`.1$2H PR L 4P0L(p  8 QU 0L$p$p Đ$p$ 0 4   \!B.,$P p@`YpUW(A*P &P P@ P,Ѝ(@ 8P `P?2 L` e"cc`c `US&Q00*8*Tج***U ȭ*@***<*O-MMLLPp@$@-$PdpQXP-$P'NP 1PXP N.$``*P v `XPv$eVVqVoğP` 8Pp0U"q0p_~PO1.10!$P` $eNMP < p 0on 1!$eV`P@Wu_~qq P- Pp`L0pP+Pi L,pPP*  P , PZ pLq P 1PpQh؋Q$5!SPQT!ϟ`@PYDU B_ `!>P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@$o PP0 XPUH%@ 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,Ph0 Pbkp?'!\%R !0 0 P_Po  ?  t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h  P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ P 6@Pd$P8 P`p(@FύT@! S0! R !X  xPh 7PPD.,PL%X PJLp P2 PAP!P   l+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dX)QD! !0)QHPE 0*8*D*P*6P*|*PET d  Pp~  EP r$P`\!08 818`VW$̷P1`P. \X0 p`  <**Q $UQQPQPUp0gm0`Q`V:Q $%Q! !t / a| /Qx /ALs %/  LP0 P · A(h 0@g\P  㹿E*崿P  < ꌭ*P 崐 ᗿ|e|E p,pW:4*U d  `P%PDQ\T P# XkP d g$P\TQD  XD ꀭ*ȭ*f(*P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\ H8P: PP5 0,"P\QL  幾!Tج**H@%^ PK  P D0<@`400 000( 0000$`,0 0f(pP 謀0 *aJ|P   ߍ؍@*<*h 0 |렭*0*|**<***U ȭ*T*ج**34*8 *]*H*(**5ToK-Q PPpP`$f`@f@T eP V:*Q"O-Mr!n bR@1% P#  e*CCܽP 4d  ,  P P@P)  %, %*㫽P 3  ^P[@U>T ЍЍO6P P P,0*P*`'*<**(*- 0/ᘯ**/ᔯ*/ᜯ* M@-M0 @   g 'bf(G-p@ԐQUP Me`Q PBe >t.`6eUP dUP @ $%eb똯**a * Y  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    {bO-uMMرNp@ @, p ppJP-JPJn@  P*  P }voD bpP   p fjpP' PZ'%8%<5" #}iP Pp   P 8D4(l uߍۍ蜯*! *̮ܮH-M zP DD 000c 0 cЍ褳*1@H-Q 1/ $*0H-0P0 @@xP0 "(*@-@ڭkh@O-MPO``("pVڤP 0  P  P `pEPK P c尯o         -@ -`X` -p -PT WV! JpA@@PV )MPU/F+\P p)ʆP!" x  RYP9 %, %*1P  P 'cI tQ>Y< `PvH/H0DSm4`PhX PPb8 = N@pP= QP @ UPI  C>+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ر[^ `4P\ X[ QY 0p8 8Ė<\S$ P -@$PA` P9  @0X# *PEQT : H P h @X RQ!  @ %_ P0 < %  %*'  P  P:= P *0  $ P ` <dQ:( P < *  P Aq P3Lq+ QQ%ڈG R hPHP*㶹  P > P 0 Hq& F0 aRH P P*ㆹ( o  P  4 Lq& , o F4 aRL P P*ZxC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | VPp .P* P S Q,QS 0"!& 0C04eQ P P*Ÿ$ P M ( (R xQ+<Q) xCx P< (%P P P*㐸Py DP  H8%<5#"( u8BH0/S8<%  PP*^G |P  @L@%D5#"G BlQL0/S@D% <P0^P2*+ P @ @ @ pP ꔭ*$**,*fH L0N-H@?@@_!0/@QP,%R{PPF Gꜭ*L*P*q*Ы****0*Lq4 QQ-0N R PP*㺷 P B 4*PK^Pz |.HPL0P4e00P@ XLP&Ts *;%P  Dxl``PTp 0PpR 1@L/Q `V*Q:QsP hOPX'P y q Qt  cP +PPb W [8a@0p @p 0P@@@_`D  F? @D`P T P$"Q    YSPPT"2rRBpP@\tpqtQ QLR@  l\! !1`ppppp0 p0pWP!p01|A0 R  h!s0B\`AP@P0UP Y*,**P**0*t*8* T<**H***Э*D**LJ 4***|*](*ȭ*p*T*`*X*\*P*L*8***LBALyS"Rح*l*n*7d*h*cu5+PigDO- MPU to*  0@P Vp'ʈuppphh@ ?P` 0P 5P p WPCP PPP PP3W렓P `P @0Cps*SP D#D\Q8\  A$o h Y(*@ Ѝ嘂d 4pG1%ܓW!\b ? D P_U! lRBF,PPq Q*P _   _, @?!\5 S A 0Q ?9@PTP 8dAxq h β@P *,!\Q\UzP P @h Q p耟aP0 R DZP@pU:P@@]00p8***X"t**P*L*0**:0*8 T***4*H*4k<*@*<**Q||   p \Q d Q\H\PQ 0 \Q , Q/\/<**8 TT 8@*! RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R-ꌭ*H-P` < @0X@\p< p X@@0\pñ?φu/㻱 㷱h H*p@-P` @  ^S>Q`p'`&p @T@T  @  0 00P@@ЍE`*0*K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝ0*,**0**O-MP PX `@V T p@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍt* *0***O-M`@@P0r!p   $P0 PS X0 @VTB4p   # R+ [Q ႏ 0%@ / ' t ?  p 00X@@d0VP  `Z pVЍt*y~x* O- MPJp`0@Pᐢ!( #P Ѝ 0P|VT Pw# P  00fV P`U ЍO#Vt*  *G-PHP<4PJ,(PP? DP ,PP  ?e 0ꬓFP$ P PJ Î ? *thP ] }0SySsyp@T TQB  PF rARP TbpNPSQpU @ U`P# P"  @P$T$X$*@妭P . @ PP t!@@*\hPP ׻ @PP D0!00*`IP ḻ P @dP0 KU2(#G LA뀭*(****8**P* $*0*t*<***ج*`*B,*(*mV<**@*H*0*,*YA-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p`p@-`D@PP T( 0PpvRP*pO-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppP3"\5 S !0_ 0 pb\B  ? ᮸@@Q P QP  ' P PqPn `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`P Hx P P PЍ, 8*0**ȭ*Tج***U **<*p@-@P@`@  (P  p@茻p0*8**H-XM pP`X@P` @/XЍO-\M`"p&P@ m!Q@P*  XjH$% 84 \ЍOΰ& P' `D : @`@D - @K KDP/  T `X H P4& ?eH+-\Ѝ4*_ \_p_!!0H-@l P:\0P ᛩD D1S00 0Э*0*p*h' 0H- Q$P@++,+@HP TLP @38 P 0q뜧 P*/*O-M@\PUFP PJUM PVP V.㲪P P8 Lpq|Q `  ` ܶZ pWQ  pŶW ׸ Ỷ 80H  \ ?p  `h / C΄L0P_?q`0P PߍH***-H-P|@paV Q PR P  `@n*T< 0 0!R  R//n*O-M`PL:@Pp PE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍ0*^Fd*8*<*h* @-` 0!% L#R 9.$P% "  / #"o  0*^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WXȳ"""H-`0S2222 0 B A@o <#?H-`0S03X3D3p3   B o #KH-`0S333400 B1 B #[H-`0S\44t4400 B1 B #hO-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MPpR `f@P< _f@, bP `Py  Bp[ (`<ND 8 0`` $( `0 x Gl C` ?T ;`P `Y< , p6 p3 㕾p( 0( pW *⨠UW  0 _P /0 r*PP VP ߬ ݍ0 eud@(edAzd@K-8MM8 ;PpPS`p @0 P?p>W `2! 8ЍۍO-MMP`plq@PJ   P)  P/㲵P rQp#0@pN]Pzp Ƞk≟ ᵺP `pWiW~f Upଝl~%P `n  -@`PTSJ5PNJ  !o :P?J040 #|P6JP2JY"N 0N @P!J̑P~  pLzP!0cN y@PPZf` P *V TJy@ߍڍ   P ` P _07N@^`{F~PgZ?@`s[ iP \^/p P X ꩾFF F@A-M@)`PpP  0Jp0P  R VЍ0 0a lp0cS@ @* @P c @갭*0*l**<*O-MPpPlh@`T O 2|QTЀ  ?P @0$" 0  ?  0 РP  j A0 Z)*?`@ `' @pTP` H1P  0XDP`@ 2V @P 0 0R@P) o# 8@V p` ! `Q 0 R-JXP 03?R! 1 R z pP d\P pPT0pp0*l*@**n*pZP*J (*O-Mr`V1( !V   墾P 0O0PP !VGXЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P 5P  Pp W@l*0*h*d*o6 A\!PP*(*O-LMp@Xp`P 70 P▸ ,pP p(PРP8`U @p '0$  ! Q pU+* # @" p> p $` p @p Ԝ$`Ϝ 0 P`,  `YP }P d P ᮜ(p ᨜(p $ LЍ갭*P*J (*0H-Q@!1 #R# @ @P @3@ @# # dP@L$@P 08$@PF0*^FP*-O-M(`,@P 0XV` 0pQP @h`0P " Z %P`pUЍA-M`p@ᔷ(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R pћ ̛ Ǜ › Ἓ p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0 G@VYJ WW: Sp `x@PDl&Q:  PRPX&( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0 ڱ  tGO@ \Ѝ J;SSQ;D40 $80, (}G,DS;!SR00;S$PU:AdU0 @@@<`E4Pb' &(@,TpP` $@ H,$ P0H`LpP, QW Q QPD@ p4a"0SQ@<8p<< ? V400P P@TpX  # " P@D@X p8P8D@P 9@[48ppWqD@@ PPPTP PTP` ^T PPUW D@PpT`V ! GPPp!TP=P:D` A "0SqW*P ? ذ40 0P 00#`(0 D08 R7 B8 Q    D`PUYD`DH Hp'& ,(&'0@@]FO@_$FLl l0J4@ @0 0b?D*LBAWu$57?RMBAWNBAWOBAWzQ@-@,P ` Tj,,&8P0@ 0 D*qu@-@,PTP @ 0u0H-0@PP 8 R B8 Q   l04PU8P0(( ,02 ӳ 0ͳufzO-M,P/ `p@0 QU    0"P  PPU@@4[ Ѝ 0F ㍳uO-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 0K +uAH-,P @NQ CP\ @`P'`&P @TQ$$ (0 0a uG-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0q 0s 㺲uK-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0~ ㉲uH-M@\$P p` DD 0yD$ 0`ЍD**H-M@\$P p` DD 0ZD$ 0`9ЍD**H-P 8@rP ZPA\PPQT`T@p  T %DP pWL*H* D*@@-,@P ,Q H*H-M0P,^Ѝ ЍH*0H-P@MpX Qdd Q 0 D`QaQ 0! 0茭**0*H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*㌛uP  @!. p   0\P" [hPQ \dTA 5d#, %*Z4C(P ᲩA @d AR *a#BP(:RQ% Q 'aP 0@ d#a#*(l`P ဩ<@ @Ѝ@H*D*0*m*<**H*O-MP\` @(T P L H D @ < 8  >$tP<@8 kPlP tP( bPH4   p   0 pPЍpcPX( 4{P( 0HP$@P T0DP P p HLp$P8`< TP P0 S* 8PZ`p `JD\ pzP T sS (`2  pzP P`V:PVs  zP  pd P $$0Ϙ$ 0 pP |S$ 0  cPG ( (z0 PZ 8 $ bpQ ( p^  0 R0Z 8 $ Ip8 p \P(0 T   0 pP&4 "X`(t' 4eO-MP8PLHD@<`04u@@HD< aaPLP bP iP cP)     j pp AP8PH`  P 0 P@ p DP X<@@ߍM@ `04$ `HL0qP @HpLP4<@DP 0`,PP P F X )$p pT( /P\@dd#e0pp2ڔAT1 $04P `@PJffp&  n $fp n/ P%`!t`4!l!Xn?!Dv`sVY ,%j80(`?"R10`@@nP? p oo4'@8P-`V* Z V, Y 8$ m0 KP!8P , !$  0 !( 4P , !$   pW75 ``$@F0*p, $ 0#p% 5p X Z@ X E4`('zd@a!-'_<K- @PPpW ` 0`W0 0 0KO-M`PHr@ pPpOPp AP4PP fP.pWppP"P` P [P  P  0 @pM |pI Y> @E$@@ 0@@~ +  0@hP+  @ᨮU   0X   0 @ qpX DH:p@(@Ѝ`('+G-`P@tq !fP p rP@@P  p  `P  U G1oP S`W $ 6 p VP$ ( p Z `P$  p  `('z^AQ/H-$ r0Q0#1"$#"O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-MXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*BLЍK-Mp($D` [P f$P 0!   PЍK-MP$Dd' 0 !`   P`ЍO-M p@P p vP `t `Ѝ  Q 3 P`rQ "$  R($HP    0V qP PV " t 0pP`V0%1 # PP 8  0P `P $ 0X PkQ0$!0  $  0`@ `P [ a P`| [zP@`Tv T( Z+ uP/ pD 0 PPT $@ 0@P  A P P PA P@ PZ:9Q $ 0#'귪">SW" [M0H-MP@ 0߬ 0Ѝ0HЍ/M@-M@P 0 ( =r <Ѝ@Ѝ/a G-MPp`KP0 @d`H <0@$LT8P,40$ ;4Ą(SAp p H  P)$tЀW|p b "@+ p p~1@ЍpWP Ѐ X   0Ԧ`pP 0P  0` Ppl 0L p   0ppqp  0pJp P2 V0>간崔  0㕦  ( p pW' p Ѐ  pst P P $ R~*0pwl hd@d@Y=MH-M 0 0 ЍHЍ/O-M PP% @ UP!? "R R$ P PP 0 P `  0J`P @  0P   0  0 @Pm P 1SS@[ prs,|` pPp| 0v pXP!D! ^1S SS@H L0  0 `p* 0 P P @ \ 03`A 0 @rP`Ѝ$7^pTP/@-M@BBQ L Yp 8$ Ѝ@/d@K-@`P p ||P; ꐪ LL;< p<T $ K; Ktf(a &@-@`P ZP  TPQP(( F!K- @PT0S `pPu 0S"%T  0XS pp `rP0S`%a"$& @p ;q H"`v$$ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 :@T(ĩᅜ ᶥ P㐀p0PPpp0 0:T :H`@D 04P:@TЍ2f(} H-(4$$,0"PO-$M@nPiP |P $Ѝ 0kP+ $tU` H0!p *S̤ 0 U0P`pF0h pUppp R0W0 Q pPp\ 0R`_  0Pp $PT p 0` pPG pZ0  W 00#8 \    8p| $$p`2r"3,H0` R HRP `T p`pa P`pV:LP PXRM 0.pF 0  0  0 GP  4$$  D $@ `PARTEFI kF,O-Mp@Q W PPB$/P `  0PPPP K< $ PЍ蔪Kp@-M|` @PRhu?Rp 0r   cЍpt~/0H-hRLR aR bR*#iR sR tR! P p@PQP@0: RP2 ( Ep @$&@0"t~/p@-MP@QL` PQ Ѝpt~/0H-P@Q 0,SQ00t~/A-M@`Pp+ G P # 0RS sS bS SS pW bS S BS R QPJ $$2!PЍt~/O-M` oR r 0(Q0Qy @pPr Pn TPi P P^P[ (QQW R 0#"N R " 0#D$p@0 PT + p8$ m0i0 pP- oP   oP!@ @  9/$ p'   T 9/$  p 40 ` 9@PUpЍ@ r oPzp"A-`p@^PP  7/$|p  7/$ qp 4 P$H- sR iR aR Y p.A-M@ P $T`p 0(  0P,(p 0` XP 0`ЍW 0>`kWO-M@P p儠刀P`CP `V    PP Ѝt~/Q!"H-0p0P@` 06`V"O-$M @ēP`   Pᄓ ဓPU \ `58 P$j f$Ѝ "G O- M`Q 04@pP < ЍOP P0S* $0D  T0#+ xnP#   Sp $ 0 T0 У0  0 @p (  "S7 H-`PP An@P 4pP  @"t~/sp@-M`lP  @6p8 05P 5 k5Ѝp  Y p@-MPP0($,4$5$$(,0@ß 0ȵP ` "r {5"#| P80hl5P\i5(Ѝp@&@壵@Ѝp`('G *\O-DM@P8`q弁< fP lP2 r6 /PO`` àP L 5P=  P( , 0=5@#Z b  CPp0S P t oPZ b@ D`DЍt~/k_f( `(' 8$ O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  p "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$iP@Q QT H 0@ YTX@ $(``P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@PuP$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O H"vP/@-@$P i@fO-,MX TP\0R, `Pp @P  0TPTP  0@ ` p 0@V 0  0 $X(F P=@T9(P5$P (PR`p  0W0 `P p  VV VX,ЍRᇝV0 000PyO-MS9JP pF $veP $$ 0p; P pP pWth Y " # # T 0 0  0 0  0@!$ + !(PP$=p  [7pv $ Pnn`(T'"x7O-TM(P`HLusH@ sP  0dpHp qP+P%HL  0P Pe@p1 T  @ D$$0㍖Pp P  , D @0 PH L0 - ` < P   PTЍ0 4 P* P&  $ p,   QP D @0,'p! P `p  % 哒 Y8*`pT  KdP  V  Rp`8倐Y:D p@0RV _(P<pVZ`,pV࠳ t  V $V @`D  00Y PQ;08 |@`D <0tP(0  @`pT  0  V0 0 P  4$$  嫏  h%d2p 20@D @  0 Y0@  `R\ $@0 `@P p 4P$ (0 r  #  R000 Pp0$`(l'"7zY_KO-$Mq@`P   }aP bP iPTN   TG TA  p;p NP7 lP160PSP  0S0S `p"`!p P 0T \P  0  VT$Ѝ=R"'`(O-gMM|ipP @  tPa@ Q&T\$d  puP xPpP  Pgߍۍ PX|,P P  0S@T `0"p!0 P @T$ P `P `V$  PG' * '*B|| P \GG`$PpP )  0)`pP @P` XX X '+`pPP @P` XX X +Q ) `@P`XX d) `@P`XX |X * %G_ 0% 0 P ˆw)P `%l5PTk)DPf)(%0(E])[)$4p## )pڴG)$4##@)`@P`XX X *'p8$ m0 `()X&)# $8_GX l*@Q* #80 P  $0   #$  (`V HCH# ( 8#(0.,, ~PP clp @ ( (`pP @P` XX@X *`pP @P` XX@X *Q ((`pP @P` XX@X )`pP @P` XX@X )  `@P`XX X )pW5 Pw($$@0@$$@ 0@ $!GO0 !`0PG 㠅G@ H( 0@('@8$ m06(4(# $ @hkP'`(!N&f(- C"3^ж*  IK+MA-MPPI`p@pxT\lHX '' 0̌rP@@ @$L 0@S;'[ |!80 @KQT'>C@!8! P0@\ЍA'` '4'V86  P0 &ЍA''PPtq0d W| ЍA~' P8$ m0Z P, 0 n'Ѝ J? &!{m^IO8H-M0P@4ppb #  'p8 0@'P :' &Ѝ  Y G-HM P@8`8  cp4 TP p lR& T pT  *pT d8 j_P \PP 80<papHЍ"=R"`((' G- Mq@`P  _aP bP iPT  u T T  ps ЍlPp P7P  0S0S `p"`!p P0T 8P 0 >=R"'`(O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P ^P 'Z48 垃p+lP`p<@P ^P p'W48 凃pJ`FG `(`H0Ip4 4800KP`,`$P `%LЍ8" G-8MP' PP# (L 00 `@Q0  ppM P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`kP p'W1 00(pbRp`P0 E 8"O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @D% :/p'WlЍ8" H-0p0P@` 0%`'V8" A-t A `pP@ `Pp @PP@TR 0 A8"A-MPP )p `p @ pG PF WH:pW@p`0< 0?p`9p0$704$0p`0S0.:8t00N , 8 8$ :  0p` P p0 P` PD00Ѝ耜Sؼ׀     G-PMP# P@8`᱓p@L _p UP 8p pPЍGytPh  0P P D  0f bPЍ5 B t~/'`(`@-@R  R 0 Lj * *@-@R  8*O-AMfvP@ oPpgPc`P $$rt@Py P7 p @@P-\\\\Pa 0 <P PX ePp@pPPa P/  P' !yP! !sP !mP !gP !4aP  !l[P !XUP !DOP  , GP r @P   8P s 1P W-pP P @@T Wp @PP` tP d  PV  P #80% P P rڼP  }sP 3P $PW @&P X  P P "`0 zPy "@ 0 mPl  0APe  x0:P^  `03PW @$ m0P ( IPH PC $ H@ T: P4 @  ԡ`P@ pWuP9 pH4 ᠎P#  #P& PᗵXU PAߍO,\ @`$ @`  8Xxa` YAߍX HH H04h h0㼐 ` `0㷐k_] t~/`('` .    PR"r !'!sv      i w   "`       ! / > K Y  *f(O-AMp` \L iPp FP P$$(,0㥌PP`@pP  AߍOo  P  @ ލ(P PB P $$0_P:  P 9P q , ጅ .P P P  s< %(vQ   mP b {P  sPy - mPs  ePk  T@  \Pb l TPZ Tq/ NPT < FPL  DPD r/ >P> P   ,P, s/ &P& "P!U , 0]!  $$ K$P $P @PV 8 0( $D`ft | P |hP8 | P |$]P$ P  P @ P , | eP | $  ,P !R$@ ㉄P$D0 !  0$   P$8 4@!1#Ԉ!  $  P$ 0< 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`X \$$0`合! Y $$ ~$PR,<`(4`8 \$4#S#o! : $$ ]$P3ppAߍ|{hw<mpd| t{0tk_ t~/`(0' b    i 5 Y r P   PR""!'!s  " `       ! / > K sv   EFI PART` A #       @H'O-$MMP @ޡP Y R`#ŠP QQ| 0o    P H _|<  ` PpgW܍ =$0P @o { `+P#  #  `  0 ͅP T "|P v` PpgW #$1P`  0 墅P  {  p#V   XYa㣢$Ѝۍ@@ 44 **  Ћ        A-RMx`00P00 0D(0 00 00@00H40,0$000 00@0LPTpp<0!1X\h0\0d@8``l` \0X@ 3Rߍi@i7 +  p@-M `@P   ]p < Vp Ѝp `4]4'i] C O O-M@`pnp PLP pC{ ?{DP P, PP PP P  P PhQ @ ppb P ohZ 0 S 1 pp P P P![ $ Q 1  [gU  ,0(S 10P Y  4Q 1  Y l3HQ 40L S 1PZ @ hP 1P l 4P 0 S 1@ `p@ `p p R 2/p 8 Xqp Ѝ|p`` LDd <\ r3 f38!  | c     m  C K-)P! P P paP `<@ &P sP*QNK-M@ PIP ` D`p p PPUЍ 㙋  O8 p !0 ` ! iH-M PЍ! @-M@p ( QЍ! H-@PlP pP<?9` ` ᲀDJH-@PNP pzP *` ᜀD4?`H-M, ~P Ѝ"K-8M, PlPA $P P     P `WV q 0p@0 P PP @8D8Ѝ 0  P !S i0H-Mx@P PP P H Sp Ѝ0 0Vlj2S  M ] i @-,@,@@*d'*A-(MMA^@り #p P(Ѝۍ @7`CdP P}@P$P @COP 0Pz}@Pi   @-M\ @ᚾP P p8Ѝ 0N   !i @-M\ @yP P p8wЍ 0-M  H !iQ p@-M@`P TP uPaP PP p P Ѝp88 808Q1( K1a  \ !  k  @-@8P , h@ 0و    J:"0H-M @Pp  \P H G@Ѝ0@0 1,1 0㰈|   J:"  p@-M@P `AV*P P 0*p l `PPEЍp4(0 0 i'    H-MP `᧾ppZP @ p啾px0QQPPp`W Bp`W xi  l S O-4MR @T @`P0⾜p l pa`c0 `0`Vv <oᠲ@ PpW`VdQ pWQ   @ 0"0 PP1/PQ 1/P 㙼8P p p `0  ! P6W30`Vpo@崀PP00PP@ @ U0 P`t0嫝* PP@ɏPP @`d@`$/똼*P"*ɚ;6eʚ; '7x" p@-M`P@P  p /\4 0H-Pl@9t@P oqPJP 0$$ $0;/8!   J:"0H-M @PNp `P H0H@Ѝ08, o/ 0    J:" p@- M@P `P P 0p l ``P`pp sꦈ` Ѝp(,/ 1/ i   p@-(M@ PP- VPp# $ p0   `q0 ``Q$` eP P` +@PD(Ѝp 0f㗆   !3 0H-M @ûP P p qڸ !0p@0 pЍ0 0Cf   !i0H-MX PᒻP  @p(( @Ѝ0  p@-M`PP @ Yp .4 ////00 /'00 /'00 /'00 /'0 0/'0H-@|1zPP P00D PaD"P# *@PLz?Q: ADPP*@0'H- p PP*0@ Q:a@QW@ A@Q=@H-xH/O-M(  分ppW df@  R 8 Q P pt ,04pW px  p\e p<-@T u @TYout%ttxU`@0000  pVP BWCW NWD aG QsGP&(|CAWB  wrWWX!   A~$$Q :p 0lW`W;CWI LW@ vW9mW; sWVV`clt!   ~<#Q hifaW lWHcawW zW]V`XcV@`RbNQ   x20S0520S1420S$20S*(" R@" R  $Q  10 $ $00 I(0 c PP !,{tx ,$ @(` p$PP PP ;PP4?`p` pPxP V  R 0*2/''*'t'\'''***''t~/*!******** `(P*O 8! k  C B ' ' ''   K-MⅅPP 0,`@mxpL x`尀W00 P   {|pW 1/pmPP`  0PPP PPdC' f(  ' '  ( R/0S  /'0H-M P@d ᭸P peP  pp y@ p,Ѝ0 0c- 8!i8  % J:"0H- M|@?P Pk Pr P yL p Ѝ0 0i<+3   & ui H H-w 0H- M P@, p Ѝ0q+i H-M,   PЍ`+i' H- @wP'O-MM@Q [P);+\`⍗P,`Y  ^<0884@0H,P(X$` hpxpPXP TT WPDpZ NP: 0  ŹP4 pP- P&P P pj p p P `P U DTPpY L`p 8Q P HH p \P P ` &p H p }p Q t8lp H gipQ 0% XPD@@\ pa PV * %:ХP p gvpP<%:P pQvpPL\pW  2/pW plf@X@ x P r P T p P Xd 䤍p H 'p@@D@P a^p   $&p R\ HP 0\  3/^_   PX눃p 8ppc`S X"Y$ @   ,"F4  "8  "*  0"0\ p" 4  ",  "(  " `V_  1/`\P`V 0  3/`VLPTP  \`ٖߍۍP )| R( i! *****f('{ i  $ : ' i%  *M"3 * O ! b*G X b m   'C  , m C D d H- MP@`QP \ p NNNN  $@ PE Ѝ3 vi 0H-MP P @Pph A  2Ѝ0P"448@P,0PPP%Ѝ0? G  b 0H-M P@8 pAooЍ0ip@-M@PP P|P lll P0 ``㸀D `X p Ѝp$&(R!5 n % ***7iy H-M@P   P lP XPXp ` @P Q Ѝ蜧  8!Q! K-M@P P>Pp p`(^ 뜂 ẵp8 PV P @ ᫵p o <f4Q ]) P? `P 0SR+ RB+ P pZ @TJ xP1 QRR T@ Pp!6P*2! m7P# p PP`! RQ  + `V UP:nЍ(xPD/'TT +'8i( ! / 8"C"8!     v i"B 9   C  @-mP$@$@' *4 0H!sf(Q @-M@L ѳPHH0 Ѝ 0~ >  !*H-(MP`P& @`P  p(M p'P\ DP D(ЍD &8&  &  *8i(     H-@&P `@p[PMu+P @P p,   0~R!* >  !0H-M@P  0PW& p@-M@~P @P8+P d`@  PLPru, Ѝp 0}5 **Qg>  !p@-M@JP @P+P \`@  PDP>u$ kЍpn **QgA-@P @pP*P @P" p `,, ,02x} a% * > " !H-`P '@Pp  0p A @H-M`P P p@  0P P  0p @A~~ ЍH- P Q   Q 1/pK-M`(P ( pw@Pp:~"Q P ~Ѝ TP~"TP , 0 gp A~ O-MQU$& Q P Q @PtH @PHp}Tp@W Wf Wh W a~@ЍW W)P ĄP@Q  /tP@@(@ T}0($0  ,pyP `P$@( [ ?P (QM VK( ( 0gy`P$QD ~@@``P`}Qp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:i}@ @ `V  j Q Q@P:}@" oTW T4=@ 04P3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``P p@ q$PP xN`V  0@p PP @P `1@T  PU @D8 0@#( #"Q!r"   k  A-@T `PpoP:}P  0p A| O-$Mp@|P @UK H`pP#  0@`4/P( P+P M{P @{ pH`V 0{  PPUZ Z |Y| P {|$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q tP 0P -PxP xP `V5|2|Ѝ @(@Q NQQ EQ R-0FlFtFFFF oP P0 0  0p 4 { u" p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pIP p`$@ "H-`P@p4P pP @B"0H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P Qp)U P `PUP Qp A-p@(`P P@ @p P"A-MpP,`P T @$ $0(0 0Pp@Ѝ"O- M0Y$ P 8/P J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP)U' `@plK0X* @  04/PCPYU@A  z@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V {p6/y P@T p@-@`PP _P V  P PT ᜽ 噽ᕽzP pG-FM@0P,U`P` Ny@&XPU R  pF`y pp PcnppPƘ \n@ @p(QFߍ Z    JiT   0H-D@D4@4,P,0H괼*'*Oļ*(QG-NMMP@Fp`)u(qx [V pp/ ) +4 `P*(k) 0pp 1JO 0pp0P,0Q,* 1U(() *0 Nߍۍ萼*Ki d  07lf(~ H- 1pIi 0H-hP@P p T p @[T@ ㉭p@@0<'̼*O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW kP2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@wP$@Ѝ@n( Hn(  p@-P@QU 0PxQ  000  @UP ` XUQ p@,U `PUp@n(Hn(X J A- M `Pp@wW W# `@`Up@JV:U` nw  R@P P`  lAxP ЍH-p@Pp `P   H詬 G H-M pP`@4w @ЍO-MMMPc Pp` `Kp] @Fw e`,\qXpYE @sP9 P5 pp `l $ Wp !@ !P 0 o" 000 3 ;nP 3P t3 ``/Y,Mߍۍ<0$ 4t"< i* %   C  H-M`@Bp pPv Y pp kt p Apw@+P Hhw@1P cw/PtЍ iE 1"H- RHꔼ*U A-Q P`p@sP PP`V@- M  @p l ᛪP T q4w Ѝ n 9i ~  @- M  @kp&  CP   dP p cP T q8uv Ѝ kw n 9i C  0H-D@D4@4,P,0Hм*'ؼ*[*,\@-M@ p  QR 0R@ Ѝ   0#Sif( H-`@Pu$P ` p!PLU, Rp Hn(:i @-M\@  P L  pЍ0 0Nt6 . v !i @-MP @ᯩP  1pЍ( 0Mrt !. , !5 @-MT @ᒩP IpЍ, 0ATtg . P !Z 0H-(M P@!&uT  0p < p(Ѝ0 W!i   0H- M| @]P tP p  p Ѝ04h 0q t .  !i  K-M <pn \XH` 1P P=P> | ^P XPT :Q00@\p@P`0  `XP0 @P TP 0 @DP AAq X \!PdH qHNuݍ(( A   Hn(Q! i8   @-0M| 0@ p P L! p0Ѝ($$  / iG    p@-t@tlP!P@PHPH@`@#p@'*''*b*g*gG-BMPP(t` pp `  t8s8s`!s p !R*cW%  zp P P  gp P l\P X  T)p |p Q$P I >p QP `8sr 'pP i pZ PQ pOH!PPPP pm `V !RAqpP!0   :R P T]P^pta@T ,EqSNo@DP0D $8P p$ $ p @ <P\P  p#Q  Q BߍXkxY8i(i i& *0 9 C V N e \ i8l Hn( t ix  ii"    / 0aff( 0H-M P@r$ ZpЍ0(iG 0H-8M@ P r$ Bp8Ѝ0i8 O-UMMd8 @2p*   " ⺧p$P QPJ+^PJnP PiP +OPZ d  PpUr|  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `(I(Y:!0(!    004g2P8 P@T: 0% P7PO 4.^) |f @DpP `dPN  PEp U ADQ) Pxp4 `@``v\T DP 0  @T >k4euP )P  0@@TPUUP  @0P@TP>P Q P=@QG`qtttttttttttttttssssssssssT:%PP[ P P  |P  @Q $ttrssHP| PxylD@kP( $ <P 0`<% S %*&S# %*/&S"""9PE@ U$K @{Px)PA 4"딲嘢@R 0 p   `'b 0 pp` @T>aLrth\ P D8, P  K[ ,I'Y.0<Q  20fp3Hꜧ  0 ` P/p_! " 0 ` P /Sp_!8"@-M< @oP  LЍ 0m .  !@-M< @XP  5Ѝ 0{m: .  !0H- M@ Pp t :P  qD Ѝ04 0Pmi .  !  O-dM⨢pʼ{pʬ}pJP EUp P < Cpy <Q |hT6Ph"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps 㘡<@m  P `XP PpGPG U*y@wQ @pP cP bP  XUp*Y GP*U5pk   㰼 PkP UZ'@[XwgP X Pp ZpP P !d   6/ R{  @Y H@PW  0 ꠞp3TkPUPR ḟP `( `W HL` !(   ᓟV  0 Q P ᛞlp%ڸ qr ፞pЍ.x d ll@ <(t$ t~/ l  `(8*<* " " ! Hn(`! M! s! *! 0H-j@<< P, 0] f(! ! }" H-M 0 7WP  \R  D 0'WP ,Ѝ=X'y 8*<*v@-P@  t0< 4 S 0 p00S$0000"""H-M( 0  PЍ`'DfP Qp0q#4 S $$0 Q 0! 00/"""@-P P$   #Q\:0|\! 0  sS Q :00@0 \! S! "# # ""H-P pS Q $$0 Q0 00"""P  S\:$0$\! /"""@-P@ q 0$SQ:$ """P H  #Q\:(0(\! /"""P H  #Q\:(0(\! /"""O-qMM`\\Wdp 0@  \cPd@PTLTTTTTTTT\TT0TT8(% 0AP aP" 0@@p@@ 0P BZo 0phFPU Pd P^Y dE P Pu앟쥟``(dP  dP  dP P P  P)HdPP(7   SP 0  000 000P` =P `ZtVP dZ''P=U  `P `P  `P~ `P pdP dP ~dPpxdP U @P(;P( {P `U .`P((`P( Ȁ{ P P JdP p P`  P    A  z(&P @P`Pk( P(P@T`bEpp$4hPm'P+U/^PPZP qQ r'P pp( tQl ᏜP X( ᇜ"Py ZPaP:a@P !PQ PPU 4 0 0`qߍۍdb@ e`p T8 X\ "0# D*=# t~/@*`(# zd@H*edAl" b# K # # !m# 1 0H-MP0@U , $bЍ0{& H-Mrg 0 b& f(G-P@pnQoQ PpupP \@nQ`oQ ``P @P!Q!K-MP!Pp@Ȑ`KcP cP p`VЍO-AMM `p@R&P ,$ (IQ $uTsTM $g ဴPP/P$ yPL 0 PI @P( PP? FȰ `p WȀZ QPY  HP PU  ` E$$@P   0pp $ $ h$ t$hUZN !1pᨠ@P   P $LP%%B 0dB$L4BT2 ` H$P, 堄Pp@@ゾDW@`P -P =QXPU pQ PPppp`4 `嘣oS`0` S0!P Ww |CV`pMpV [ (p0{ILpL @Pu $ P 帷[P- , 8y veP\[n( `PG ޘP(PE` ՘PUP(  ɘP[\X⚈ q:p P P!p@T )$ P nl @Aߍۍ ,QP@[P  0p f n@ l ѷP [ ( 啘㓘, \p0Pp[n BN @N WeP  0SLePB 0ә# ["# D*# $ 1 KZ!""$ $ % Q!@*$$ !*$ =$ "@!a!]$ f( p$ # O-,MMPkp 0㨀X P`pOHT2 p$(PhhbhRhr Q Q X8@T f P:T 0D! XP0!(P$P !X❰P !PqPF HAH`'X P: X, @X``hP @@ @@P0, 0  @ 0WP ,P , WP, tu,Ѝۍd dX8,ЍۍO{$ "D*8!G  $ b $ $ $ $ # $ %!F 0H-Q  Q @P,`P Q  0*p@-@P6 nQoQ  P# P ,R R^P @P,VPP ``,VPP(ϵ@p*vb"0H-P@0H-MM @  P0 "x(0ᥗpX  0q  @ , |@}Rt* ",' O-Mp`P@b 2P R帒|‰  |TPe@ Q$\XܨXXXXXXX<GP MP3xUPgt d 0CPI 7p FQ< `V  X X  V`p!}ZYppᇗp Y4tZ8xV  V Ѝ (   `(l~/' t~/"!' j H-b f(' 0H-MP @ RQ pЍ0  0r ' @-@ᳬP@6 @-@\P@A\!@-M @xQ QpЍ H ' 0H-P@!P /P0$0H ; ( +( ' 0H-P@F0H-M @ P0 ' 0Ip bP P  L LT,rb" (  0!?( P( ( ( O-Mp,P( 尰尀`@ $oP 0-P !pDEQ A Ol~/`(] t~/"!' H- b f(( 0H-P@D!P /P0$d0H` ( +( ' 0H-P@0H-M PAN0 & 0Ვp aP P  H H(a勻 A>d!?( P( ( ( O-Mp,P( 尰尀`@ oP 0P pDEQ A O2l~/`(] t~/p"!' H-va hf(( 0H-P@ P /P0$γ0Hʳ ( +( ' H-0H-M@AP" 04 0"p 5D ( O-M,(帠帰`@pP oP 0%P phDQ @ A +NЍO ] t~/P"!' `(H- 03Sf(( 0H-P@7 P /P0$W0HS ( +( ' 0H-P@A-M@ PA> )$0ᢔpt 0n@ D `{L,<\PP ")) ,' O-MPp @0_bx wLPg@Q!tش$4Lt9P GP8||||MP' UPw| ||| 0IPc =||>w ppPQD0Z  S S  Z`PY[` ეp' [<pY@tZ (Z PP$||Ѝ  ) t~/`"!' `(j H-_ f(e) 0H-MP @ RQ pЍ0  0_' @-@ᠩP@6 @-@IP@A\!@-M @eQ QpЍ 5' 0H-P@P /P0$0H (( +( ' 0H-P@30G-JMM 4P@00 0 0H4pa4@Ppg_KPVP S QP0 P Y0 0p 2@E P!ʎ8P 0<p 00 ; pqVP hZ傱<0 mh@D L0\`dpl`pPt@TX P$@`p QWJލڍ0 0닚 *"* * * ,' p@-@  P PP p@蹰(P`^`p} *b"O- Mp`H@0]H TS뀶嘆否 @P@A@7Pth0<L\(2P/ 3P6PI$D]@ IT( RG a58 yltp l,gPCP4P a@]Y 0P P    @B P  P  @           \"  T $ J     p@ $ L6 <  (, 8  " @   , 0b @rd$ tW, wK xB0P }pGQQ0`+J4R 7 ЍT-') 0't~/,'"***C"*>!) ) * * * !* '* !' `(H-/* 0H-M@ PQPЍ0  0K* @-M\H@ <0 @  00@@+ + f(, =, Z, + 0H-P@P /P0$/0H+ m( +( ' H- RRYk, A-M`PPJޏ  pPJ@@ RR0 ِ ỏP 0]pЍk, p@-M`P@ ㉏Q 0yЍpO- Mp@PFp8 p0`pF<8[$ $  04O79 2/< &   4@K<0 p P 1Q 2/R 44z3\H Ѝ @꠾*|, , H-BMjo^# 0142/10 >p0p @0 0 P \巵 ,,G\H<Ͽ Bߍ , A-MP@` p$[ XPh 2/R1QP5_U @4O[@[ 0 Ѝ蠾*, , (0P0/O-Mp FjP `@ p{P`DH @0@3/p@[P;p@%WP ` p@y)0 @ 3/ qZ㋐r P P >YR*$$0a[<Ѝ, , O-M@[ H@MP p:RPo pP0`P \Z d,@8  0VP hV < ၭ$Bt`p PT P p  P 0  p8 ,ZM@ P @!0x O D  0zp PQ 1 UP ,P ZQ @&P+Tt Pyqp` hD U 000  Pߍ* (- ***, O-M-M`p(PYT 0 ؚ݊@C 00000   Eg@Ql\PPPPPt4XPPP|P9p  03Py '@@ P , P ph  @ : 0SPb@ ] @ : 0SPZ@ SI P  p GQ$A+G@  Lp, 0(<S00 p@ Ppp 0ЍЍ)e` adXL Q4 MH Ql~/`(K- t~/s- x- }- . B. ,. W. ?p"!' X- - H-Y }f( / 0H-8MMA.NP$ 0 (0Op. @' P@  (LP ((x0,qP ` ,(L00@8Ѝۍ0, ] - - - - - . . . - 0H-P@0H--MX 0@F;P  P   Ѝ. . 0H-MP @ RQ pЍ0  0' @-@P@6 @-@ኤP@A\!@-M @Q QpЍ v' 0H-P@ P /P0$+0H' i( +( ' O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q.<"X3\cs2/3?6o7"X3\cs<<< ??j < p < p <, p ;$ 0p ;( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,e;@ 8p ;< Hp ;D`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P; ;!;!;0A-P ~;  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 C;!>;"9;"D`6oD`1;#@`6o@`);#H`6oH`!;L`L2/3?6oLX8<\L01`\XM`Mpp` K}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p :D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,>0ЍTU  +0 BR!q p/G-MM`RQ:@ + K T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_9 ЍۍLABLK-M,(pQ@Ppp  PH`UU Vl# 5_ Pv 9 0AQ p Ѝ˾LABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@xU_P PP QPpGPPlllo ,8 Q`40,( ᗽB@4Q tttt4ttttttt|tDttt$tttttt<t4`,ttthptDt@]QPc XQP @P+ 2 10  0#DlO 8P `D` 10   0 <-@Q  $$/0(PP  v 10   0 80  *0l4 TL 80   0 c00  0 @PP PP q#[ @Q ᵞP T 10   0  10   0 0>@xG@ Ἇ@PP@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:FPX/FPSPf PJ<Py/10 1@@(.  T "k, sPP' PPe !  !  0 T X L j( F`  Ap8 @x P P D ~%#pP[otQRxB AG@P T@P UHH,H<TT P@   x00[?yp+X zRRp& P\P T+| KP pp W,ᚆp`T @ pt ]z Pz? J p$ zLJpPpxPt @#@z *P;PJzpŇpm*l j ?MP@@[ot   zp P妇pTf) ?M|)@Pt@x$ P )P*   0Y$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$%p P$@Kp 1Z0$Pl, ᯅp$ D[LP ڬPt pQH `q!'P  0P$@V U   ^`Vp V 7po+ QʌPtfP  RL+㩤P  Q(*㠤fP5PP[oQ,P VP &0つQ 0Q 3,80(  @w W 3y /P BV8P @p1h 뀿*w/ v/ *{/ / %0Bd둅  ׅ%0 Tp txB@ [?◅pPQ,%B d0@{ȀB_<` Np- MPZ &P P)  a&p! P< pP Lp0B/pPcPI@4B/Xt~/  kY6 `*6 h*4'l*6 *B6 @d  PT*[`Y p, KPrG @  0MPm  +MPh [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4\*p*%e!$"0QSQ% @PPX*^7   x'A\!6 |** P  0QQ[oXQ <$!@1H!0n[o;7 [oPu  0 ꠿*40 'f(/ *e!* y*w/ *t~/t*0 x*0 Hn(8 J2 *0 0 |*l*!' '!N"!b0 0 d*Q0 *x'*8 6 |'X**\*h*"4p*5 *0 t'**`(Z1 H1 ** "zffsz2 2 "1 1 1 1 1 [2 2 2 >3 3 3 3 3 4 !*(4 4 p$ 03 2 2 62 1 m1 1 A-P@TP T0bx^ht @0pCXX`P`P IpPW&넿*f(k9 9 9 9 "zO-$Mp8P``  㷡 P@p0S$ P| PaSKC P0kC P0P PBS GSPbS gS x0(P` \  ` b R40rbpSjQ72VPOZƟQVQ"P) ()% @P W P%  p@H0L S P  p`0$Ѝ\ 0:@ 05<p@0p`0  0(8 8 8 *9 89 O-M-]MMԠԠ1у P@ P< TU 5A`@0: P`P P`.pC 0p: P P`.p 㶃ᲃ0 D: .pp# Wp"  zkP @QN pP HN +P Px0 <0o (5,%(,D D R$, H$ P @P = P @Z B0 4 , P @4A ! P @4D QX P @0 Q* , P @0Ql( P @04 Q@ P ,`@TD ! / P*0\PB\C0\@PXPvU XQ`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D1}P9 `4  (08Pp8 hpφW @ T 威 dQЀY48R T?QYQQP0Xd@Q4!U:8 8P `4@8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?p-H 0A0E HP? !H !p@]!G0Ep/(50$u 噚z"@0S @!1R\Pu DP x@8P@H8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0G? A@pQ`13 P PPP*!1GPP! !Q :ArHPܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0a31QpP!a!! 0`v3PpWp#Xp1G 0)G!0B@1"GDᡞ@/X0^ 0R3a@/.!PV`0PT3_>QQ10Q0U@A!`? Fp 0 30a@ V㸀!` 1ؑT/ a!R, ꄿ********t'*x*|''9 *: \*X*F: ؑa Q o@Pp$ x帀@8d<`P0oG GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  +_Бp 4J?@ so H44p0o0 /LP0@%X\V Qph? P0>~  P\% R\%R`d~ o: : : : ; `*UUUU3333h**Z; ~0: P`P P`*p@J P  0P P`*p IPDPl`F r0TP R&0 댏`H pJPOE@T`VA P !1L%H ]+0`'r; = T; >@ !딇Q FL+0 P LgI 3+0j@PV.>P f@ PJ EIBP%xZP , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0_ ,Pz/y~#QPP\  P0R0CP0R1,@,@0ETl @`XA=p@8<$Ϡᔆ P0QP\PZ! @Va dJ\j ; *4 `@, Z !/@ ZJjZ Pf pzHE h [$Q`0pP tx R !x ꠿* PJ,@P TX\`/$%R0Q@h$l` R/dPYT P  Pk P P P` <$P plQ>dHD4-QTT! !-QPeXPeV d! ! !D@pD!!G DD$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.4F0P  UZ ;4P   0x 0S0# !T P`\uWl`|*^F0< k< **P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82tBPC@ 0p@ A尜DL`lP`PD !LlZ?#\Q @0`d0 80 0h93H ;B XaAQ 0SApTP尫Aa[*d唫AP@ aPT@TK.DT@@C< "a<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`0@P`t*PaP ,  PPe }@`,V:T s PQ ~E  R P _E EP: _I` :ꈿ*= _A Ezhz0 l dR 07E\@!U04@0vPLj @D5Lp0? dLf(ht@z@`AL9z_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  -zI> U y0- AF0q Q0 ,Pp@X  !)` @ PTP` 9X  2/X  )4  +> 0 XPq#P|QXp  (`@ UOFKgD\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / yGy dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !lyp y @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.9VDVCP PP\(` PJ C ?> 0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daDx4x(KЍn k0T&%( *t''* 됿******t'*T*****|*****! <  ''*8 < < = p@-M@P`P   +tPt!"$! PЍpC], 0$됿*****= M-MMԠԠ@`PSTQ LpW@@! 04#'p( Pn  P;T_  P*06 q`V 7Q  QWE @_l4?\ F0KMq1 *0hK萿*******"H-M@`P P DB!p_'"$" dP CĜT 0R"(( !:+Ѝ脿*****y= `0S * + + 8+ 0/PP B1 B/0 //f(< p@-`t[@P\ATPC/EBpx*t'O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQR, - (- D- `@1 .Ha@aV&`aV QJd\8 _Y0<LHRP Ѝ S`R - . <. X.  0H!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQI< QTT! B! QPuXPuW&d  R  b9 Q?S <먠    0 H? ᄡ< !? <A0 P9 4{@8n 0 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_***U > f(1= *t'= > > O- M\T`0dP p e7@ PUSQDP sP Q QP Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0P @ث 0`p'?ᐛ#"2++\%R !`0Ϡ|' r! xH;0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0p2'SQE `z(1!2/pG w( X q13?A qX0/x 0 @ 'TQ% @p`p #!p`Z`p@#!p@W   4l,48@P0 0 ЍO; ***U > **O= T*p@-t`P@P x4@P 0Pppt'*G- MPpR `@P< a@, drP `Py  Dtp[ (`<ND 8 0`` $(Ћ`0> sx Isl Es` AsT =s`P `Y< , tp6 tp3 >sp( 0( pW *⨠W  0 a?P ݯ0 r*PP X , ݍ0 ud@(edAzd@K-8MM8 ;PpP`p @0 P?p@rW `2! 8Ѝۍ0H-P@8P /P0$X0HT ( +( ' O-M(`,@P 0%V` 0p%P @h`0P " Z v"P`pUЍA-M`p@=(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R p"" " " "  " p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-MMP, ,j,@q $ YPeP=f@QU> (B (B @ (B (B (B <@ ?  +0rRP1D @ R ? (B <> (B (B @ (B (B (B (B @ d@  㒮l)Qp R  R ZP] bP+0\>SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P#[<fV<X f ,pP T pW -pp"'D P& ;fPJqp @ &}qp8 Pe op_ P P,@ u 0U7P@@th l @D 0E7@P@tP(P @D.P*  0@Xz*$倄PzPh Q,R /\@7`PV7VeYP64} # p, {R  h0`P!6@LPPL RF7VB( pL| ЬzHP0 P`UlkMȰ  P{PrJ p8P 8P I @YTbfA06  / -oz Z (o4pᙋP< @ b%dP  0p0V W  n`V_prᢍ.8aT?  ppL(!PpP (P @D  7V$ P WP  01| 0,*> t~/*K? J2 *Q0 *^7 ';7 *%e!*B6 *"45 *0 y'*'? `(*!^"z2 2 D"1 1 1 1 [2 2 2 03 2 2 62 1 m1 O-Ma;``  @P@Q 0SU0aQ JQ 0KQ 0MQ SQ jQ 0kQ 0mQ sQ0pBQ GQ 0bQ gQ0`pP p`";"P 0''1`0'#Qw "0'  P 8p<0 W ЍH 0 0$$  8 8 8 89 9 @-: 44@( 0-]f(m? 9 "O-iMPP@%oϟpo  G"1  "" ? @P",R*?`0F|?0V:@'T  W W O@尐TY R0@ C ! OPG oo g & f f   ! Rv$PVCo  `@wP WP5< W $R,f f2! `VS&Q W01@( 5@d X X5$PY 5`50,0PDP U:T P QR !bPQR` ( @P, *$5${5`,`($ @P@n5/M0C0 (ࢂ0 0`fR `$`8< dPN\ fbX(@DPHL \` $(0,04<ppmn n  T@<%<PGh@`PU t,PB*x \'LY\`\ P0' 80@PV Kp` Y  d V:VK  0Q RS 1c!QRSTK\ 0 0 0 P30, VPE0V A0p 0`0V1 Lp㸟O pPh(d_`P!:!&{0;qa P8| 0 (@0"*s $O0 : jPUP 480@P rRp.0 n Pp GR pW  P@tIP ,.   ^ ,P4 Ym QPP PR00CP0xR0$4$TmT. X@Pp((,P,LPd +㺵 oRp#- &#0-   0+'3,l6%A0sv 7@ P  P+" AR*1p71 @ 7p 'P`P:P `PX:P U:k 00 4(p _7VE V7[  P0   0 D7(P P$P pᗐ$ $pdW:0 & 0(PU: P00@,P[j LPdK$P'\ Pb$PUZ.EUPPR[8:[_ P1 Q R. !b P Q RN0@,P: 9U  PP(` P!  T P[:[ P Q R !b P Q R$ P[@U PLP \ 6lP kV %"e%aq' 'd  `l(4miy6P\ gFvጃP$ 0@冃P  VGU $\6<U*0 UP*  6 d$S( ,p&:wP U Q:QP YX h PYXRM* @ tfQ 0PR*A6, 0v < (PGU0<*!!U:LD&^*3333UUUU**** @5q0 ;003S ;B0V@2%P %P@0@~,AU1P\ '' ** * 0p'U*$A5 j$P  0b  0ALP ``PFp5 㰦g`k V `#P p l h dj&ẗ" | $P V0P :@,pPFP PUCУ& 07V㴰$:,pF ` PV1U5  *  0 ᴰX pⴰfH'QS*` 0?055LpP`JPA\Vj @`Pd`plh,j |GPPr &X2@` 0 Eob@U+`*&0#Z*+10%A0+jiߍ+!I E A = ;8 83 0. * 0% 8p   Ԑܐ  *? *? *i@ @ D D **A &A *`A A X*\**P"D f(ht@`*< !  C B C MC C B B 'B ?B ''iB 8B < A = >A @ ?@ @ ? @-L(ƞP d Q:Q0 @S RT 0Ad!SRT\   *H-MP`PTp`H%G!  FPЍ ***D D G-M@LPN TL8QpW,appP,0`V5P P+02 q`V 7Q  QWL0\ D0ۍG/+0ۍ*`+ ****\*"H-MPLp`@%G!  ʑPЍ **A B G-`p 3W @ ` pP @  (PUB@D`Rq@ (  *`*G-x`0FQR vWO:nPK P 0@  T 0Q0 pW S Q @p0 pWх`! 70fF&0ἅ0 A0 @ `  m *C "O-MlpVP} ` W%:( /@0Qx  0+u06&000A@`(`WO*@WP 0Rp&!&T $&0f?F#0(  h0" XQ S 0$&?/LP5Q0ᒀ$ ' P ((&d 0DЍOhT PH D4  00  *\D .D zD '3D D G- MPpR `@P< @, eP `Py  gp[ (`<ND 8 0`` $("`02 ifx fl f` fT f`P _v`Y< , Ygp6 Sgp3 1(gp( 0( pW *⨠W  0 2P /0 r*PP  3  ݍ0 .ud@(edAzd@K-8MM8 ;PpP9`p @0 P?peW `2! 8ЍۍO-MMAn@PhJP Q7G@ Qg@ P1s ~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT ! P*V [aAi/K  pap 0PP'  aP 0AP' ap McP0 p[@e(QP @ 젍2P QZ rPPV ` Pp pFot*Pv o*Pq  P@TPV젝q0(Q  @oow A 0  0f'0($sU @F*P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP /$P@0S  000A B0SR @A@dT`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>lp d(G,w0gP n9bp `/ [PT5 T@7*<?W?p#PW :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< <QuPsPqC   TpKp I @ eP P YPR ^A ZYPN8PYPI Qx@P[ AK( (@@ 8  P2 HPix  Q8! Q/GP- 8 PDh T+SD( , `RMb@A{Gz???eAGQW7,  0PPZP H'z8![ZppZp PPLLg@@pq8P 5@   W!DppZF0SX  W &Jf0 vD0g"Q"\P Fȕp  D0 YpXU D0 YpЕ D0 {Yp D0 lYp岕  0%00<000%00  \E @( 0 00'a0 U@(0<0D0 8Yp  @3DC`p pp0VPP  p0Pd  0 YpL[ 00 A 00SQ: !Q8H@(0 0, $084p0P@ 0<0 0 4$ P pP$Q (#@0D q0S0pPdдU BDpǴpPU ㈴  HH0 XpʠV C0 Xplx 0 Xp0 0労BP`p\j 0ppXp P1 *_X#PAPPP P!!\P PH H@LPPPTPXP##P,A@XPUmh+l+M M t~/+O p+ O +y7+N N N N x+N ++uN +XN ?N `(t+N -O IO xO P,X,O +++++++Hn(X +X f(X H,-@=B',O P ,,,CP dP P P P ' ,l 0,@,P 'P O O M M A-pP! @2`P T  PP P QT P A0s(0   p+Y x~/X H-S# dEf(,Y H-DQ 8Q ,"(( Rx,, `,t+H- 6Vp0,hX O-M-Mfv @% $=; < #P!qE 0 EWpLt 0< PUpL @|0 P*Wp3+W< $  D  1DP@#0H头<` R D0p0PpW d4!(q!( #H4  A<$0@  0UP Pu 0tC ,3`Sp 's  `ß `P pPdXs`P4 Z 0B:   A 0A Z@   ? {A Z A pB `  Pdڨ2 ]  PptBp- Xtur $` PXH P  ZA H A*  0I Jl| L%@ q  * P| x1PB$`##p3p@ A81BPp@  \  R 0Ap `D0g"Q"\P ЍЍPDReA`,@,P,+,l++p+*X 'P X Mb+,h++NX +GX f(,h,x,, ,+P,X,ɚ;6e5wK+H,-@=B'O-M-8MNUϛ@  ˟   A 08˟I۟帍席]`U@   A  0@:Q3@˵0  Pz  A B* 0 @Pt M P^  A B* 0@INH˴LN   1H @M  ~P>  A B*  0@8H˴LN@ bSp  ( *SPUx<D.o@@p+wR R R R f(A--0M@>T 召|B|勬tRt凬lbQ `偬P PHy @ w(+   +Sm 1Qh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S K96 W 0,H-@`p P^U U U  0pQ /`rH$/0qr  0p$Hp+W W rW QW 0H-M@| wP PkL0L 0ᠪЍ0_0 Ѝ0H蔪p+0,W O-M@`  Qᾐ庠p+&` 0pȪ ª 0Ὢ+p帪&`峪V: pPW *@@a᧪V`FW:ЍY W W W W  O- M`p4@ -R@%PP|lT@ l@Q  < l ` dPP p xP, qW-f``P` `PfW Pyz p W@RNPZT1`PEMeP`b`PL ysl]sD 8 L,<P ds ^sXm \sqaQ s 0sY_L   {LppsLp]PYY7LT cLp @T J YLpBP k |L嶉3@BLp`Pr0 ᵿ4 0rP \,Z `,Z `( C  @Z SZ .Z !Z bZ x" qZ Z Z Z 8!Z dZ p@-8@@P0@,`PP 0զ\,Z f( r"O-MMP#`p$P!@'P  吇U-P w匧GW夷  ᤀ MP!bBP2`  $ 0S` DR MRᳩPP NR6 RR  A<&QP H T8(A %QPdP  dP־ P `bAP P& mdP -wQ Z-@r)P $u 㤾P\j@@lQtP4 PP`pFP(  0PwpWBAi$b l  3P xX0 V! P HX0 88 0M J  P hP X0  04H٤7j ,7^ ![ x,t,,t~/'[ [ L ,[ ,',[ 'p,` -|,s[ l,h,,9[ Q[ `(l f(,P! ',P [ ,b\ y\ !T .\ I\ \ \ 0H-@XX PầH ᶧ< Ყ0 ᮧ$ ᪧ㋤f(\ ] c] ] ^ O-MM/?@@`,, l`ll|<M∯\x``T͞@PP P LL` @@  P ,P NQ/P5=ꈰ9븎n~P  @F P   h  Q P@P<@P Q Q @̌Q-  ` -͎@0  @@ 0pp%P,0u u u h D` L < < 0  PP  ,@ n P L忪a@Q?⌌ <  d < < < < < x < < < P < l < <  @W "Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoP- Pf[P} F@, PV(& P] ^@ P@}PN JPt P,w  P H @@ P * :$(,048<t th,@ yPV P: P P @1, d PP% @ P P @ `P aP Pp `P$ @ἥ(0᭤P PK o ``\PXPLPt @1 0PP DPsP 0nP PX^0\ P  s +  >`Pj P@ @ ԿPBPD  O@ 0@ ἿP* P ᰿PVP% |0 @@D ᜿P @ (呿Pe  0 s` 2 |0 sM ` @PP @80 iP` 됕xV[ 4  (V` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  Df -e 0@pQQT@l@h>PyppdhPn 㘷  @們Q p 1 d |P AQ  QD PB   5P AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰPႤ@ThX yv e[x弱夀P @ P:@D e d`=  p` P @`)Ѝۍa !  | (,,(,,,f(a ,@,!a!a b a !b Sa p,Ya ma Na Ea "4t,"a 4a !Ϫ za ,nb 3!! b [b b ^ ^ _ M_ ` a ` ` ` t` N` %` _ _ _ _ _ m_ 1_ 74q ^ G"^ U",'P a K-P_ P" `p匐@QQ Q  0B01F P 0p0  pot,p,,0,0H-P @P hQ\ 0 B 1 <QP @ P0p,,t,G-`P P  xP /P../ pPP* r Q 0/S/Q Q P/R@P5 I@ P  B0QS/SpDr0.SAqPp`FQ (@P@ET@EPP/Q@@hq@ Q   0#Po!>f(a H-<iP0P$Y"P[,,,a (,A-@ R R P䀟`!R"R'Rp?o2QQ QQo2pS KR R R  \RpQ  " 0f(Ob ,b A-@ 0P h pW \\!?0`V`p`p 0`pW!@ R  A0 % P *  ^ R 8 @ H  H @ H X H ` H 8 H h q P / = #44̡ @%t,Hn(p,,f(b H-MpP B` 0 d@P P P0QLX38< X0p嚡V`Ѝ,'t,b f(z{ b K-pMll`@B 0 &P8iP0PA $吐P! d`P`Y  0n .P*  XY$! P p 0 P  0 P  0 PYIT@pЍ',,t,'b p,f(b @-\\0 B@0 1 D P  R T@,'O-MQP  X0 P# @P pt X0dQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P  ᱠPW  `$`VP@U:Ѝt,f(b c ,,,p,#c @,O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  XJP@0  P P PU   h 4  4 $HP$H 0W ] QDP nK `V  ZdU  TpP $PX $C(ppp} TX pP Be0" ^ 5!d"X W> L  0< @ZpPu BP/ 0 pf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0 Ѝ,/c p,f(Gc ,d H, d |NIL"c c @,c kc c xc |INOFNDId 0H-@P |0x   `0\   D e0( 0H\H,|NIL|ONTAPE|INOFND""O-MP  X0뀑P0:dpp@PXp}PQP@U: E 1 `V P P  ᐞ9 `@T" `圀堐XP pW PP  P  l p$@TЍt,f(dd ,,p,~d @,d H-P  X0 P@T `p P $p$J `@TV4@T (P$@Tt,f(d @,d O-M  RRP  X0" P  X0 W D븁就P` R]*唑唡lp1P` U *@P  0G  ۝ %0&  @P *  " 0ᮝPP 40 R:Ѝ,t,f(e ,d ,,&e 6e Me ne e O-MP  X0DԢ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  PU@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*Ѝt,f(e ,,,/c 6e G-MMP @8P ,, X0u @TP  X0 _ȠP':P ^P `pV  Qk@T@ `PU:Ѝۍt,f(e e ,A-P  X0딀P8`@PP p RFP pWP@U:t,f(e ,e H-P`pZP @o"@/o"PPoR T 0RP P ,t  Pf -f f(e O-cM@P  X0t$0``c rP S0#Ϛp 딓P T @0x#0輚 rPTD՛ @C0@#㬚\p P s AP/ $  PuJ(8 Т)Z`PI@/0A`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQ PF! 0P [eP P2@ PH  P $P6P c P P PcߍcߍOHX`XT$ H0 㒰t,f(Ff ,,'ef ,*rf h,'f f l,f f ,f p,Gj ,4  k |,x,,t,g 'g O-CM@(PP& UP`p㰐Y AP y i^ py@T:]U[ ptXp `P 0<PP P `X:P*P  04 P  0* 0SP lYP 7\ [:P Cߍl, -H-t,f(i i i H-$ 0S  P/l,'p@-P@`  P ll l0 a P  ``4L`px,|,h,,'H-M<y P,0 $0 $Җfj j ,j f(j @-H@;p `  UP p@`;Ѐ'@-$@   P,O- MM`@P/0{ [ !  0 01/ Ѝۍ0 01/P ! @0ፘA댁P epP dhP TT pW 0XP  orp` 0[W @`尠0 P  P +0 0} D`p 0.@`W,3!t,!f(8g `g g p@-M@P 0`@P `Fv\\ P ?  + ;Ѝpf(#j O-MP `4,㰠Q +:P+Q!R 0KS p@TP T:P |  ˜pP T Ḙ pP 8 0ppЍ!,p,f(g g g O- MM@hgD/Q 8\XpPC @P? `P/0젟 !EP. # "  GPqP pU ݲP cpP  PXP @(0/Pp Ѝۍ!Mb,t,H-P /0`@HqW !  p@@@ ,@-@E:@XO-Mp P  X0& rP#@0#0#P 0) 먓P `x:0 P` R@`@( p`@  xPU T TXxPSP@`@0T Y@  @ $txPiPZO P@G $ TP@Z 0P4p lP 9h 9x0ST ! 0u $02    P h0t x nt 90` 㻖@v v$ 0 T X:Ѝ:_ @. *) 0ЍO|\vtXDvP P 0< 0t,f(h ,,,'f l,h h h h i ,,@i Ui ,!i h lh wh Bh ,h K-MMP@`/0pP # "  0Pp ,8p(tA 69@PTD` Tp{ 8p# P 8p) KT88 @៖P_ ᖖЍۍp P@ቖ<_l PTpL P@z}-_ (sT,ni t,,,i f(v i a s p@-/0@P`8P # " `Vp,@-4 T#P D@ 0b9,#P@ 0b@9''p@-`@ dPV*P ?<P # " $@p,$, ,p@-P` U: 0 ?0P  " , $P 0@0#@$0$0$  p 0p@,j $, ,k G-M@PP-:P ?qW!   $p P@`@`TV/VPW P pV pWPۍ,$, ,O-MP0p`Р L@DZ: 0;P " $U /dP$ T &Ѝ(,,$, ,2k O-Mq(@PT̡@P`P @@(@V($@@`Q(@A$(Z ]P `/q ` @$ >  P  2( #P!: ?P " $ PPh @ \0@ ZЍ(,,Ik k k ,$, ,kk A-/@/P PpPP `P PPm O-MPt ]딀 q`P O@Phc  BT0aP@U ЍOWc-l ,,,7l H-`@p V: 09| ?1hh`1Q$0A$@T @P! $@T,n $, ,p,,n p@-@P P P  P ` PPU U PUP` R P{P400 P@$ pk k k k l ,,(, R /R  R/T;n @-@ @,,p@-@P`P>V  ` @/`PuXP `juo pl ,,O-tM@4PP $$ X0cPtЍP寓P H\ ⍓L@P` @`GP p 0 @2p@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(pWX@ T *P@,` Pq ``D@ 0QD`V `@ 0p@@ pp @0 08p@ [ (TL tЍO޿t,f(Rl ,*lh ml ,$, ,,,,l l G-MPdP XX X0U[  4`p ʻk[ Ⱂo/6p ʫ[[ ⠒_x0@ 5Q@PU ᠀4PJ0 4p ʉ9[ D\~T=P4@RQ* rQ=4" `!P `8 Po0n  0PP 0Ѝ1tt!`PQ`PHLP p 88` P 0C(AR`PqW qqq R( R*0`pS1100aS110 0aS11 0$0ppS11`$0( P0 ӎt,f(l mh m +m 5m Wm i m ,,,,h,m m m , ,$,l !0H-P(@(nZP P@0"\u H-@!0S Kaq:p:P P@2P ㍎P幑PRZ P0ᖑt媑P lP\HT`:Z44 0h,,0- ,f(4-k_OI \n i!8-<-p@-dP@`@QpP`P 3RLP @p$$ 0&8',<-f(pn G-M P  X0 DP  yp;Y0\#P  S刓嘣 00+|P0 `%`V Q % 3 P "% P XB PbŸ"0Pp0CA00G0LP 0& P d"pk0 <`rR pp1  R8"BP$tP } R ` 4p4ڈ  B? P B2 P2AP P t!( X⊐JaP"A|PЍ 23s#Y 00!p0_Y LT dd00{pL0 't,f(n 4-<-8- ',,h,0-<-Jx jx -x 5x ,l,@-D-n H-TI,,,!$' o o p,@o ao o ,,H-n n [~"H-MP" QQ @P ЍHtt 3pX <LЍ$$ 0)ʌ,'8-f(u 4- 'mu O-r (r Or `r 3r ,=r Nr _r ~r r r O-$MM"R匂P|Bb吒尠$p P *P #3"#AP+F hG @H F HH \H  P eP Q [P #3"#t p 0H d L,4P04T< X 0 \ `p$ "0尲hPP(pDP@ H L0  ``@ H,P R@ ႌ$Ѝۍ,u ,Tz y y , -f(Tz ,z ;z O- MQ@̱( P ! Q  딡PP Gxx` NK 0`  PP pP Q:pCAW k Q*QW P 8PP  0@!0 $ dP DVP0 Ѝ,,t Tt P-T-u v ,v O-,MMP t0x&00PPP D H`PP (P<<@(P rP`VY PP H% 0iepP  0P^: *p0 \ 0ᐋ, *pP U iM(%5y( 06  01y L ( Q PNPIP`\VF > R|* 0ll$IS L ,< P. ( P tYP@P  c  2-p#DP PR ,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $I p@׊A ъP $", XƊ 0L⻊@B` #0 0Q a0 X⤊(P%tPPW (P  PP(@PEUʐ[Ps x `U! V0pG V@Q  1T0Ѱ ]T`G(@n`FVʴP``(@a`FVʧ8-o P-L-,@-,,f(p !^ o o p %p Cp Xp p ,p p q <-ٛ 4- ',0-fq ,,q q p,D-q q b,T- r @o Oq ?q p P/AQ y 3, '4-H-h``PP QLLP H@ @0@P@P0 Z,P-lu |u ,u T-O- M3p R cģCȓPXQ0 U0SWluP 5 P +P [Xڗ# R [ P 0 ][P[} Pl  pGWt"P{Bx px0<pP P P\ DHP j ,, d$ 0 P5 Pj  tP B P ZU? 8pK [(lP 0 P-lqPP<0p RPA P 5 + +H 0  Ѝ  t%+/Ql ̅ -0-<-,4- '8-p,f(Sw t,pw w ,w w w w x,a x H-,x @-D-O-M4@P,P0p $(`LPP<8H`@0P@ @(p 0, 0D>+pP A  Py`@Y ,X Y Y Y ,X Y (Z Y \ Y $] (P d X⎈P9PP + Z?H+pK  **ZI @   0 @x>PP D XX<P(P +*p:  **ZU P@   0@ PDH 0'P LP  ,P   XP k+P-*pԴP@P 1/T  `S* pR* D@$rZ 0P 8[  (2/P pDXP`)0 廇pW`P @SP  *8 *P @ 0@C |8x# PP @P *@ `PU 8  ))Z 0{Pr p 00P $ XPL `PP  X? ЍOE`P=  X072O0|& P ~8~dPD tt Up@8O0< O0  `Ѝ_))G) vU }~8z~pP tp@ 0J),t,f( s ,,\ -|,` -h - k Lf k s ,!s k s s s Es !6"^s X -T -e f t"s 'r r r   4,k pC-M`@ P *P `GAPhUP @PP L PPH؀P 040  PwЍp - - -3v ,gv f(O-,MMD A "Ph`pAU`lhQ \XTP A" PA 0" XP`P P 9 QHQ  A(2/A PXQ&Q  A(2/A q A"@9/A"@9/A  pAA P0 pAA APPPA 0" `PV },Q  A(2/A"9/@Q Q  h卅Q Q  EPRPA P P< P P 0fPP!PPy P P`gQ8j@P!0|P ,Ѝۍ,t Tt P-T-$'p,t f(@-,u Du H-MT  P< ЍH=T, 0(0P X -T -,w f(H-L`@HPpW0p$ 7p - -~v -H-0P ρ,,w f(O-EMس@P P  XڄT 8c@XpP PPp 0 ḃP @0@!4ᶄX X' X 0B  B  0 y'"$ 0B  B  0 c'" 0B  B  0 M'<"p 8P ,oP  P  P P  0 Y:XX X# X[ 9!!X% X- XL 9L!+  |9!  9 pP   c9   z9 ptP 0| Y P X EEߍ`t,f(s J't Ct 2t #t p,Tt dt t t wt t t s t /p@-MP@P  0|3/xPl %p ЍpL@P`nL< 4 0`尃㑀|,` -h -,\ -,v f(p@-M@P  03/P x 0p ЍpL@P`8L< 4 0`z[|,` -h -,\ -,v f(H-4P4`4@pPP p,,k MH-M(   <ЍH Ѝ/f( kPrnrlQt`t:s0H-MQ  13?  Q 1 Q <R 040,@P0 Ѝ0 -I,x f(K-M/@/P Pp/P Pp/`P\ 0`PЍ0H-PP NN@PH&p `P TT X0Hт0@K0  0HÂz ,t,f({ { 0H-M@  h  PxQb,Pۍ0xz -0H-@  Pᑂ ዂ ᅂP  } P  uP  m$P p e0d\` S ] LY<<0Hf(| | | | | } } .} } -Q} p@-MP@ P`P ``PPP8,@, ,0 `Ѝpz -z z 0H-MP@PY$p \P PP X0Ѝ0HJ$ ( 0Ѝ0,t,f(z z @-@P Q P K G@tP$p XP LL X@́~J0 $ @!{ 8{ ,t,f(X{ { @-@P  @pP%p TP HH X@虁KJ0  @莁h{ ,t,f({ { H-M`@PR P#p{+J"VP#pڐpP x0x| V X0PY@ WJ,, 0 JpЍ{ ,{ f(t,| | &| { MH-Md   HP<P ЍH Ѝ/ P~f(x,}w"~} 0H-PP 0@#p T@P DD XI0  0,t,f(S| +| @-@P O K@pP#p TP HH X@ЀI0  @ŀg| ,t,f(| | p@-X`@PU *PQP@ p,0H-PP@:hPQPU@u: @P00H-@P )        t  P P@ , 0-|NIL"Ќ""|NEW|KEE"0H-@PPPDD 20  @0P 1,f(g} A-@Ȁp` " AQ  VpP U  AQ  G P   nU yUf( ,G-MP40`p@.PP/P << 0$   0p`X1 0  0 z        l  tT  ` uA@Ѝ8&,>} } } Q!} } } } } } r A-M'bP x pP d \\dP !9:8P P| P@@0P Q !0  qpWcJpp_Q-Q\0Q0!|p ?[qP?UBJp* Q%  r  * 0R"p@PLZ ` @ P  0@"PJP * 0``4"@ 0`+" 0`#"PЍH6@{Dw@4j-l --T!* Hn(h~ _~ -,b"R~ 7~ H-X~ A-BM@< P`0}  Bߍ} -H-PL@`pQ  pJWHR-@-$@P -!} H- Mp P0@s}X PP ` 0   p  gP Xo   P`qE@-P*   P @PH @P\ \\- XkP2 @P$ 00-=`FP@:Pa0@3S) `@BKԊ t t t t  4 t L Ċ Ċ \ t t t ċ t t ԋ ܋   8 D P \ t x t t t t t t t `R 0A@@ S3        Ќ    @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   PE;!X  aQ QP 7o/oP" Wt`Q pp@p,aT gT cT\'  p(P ` px  (@AP @R p pQx `xp@@P@ P PD  @ P@@  P P( @ P@@  (P P(t , @ P@@  P P, 4 @ P@@  \P LP4  0 @ P@@  P P0T`K`Q PP $`@P`XX X zhp@P_ p7P `P 7P P  P`L\\BTH;3PP 9p@PP2p@P- <P R' $0 0 ` `QV1AV0v QV  `\"-$-p@gPD P@P2P " 0xP  xV3$DP TU 7U U--$4bx xL H --(- -,- -`(0-B4x 0:$.:(,:,*:0(:4&:8$:xi!4-b`^,- ---- --4-!D- 8-i!$ @ r"  H-X--P-T-@-<-'-X-   , = J f(݂ Ʉ ![!uT Y } [ 1"0H-0P@P PPP00'O-4Mp`P@P,P1!,0 $"00 (P PPPPYp0P 4P P00 Gp0<P 0LP x0pPp UX*` P, R  PyPP `V::x  yp7P ,Q>8  PP M w0@P  w(9[P 7P P|@t9p4ЍLX ֍D-4- v,- --- J!݂ Ʉ r O-\MM@`P QH 0@<$\ЍۍOXwVwSw@P}ܚ ܚ ܚ ܚ ܚ l ܚ l l l l l l l l x l l l 01w#\P{tX` d"w(\s { 8w  y{  x5 8w!p4,0,#W W\P oH`{X   vQ, Q-)"v"\PC{0Xn \ЍۍvdAP缜  D T vWvTv v v Q\ЍۍO8j@Q:g@P189 :0T;p<`=Pp`Pv%8;=E4@APBpC`D9 :0<>?($ `pPP4kvjP8 @0`v \ЍۍO!v\Yv PUv ,- 8,; h"a A n "f( " } f h w G ȃ ^ ,"Y""J "O-DMMQ `XP&vL"@Pz4rX`@P`XX  `w 5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hX qQ4?_0 .pA~hX pP  .0>D 0 .Xu u ZP@`@P`XX X vXVDЍۍ萄 "f((- -!O-Mp@`V` ` GP  , L 4 L L L < W W` ``P; V? "VA " Pp 0`B V0 a0BSWBA0BS7B0R00S`P P , 8 D $ "Pp p P@ P:0WW``- KZ( Y /;P1 W/`P ̝p!`Wx 0`Zp @`Ѝp 0  zЍOC/`P WP ᗝp.P Y@P   )^`P9`W  ?( ފD-'8-Y@-υ p@-@`)P R!PRU e1 E op㭊 ᩊD-݅ 8-υ H-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 08-0H-P@U U g] DY 0s0  sX0He W s f(O-dM 4"p(0P$8,$<0 0pp<P{ /P~ $<0 pv<@Te @@pQUWyQQY NyQ pwd\1X @s xp2 0`C`S``0p01 P@pP" H `0`bD 0`\ ^s `@P`XX X t@ T:4(dЍ@㒉(㏉l 'ʆ % [ k_f( r H-M8 ((0$  $sЍʆ % P P Q$ss   0H-P@Q  \0t4 0Hr$0Hr  0Hr2 p@-M@PQ`{P . P ,P `V V NT\,  Ѝp@r0$$ 0Yr Ѝp\-]-]-) ]-Y@-M@T T Ѝ@Tq( 0P @P.P X`P@T[@@ P,ЍpY]-]-@-Q R R  RR@zX@X@0 q]-d p@-lh0 @Q   A.@R$B@@@@@P`@ BU:  p]-J 0H-M@Q P5_EU_oP4O T *,PQU ʠ $<P,/U$$P apP  - 0>pP X X ap@ pGWʌ@T@DЍt~,` y눋 <#-(#-8#-4#-0#-,#-t~/$#-X' #-#-#-`(P'f(D#-@#- H#-L#- @-(M \\@LX880$@D@,   @ @liҗ  f(# X a D N O-TMMPL<00 F8|P,D?ceHU(@`L P[ 싟K쫟`Lp]V0 0 `[0`x8V4K 4X 8PK+Dx;UH0ppD+@;UL0 8 P V] P V' KP<Q XQ8  PX XP : P |skXQ8 <P Ddj4X>| @<PT(<@Q3 P18E> ~p PP%  P| 9k PP x1kPpWP 80 T TH<00 07/P<AQ ` 4 p  X 8  + 8pW P 48 @<&P @P<  @0'pu,  P@&@PP`00(j<@P @h 44 jD#jB j@jPHppp$p \G GP,,GpppP hW,`,LGp  ,W,(,Gp  V,,Fp  V,,Fp  V,},yhFp  PV,oh,k\0Fp  V,a8,],Ep  U,S,OEp  U,E,AEp  pU,7,3PEp 8U,)x,%lEpW \%@P 0it,,$$$iHQ i(i i[I8@ E> @@@ pt @ 0G8 @@PE>  PPPpM P4 Pj8P@ E> @@@pN d@ 0!%8PH @E>  p; P$0H8@ E> @@@p+ @ 0@_0iPXT^ 8Pp 0`L- PPf%P @E>  p i7"j18<@@[@T' *$4Y3*4匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $$0 PP  #0 PX4 R-F2 mfP#-h&-!! '8!T',#-0#-a s!n g b [  Ë  ԋ &-s Q!| (l !tߋ #-#-u P'F @#-5   O-MMp=P @TT?QD@]oP.PQQT o P 弿 (c$,,$ `( 0p+ , Tp oP  00@R   00 SP W, (`05 P( <PT=PD AP; =PP4H=PppP `P`d00@D,dD`DDD,@p$P _@ = @P  tfP W ,Pz @@ VP p@  NPI  IP^  DPb  ?P  :P  5PT @Pt hBQ0 0 0 0 0 0 0 0 0 0 aRm p p QrT (P PP@{ @pQv U@TPY  @PW PV PU PR PO T ' @Qo PlP8 gRi3T <(PP P@PUTdP @ P @ Z PL@ =PPF=P@P 0P0c` X>FtM.tp ``X `p0 `d0`F> `p D`@P;!9Ut (`0wd 㬁P` =PP[ =P  =P  P9 =`0@P`05c <BM. p  FnX 0 A``P`d40 `fp hP@ , % P# `V ( ,0 `0  6/ ЍۍOK(0`P PЍۍGP  ,(P  PTTTP =7P`ppd "PC/ (P P7 P% ( { @PUPL(,P@pW`,P* X `/ L Ll  Pb Q vQ Q Q \PTtR:"x!PT ``F> p H`4 G 0@ .  =UO PeJ(KeB &&PW  @Q s0{ppP ppy pP.` 堠 P  d PJ 0pPI c 7M. 0- ľ q 5 q'  @P LQWP P [&  F0 ̔0pT@` A$ M> Pp @@_@PT!L[ .  G @Q  @#-PP   `PP >T'`PP PP  R%  D#-'P#- ФZ PZPZQ)Z&PxtL 44@P$#- p , 8 Hn( z%PP P (#-] M `0 Wp P P, PC 0VM.0(Z P |C 0= 0H 4C0 0,F.0% # D X Kдp.[ [*  #3z!F PR"g"p 5d`Q P`P= \P V $PP P  6,3@APOUJTH TP@/PU*%o , `d @ PP, @ PP3{ ׀"F @P`h["-, tHꁔ |@ꆔ H>i?" (#-P#-0#-4#-[~"k N ) #-D#-h&- F ʓ  " ֖ * ֕ v U z!F M ɔ $ `  7 X t Ö  M0H-M0@P00b 0P P AAЍ0HЍ/K-GMP AN` XpF` 0 @p`PV`v  XQ:/$X`Gލ Q( Q`O-$MPP/P tPt@` /pF   Q2Pⰰ`P$ЍOA2T'P#-$-O-\M@ `QqX: ,P 08P P  # " P@*Xp\Ѝ` @0=4` @0= 0mx$- 0"Ȍ ، Mp@-Mx`@Pd bX R LL0b  c,Ѝp@ Ѝ/P'a $#-H#- L#-@-@P @Q 0 %  I+ pp@P PP 9+ 80T(PZ_@#-#- P#-[~"$#-A-M`P @1P(p 0 WЍRWP& XW _aЍA X0ЍA`P P# PE  X3 DW W ta! oa X   ca# X  0Wa    0|Ka  l\\>aWPЍA8a ЍA`4#-8#-0#-a X'8!<#-J ` C  +A"f(K-`pPP``1@ p 0 WRW P9 4PW `Kd X0KrP `U`PEP `Q P `U PE@W hK`W W0` K`  `4#-8#-0#-a X'8!<#- e Jf(A-PLP <p RdAW P  0:ONIDP PA,, `Pvp@ 0] 0P`Y' 0 P ]P`儀@pT ] ]@pT j] 'Ѝ  sݑ #- T'8#-<#-0#-a G % O-M⤢P`P 먐V, x8 x0 ᨹpA p{X@T pX P2  :PnZ` 0 `}p VP\A嬐  V 0w%4Fo5B `@xp|x- P0d@\0V  V"   0Cx@|x ,T Pd 0\0  Ѝ$#-A / 4#-<#-8#-^ K-M0p`P 0 p3 9P,  0 p$ P \ `V  儐Pp@2  p\ ` pV: a\Ѝrh 0#-X'8! G 0H-(MP8@ 0ᬸp P&  0qtPh^\ :*@ ;AB+@ +S+O\(Ѝ0 r멐 8#-<#-0#-a O-$MM@P = T9 wP `@ZT,P, PXX``8 0`zp VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 Ѝ$#-V 4#-<#-8#-H-0 l 0@  @ @ \R $0@BRHn(O-MĀ弐`Pp @` 0 T  0 p <@`VTDv@P Ѝ pג |xޒ O-dM`PP hZ8 p@ ^|]J 0.Z  0  !Z 0  .[0<P 5@Z P  dЍOSZS Hn(X 0H-P @P08PU 4P 48`PU:XP0PQ4P8P:XP00,Q$/  4#-L#-\' P#-O-MMP` @P @u앟 F쥟 1TP0U@%Pp            @   X  x       p             ( PAP DPYPwPr@Pi PaP[PS PMPG 8(P1PspP#jppW  FP P:   L8W`V LP,P 2X WWP P PWGP;  | 8 | | | T |PgFWڀWI  WV  WpBpRhPj `P P8 Yv W; @Wr!0 0  0=Wd A @p[ A WP) 1o\P'ZIH D!00 0  0f8 '  p  80P&KV r X*@@XT 0 !$!6q0pX$V놘 '- (-t~/!(-(-(-(-'-'-'-'-`(P !W H ʙ K-P@(a(q( /tPP>aPp'D Q Q`Q@@eP! @P:UQ@T tP dP@HH PX8 XU E (-t~/`(P (-f( + 0H-@ PX X| Xp Xd XX XL X@ X4 XUf(9 v ě ߛ  : H-MM@P  UP* P%J  `pPP 7P ``P   `p47`Ѝۍ;UA f '-(-'- 0H-M@  UP DPP 4  p7Pۍ0'-(- O-oMM 0@@@<Pc 0@/PN'P PpB ;[p $  .pI @(,P $P* P: @$h  .ip0P' P!1  `VP p,danXaP  W,аX:(P.  .1P(P% @P 0a P `VX `7|`P p V@T: (&PPkCoߍۍ"!|dĘ8!(- 7 edA!O-MM~fP@T`d D t P.P )P TP PY  6  PY T P .p4p0 P `P Pa ,㍸P P q`, bp*8  ` @ozPBp1 q`V P Y p"p2@`U&P D -)8*$H S6 "2U@pPU oo `A`qe`PTEY @P U ` 0U<Pw U  U  0V@p V E  0qVl@lpP q&P PP 9S7S8kW !Z (-d (-P! ! n 0 7 f( ' ښ @-@pP dP   p , lU5'-5 O-M-hML PH (0@PpEP- `  p(@W  JU$` U U刈 qh` LDP @@dP yP( PoP`VT $` PpeUB~P1`FV PP0'gǟw `T `T4P$ċ@  P0`LP HpP /PV{ 8P<PD @@ V;$_` ` !Up ;$Z `Up G; $UP` Up _P0\4 TzZ 8   T@D <0`8P 3d ?᷾P04 zTd,ʿ 0᧾P G 0 ,坾z p   YT @D <0`8P@DBTpP (P% ; $p$@Ph ZP ``PTp ;$_`PTp Z_ #TY@$PZ U P T;$ @_` p`mTp ;$Z`bTp [ ;$ sUpPQTp  op` o A{F_ZP0tl#"   dPo 0 0  0ᡫ t `P; D @P_ 0Tp ;$ZP@Tp} D[$ ; UPSpm D_Z U0_PdbU fhd@Q$_ 0᪽  0᣽p 0᜽ 0  3@ Qd`P$? H0pᆽL 4o/o AKHP $0 q@ 0jLP0 @4(S@hЍЍhpi|Y@     'Ĝ ޜ pv  %   N < ʝ e v v[ O-MM@Ppb |*fPpp RPqPk !Rc P`p PP\ @@ ᫁P AP  a@P@ 3  P  P O@@ FP# < ERPt0HP 2Qnpl2 R< Ѝۍ $ h (-`( $ FO . H- SOf(9 O-M@@PZ ,q`P! `P ǀ`H~A@U U @B ȽP P `FpV\2`ЍP@P `@`P(B.&PP Vh(-(- (- 1 H-P P P||| Rt4hh h0LPd@dp`R0 SDw H S-Z --"!!8!T\ 0H-@P]P PQ pRx0 RP\9&H5&P0< 00 0"!S-- - ---H-P@P@T`p|T Q\ gTDP 80 %,%P@pO-- T-"| h- H-P H3 諞 -H-P H3 !-H-P Hr3 貞 -H-P$$$ Q3S- D--H-P$$$ Q3S-ٞ --H-P$$$ Q3S- --H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0%J!T Tp @P P H |@P PP C3Aލ" - ----> C 9 O-lMR0 Q* `P @pp pQ T@: R R Phepp p   AP R S(  0S R :@ T T0@ pW T P@ B P@TP* \< $@T9 X4H$ p$Q \Q Q ,P1U:`T 0Q0p@T1EPaq`ap`W@PTpaP@UTp0 tj$0 @ZP]\Pr [P|$P P `` 0P 1@aV,P ]Pi $P  P+P\P $P`p 0V 1F!R H !PqR pP Up,P]P> Ps  D Ps PU P Ph $Pq Pppp 0U+ PU6 P PO R  D QEPC  D P?u B\P P0  ]PP 1EQ HPqQ pP Up PU P PHPaQ `P U`XXP +i lЍHn(@n(----S-@ O-DMMP<@l P$ <>Pc @@c:xFP <<\ PT <@ BP 0 P3 <P. < 00< B@0Qo0TA0#PP <!@P@PQR,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< R@PQY K9DЍۍH --@ ,-,T-HU----O-C -> S-O-T H-!9<P 0 ,,P [ES-S- ,-A-XQPQ DPD`p@ Pp@-S-O-\-O- MMP@P\ |PXx`Vpqdp` 02N<L0+8@PJ0?P 0N 0N +0@PZ0$@@0NoPaP nP@pP qPt t@l8 @@ MH0  Ѝۍ\-O-j S-\ f(@n(Ʃ - { @- 0$ 0 @-p L G-KMp@P3`@PI 8"0P$0D@?oT@Q2P 0M@WT  P0 W2p@pCT Th!<P P @!<P PP P/@3   0/@+PA r( @ R @NQ  VTt 0V)P@@@ Kލ(,@- " -----̮-S-s @- 0$ 0 @J-p *O-MMP P"<P 2B  00$ҷP P 7Px+DP t\r P@?Pt P7@.0Ѝۍdh 0/ꨟ - ---@ ,-,T-HU-----̮O-p * S-S- s K-AMP-@CLP) `P 㿨+0Ѐ``)>p pPJP  0`E+0>py -8 4K Aލ- !-p *S-  P/j H-P ,,, ,0K-S-  -p@-P@P Po`t \P `WP -pU , `P$00 Kpj S- H- 0 `-( -H-P 0P $$Hps-O-S-2 -H- 0 T-f -H-P P!,$!A?o2Q@0!`@PP pP *AP( 00 9-@P CKh@P \h :K\PL  D  *Kj -O-S-u ڧ O--H- 0H O-  -H- 0> 4T-Ϡ -@-(@(0 3  RO- --H- 0# O- -p@-MP P P h/o"Q ) @a/,F@PpP ajP<P@,Z@@T P x` h0P t0@  T0JLDL 06Y(0ЍpO-j $--S-O-S-: ]  -H- 0 O-d -H- 0 O-m -H-P PP@PP P ,@0pʨ TJ:,xo200pP`TT @S@p L`@``0`7JQ  T-j S- T--H-MP) P'P  29P P}Q xP ll\P PPP 000+Ѝ轡 -O-S-Ρ ---0H-P P  P =P @p 4<ll0P \T I 0H+0<F)($ }0H -@] :|` !d0  $V ЍGG Ѝ  - k_ - *S-y O-$MP P" t7P{ P! k7Pr  @@ )P |P o;P^ PY @xqxPP2@`q?P  @P3 S-F HU--0H-|@PllPPP`;P HH< F00H( $ 0%0H肨---S-{ U 0H-p@P`PP9P DD8 F00H(  0$0H]--S- * H-MP# P!P  5P xWPl}Q `P TTYDFP8S(Ѝ覣 -O-S- ߣ -H-MP# P!P  h5P xPl}Q `P TT!DP8(Ѝ覣  -O-S-  -H-M P P<  05P $ 'Ѝ - K-M@P +㛢UppE`  +aV +[`U0 Pۍ! -H-M P P<  4P $'Ѝ. -H H-MP Pt  4P P T  4P P,vP 'Ѝ - N -0H-P D@ PP 4^o'(0UP0O-j _ -0H- @R:]'L00@ PP  >:P0O- x -0H-P D@ PP 4):'(0 P0O- -@-PQ ''P<@P  %P  BHU--H-PQ '4P Hz6HU- -H-A@-M P  PP@ &L 4R@P@$ឦЍ衤 > -H-P/@P%,,P%<xO-,T-HU--$.-K-MP P!3P ,P p\`&&&HH!p P 8;P(Z/@X% P PzK%G/pЍP3P `)@ ᳛P  P @2/LP%/@ -S- $.-f HU- X]-x-Ҥ H- 0~ - -H- 0t 0T- -0H-P PP U@  p&`0L @HH000 0幠,U0 0H诠----S-" 0H-MP< P @  3P,  3P( P%ʴP k@P  P  @_@d+p P L+iP %Ѝ0S--/ -: p-,T---p@-P P!0PoobQP``@'`@@ P P: P 5 P %|| hP  \\ @HHP 88 0|C pj !O-O-S-A -H-,0, (0\ 0 O-O-q -O-H-,0, (0\ 0 O-O- -O-H-d`P` `0@P0lHpPD D0``P0_$`O-O-q -O- O-O-H- 0O - -H- 0E - -O-MPPR@P$Ѝp` P  P p P`U 8PJ`U 8P-- U`T P 0 0p S pB U`T pP x0dl `p0h`P S `BT- Q-!! "O-O-O- S- jO-O- H- w-H-P |UPt}Q hP \\WTFPHHH 000M$ ) -O-S-. Y ---@-MP P@ Q P QJ R  !0`  R L@ PP @ 88 0,0HP0O--ި ٨ S- -0H- R R l@0 PP `!@0@@ 0,0Hՠ P0O---  S- O-$MMpPQ %P $  .P XCP` _YP P@XPU  >$Ѝٍt)d`\ A@T @D @ Sp$Q \Q Q> 00iRZ @)0 ?P@P@0 0@ @ AQ`@) P%%P Pp  P P / T@pP Ha8 @P   >` Ú` 2/PP )㯚K%| @P  P >Y& Z2 LU--X]-Hn(S-S- - HU- O-X-`- O- MPl@!5P LP P{( x(P Pp  ЍаАЀ:`P *P `P"pW pwP|P PP R`DT-HU-@ PA T-(/-O-k_p@-MP @᭕P  㧕P P ` 㛕PU PP 0PЍpd%PPЍp@ 4 }P F0R֫ ޫ p G- M p` řp"/ ̞ P/P:P" 5p P P  ЍPP `A`p<@cP'`PX᠞p pD/ 僙  O z /p团P p. P :㏢P p`./ PPp,@cPP P "-ū !O-uMM@p`xq|qtqpq`L```lq``````x`t`h|pp`d```fhp\``0`` ``3P |p |-'xp x ''tp t!'pp p'P; 5= Pp0 p pR.t\N.x`J.|Pp(UdhP&PQVxPQUi UmQi /.} h_PG Plp lGPP 1/QP p \ P P P P uߍۍdP X/㝡P--P P oЀ pPpP  T P  P|P/?05P 4*P@D T P 4 p剣q&P _ ;  ;b P `8@QpQ P &p&pN|QQ _P $-/t@p t%t#P@P$ ``O 5P 2 ]peV &"P W}J@ Q;Q @ qQ QPpW p@nPP  Mh R ?H0  R (` U/? (`͟(ԍ` R 0m S썢 Ρ0 V4P  P 0( 0 `p Wp  p #PP   X`ᰌ PpP d̟ԚP $P P P#@~$P  <̟ R 0E S2 H0ppT0(;@P0 `#p @P  P  p  R `@:#p0 P0P+ P@ @@[=R# s.[~0SG/ rP@HT `.5euS FPP T&@p93Pj Pး``@h0P  z @4PN 弤PMVP PL`@|PrJD_p,XQPU|QPM PNhJ`DXAP判P |P2 S$x $7P # 0 %0&   P 0 '0*&`0 P& #  P P  0 -! HRh Pd 尸pP!P RL HM+p[P7 p [^: `P  P  *Q QP ΚZ: AUP PPe pXPHpW |QP/ P P -p0P$ p`%mP  \ 0 (0) 8$'* F8P ` ! n 0 ,p9 PPP@q*4/-;ꢧ? "F P81# k زlP) `P% P ! P @P  P, #l @P   81P O- W-PT0S   ! N`aPT 0!3/`p@P&, $8 pP" p,0 S  @ 0R@  qW P PO) [~ `pt|Peeee LUP]>  Pe6P PmצjO-x--- O-S-ì ά $T-ЕUYH8@d @_ @}n U  00p@ 0P  > :P P  07 p0Po2  /p kpj/i?#pv ,+ d Y 0< `0,/-0/-O-O-vO- `P U嬎8@HU gP UU YP P mlalp1P!H^tQ<!0l0L 2!P<!뼽P  7PP P9 p0-x `p6/pt \2x /p|/t/l P `m p/P l  / 6x /\ P <,Qz/ PP  q/-O-,<i/됀P` 4|YpQ`U P P 6@ P/ PV P  }6P @/UP L T5//p !뼻p( `>PP@`D`8@ P1 P   ;  ǗP P[ QQ + @p  0 P ` 0  ?`0   P `4(@P `@[>6PP5 0   P| P P Q'P Q'0 P$i$YpPJ `pWb < 80--p ; k_*P,p<` 0 p `4@@p<`@( 0P ]^uP6PLPW PfP Pf vPP P@[> ,P ^L  P'Q]J(0PP 0` Tz PS *Q.p P0ĆHP!n,Uo)Pu Ppq%TPk;' 0  (`hP@ Xf( `QJpP셟-Q  0QTJPQ pP @/P *R(  ` /  ~0`QCJP 0 ` 0@pL .e o PP & 0(`0  H @P ,[> P 0 p P ` 0  P֢ ϭ  40KCP  0pP @WP!& Z H j )) /S5 S:x W   0(< Q 0  0(Pꊮ 1S#P 0 W4 p0p0 8  0(-<P <`#4ꗮ P \D0 340pp 0(PB z7w`  0(0P4 p  0(^  0pX P PI! E 0pFL 0  O-A(  00P<`pD@ P0 @V U P `WR WF Wpt ?p_! P (0p  00P<` 44!41x--O-S- O-LU--lZ X]- S-X- T-p (    # 5 C T- W l T- Ͱ ް  G (  " Fvl'Hn(< L .[  " 4 (/- _ : ϲ 7  O-LMM@  P0P(P,PPPRP個P  ?%@P徔P  40 ,02%P:㰔P (%P (0Pp ,P P PP*eUP( LЍۍ`P@V= P@P8 /㰘 PQ# P* P#PQ ;㞘P PtP oP jP  4P ^ `PQ  @`P P `P`U P ҏPTP ȏ`P`` `cs@@P a@r8 + P8@<( @D\Cp8 pP P,0 !P X `X8R 0"S K88`U. [,B尲8p `P /㿓P`` P P +ǎ@G T-k ; C K S !O- HU-O- p_!G"--f( !O-O-O- γ ū O-MPQ RSG ᵉP   㯉P   㩉P (Q| P P P PP /ՒP @@`# p P@@@#@l:#p@㹒P PpQ  P+#@p:ᩒP P"#@oPl:㛒P PPPpU  Q QP P* 0M P P P  ? @lPUTP"@P <Q"Ѝ֫ ޫ  T- O-|O-!ۮ 0H-P@""" ! !00H-P0S0 %S S Q PP@@ ^00 PP  V060 /00Hn(H-hM\P ^L 0df/P 00<PP'S- S-4/-H-hMp`P :P 0dB/P 40<P,'xO-S-! S-4/-@-@P P P 0H-@P PU ‘5P 0p@-`P@:㇑P "`'P %|Px (` ( P P !PR! R (p@(ꈰ  vH-Mp@`PP<l0 *d0SJ  0C @P 00S  P ЍT- K-pD@`E P AQ P Q AR0Q  qQ  PO-lMMP@3   H   X$\$`$d$T$H L@PD0ᦙP P`G]D,@P,QҋDYC ` @k C ----h S-ǹ HU- h3-`2-4 -ѵ !p7-, \2-,T-(T-pK--.3  @-hM@0 @@rP sPxl@d 㔄`d ` PP05(z=xO--X2--T ] S-p7-c O-MM̨P 崘@  "똈p>ڌ 0 P]TP2 HP.<x p00P `` plLP|xt4$q p1$P!~00p! P P4 ߷`_ 000G~`p>LpQ_` Qa Qb Q F@[@Ѝۍ <  @0_p@P>Pd"|x$t4q px0$P!~0p0O-8-H2-O-T-O-O- T-O-< HU-S-z.-A h O-m . h3- 82-u Z ط  3 c  4T- ? O Ҹ O-LMTLQ LЍOuQ @pD P p= (P(, С mP<=iP(,  00( S00@BSCC /p 6P 2#P ,P {@GLЍ  <>P@p< pP #P   ,p P$ Pp =P0 ' P@ jO-O-T-Mb f H2- O-LM`Ptpp̣ǿ[ǿS@0PW 0@P}@   ppʯP #P  pPJW~ PP  y@pʌP #Pe j@PJpGPWppP  <# R u  0PQr" @P  P P ء ?$  R# P$p#@Wx 0 08 (P4$p0SE/ppP r_ P=@A>pPP'  P #!P0  @P  P # @P   $@0oBPwLЍ#$0O-S-O-AM` @P00/0 -复嬝 }匭|00p0城xo" ,Q P(P%T PP2@   PP Pp" \P @1P[-P !#T |  x# 'p%h"[ pD PH .PC9P= |P8/ pOP K PkW W /H+PpR`{P * PpP  P ${P  Q b 0 p/ P+ Q Pp <PG \ 7P @ P *, R  [ p  Y`p  z HJPJPP 1/P O`AߍPh  TP P o 8 0kP$  dP P [ "P (WP |P " P 'tXh\'X`lP@p H  PxWQQ gP  ` P ' R P@Q(*P  XwP R'0p `P PP4 P v!+ P( PPlvU#` 0BR0 O Pd P pdz i"T[ Ѐ Xx P  E U& # @P  P `嬄   0- Ѐ X༄-"N YTP @0 @P  P  Y y Y   0BR00R p R 00r! P[y ` V  @P  P # @P \ X0 pP000q܂GȂS 0 P.JP P` p 0BR0 CN P p`pP`pU  0|paXz s!@ ӏ P HP!@ (Gn P 1/MUP DQ  勲0 S R Pk P @QPL0 !0  <8 @`p,`(p0PppAP8Z0 o # !1 03㪍O- O-O-O-x--V O-S- ' ,T-0T-p7-(T--,+ < k_-G !!Y ---ѵ ! .*v֢ f($T-۵ j t8-x8--v ; O- , O-G-/P/pP @Tw`pUn`v+ܠ+ | . V%@1dp1PpW u`9P PP0POPJu0QT.Q@DP 8k ±!!tK-S-k G 0H-hM@\t LPd e| 8PoxO- S-p7-A-MLQ@PC `lP    0n:P $ 夂 %PP uʴP5T P+PPP`P ۍ@0P(ۍA. ͺ .pK-- @-[,@ P@xO-X2-G-dd@PP LT Q88rPQ $r " BPP0PQ0 ,{Q00 E?SSEA<<AIoQ$N@ (A@0,A4A4t@d!pA880`L!01<<8@@ DDRz{R v{AYP\ o{ k{l@ l!+a{+]{@W+X{W+T{ l P  G/X2-$ ,T-8-B-HU--.H2-82-.--(T----------0H-tP3 `P T P,P m88 80(@PP xO-S-S- `2-pK--X2-p@-M@P T 0S00U 0 `S0100 `P TU T@Ѝp@-P Q tt`H@ PJP @.P -S-ֺ S-ֺ O-4MM0, @ ,~^.>@0@8x^~n.Q ^n~^@^pp@[>Pn~ @@n.@@d>@8d@@tΟPx>~P|.`n@@@@@@wP @(+Mz PF*e0.0w(.P  wP& @9P 4P /P *P D cXP l RP< w8P R Q P  wP /P@@lP\P,X P剃P T Pll0 0`0,P 4p@DW/ @ 0H  t    $     4                                  0 8     X      d $ 8 8 `  H D{( {PB( 0P :z( +My 0 P:8   0  @  0 o, X)0 eTH|@ z$tp wpjp y댉php$$,P\ Qc pWS @,y( XP ( 0P 7<,( 0P& tx( |P( 0P <xP 0 p $M  04Ѝۍpq`@ 0IB'7w0UA0,@@,  xd7 PZ@W@w@@@uPQ )뤕P :@P6~@P P PQ PQ +'x@ Ttx+w P:?P6 X@Q@v P , @ x  wu&PP uuP  uuP  uuP  {uuP  rt{up%pP i\ruX%XP `Diu@%P  W(`u$P  MDD0Po[,:||RP ,Pd |8Pld ,@pd|@P `p00 ?Q  0`+[w,tp帓r帣 DV@@03 V P R P 04@ cP [0,p.7 4    ?@&0 /? 0 / Pc0, #@LP P1.넄p0 / O-xO-|O-!O-Ӂ! O-O-O- O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O-O- S-j S-  ! ! : ? S-I ! f(S-S-T- p~/a D M t~/ T-$T-7 T- Q! T- T- k_ T-T- T-l' T- `((T-,T-0T-4T-8T- @T- $p P+(<8@ 㫹(PN/܅(P( N/х<@8 ㋹P  jP u 0S l%(P@T3 01 A1  A%( (  _dUdPj0`Q-@AP Ix@D T$tdPp?DA( j j X`@ pP:j)0$  uK!uPP:S0:UP$j( XP(10A,qS @D1 -T=IBJ P@   APЀX0 0 A  QtO@ *P : 8s0( %k!%P@ :S0: ` (Ăr1p|&pd`"g "'ue 0 PR,@@X!@R : P\" R!1`p1 AkG   H 0 JT!eP$P!ePx ,(P ᴷލЍ P*p!e Y@LL!@Q5?e,AQ%.v w,BD@b"(r02r 7"cA qdP}| (@0` `Po%3, .A.-.(.O-T- S-DT-O-% - x-8 t-Q? x" `"I V ų ! k x @- M @ @  Ѝ0H-0MP@d ,PC0Ѝ0@-9@5@O-M-JMPP- F`rF?pPQ @CE0 -T=IBJ   Ah@T0@`p .0 A  QD0`pX p $ # 0 F=P9[ڼ#!HP1 e0 PK xP?@K P*8#ePvw @#` pp7cDepV0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0d`Z pX@"fU ZP>JߍЍ.A Y ! P@PPPPn/@Pi/ AKE4 H 0  Q%ᡏ,!p@Pf@ U: d0@vw @ ` pp7cGdpqQ`  W 0Pp Q0pSh f`O-O-.O- - bE.« ų `" x-- (. S-@-ق\@ RHP < 8,P 㮵‚@O-S-S- O-kMPpPN `@xP/ .pӫ.u뀥p4P| ZP  P PQ P p  HP P  @P, - |- - :P p P| J~P  P >~P PٶPJ?P p P(EP¶PJ?P p P.Qs AQ  g@ Q  Q Q q R sP PQ H@p @ U Ph | hrP PP P H @ Zq AQ   @ Q q[ܡ Q ?pK q Q  x1 0Z 0ZS P\ Q7JpP|8 P  P yP  p k?pHc?pkߍXhLdd`T\8O- 8. -,T-S- LU--Hn( - ̦  u <. C  A-PR@`  P,P AQ  j?P @Q:p '"P%a@ AQ  R?\P p"P HQ A?p; F@Ddt08A`p AQ  (?[P \PQ  Q P ,P ?p D`Fdvx@DFX@@P HH8@P|P PP @q@o8.<./ |"YH-`tP0P .s@P p%P 4`pG iPoB@<.p@-MP) QQ  hPʌ! yQpap@l1 R0P0R LP R 8&/ЍpP PP  2 ``m 0` `m ` m ` m ` m P  Ѝp@^HU--S-P -!O-O-|O-S-{ O- -!-- - @-D-f"d--!-h-1"O--K-MpP`r뼐@? T*  ` ?,` B0pdd Q`Ѝ@ᚢJ $ 0DX]-S- f(S-X-~ O-dMPp@`QP PPP `W P 4P V WU P~  0ppW ̳̃ԓP `0S  f b P 0jpPVpP \P qPqP pl l lP p`P: Q @P@$ qA~  P@q7~TQ d@P@q%~P4 $P@q~`@T&QPP!@PvpWEQazP3 PpW:T@ xt1p@P  PU ^q} P y PU Pq}P kdЍ)0l Ps>P|| T- g S-@T-c r f(O-#  ! , 4 > -,T-HU-LU--lZ X]- S-X----~ -A-ā`P,PKV q@f P:.P Btt0BXd @wgP L qgP 888!P V  FP pP 0RP @@kV  @ #}pP  1s0b Br` T-O-Ǧ . S- " ,T--- - -Z -O-,? 0H-@Q @QaPP  fP tUP dPP TKP0 0Hn( -٨ p! @-@P ; x0 t@Rdh0HT P L<Q,.-T-HU--O-O--O-,T-LU-H-P @P 4 0,P CxO-S-S- DT-H-@O}PaP pP Pw8;pPJmSP |pP PW;@qT}P #HU-.O--I H-P (P## H-P`p @KP o@ R* T 0pRpp`FPt` AQ  ; PpT,`T f(q Q _ @-@P <#! @-@<P-O-MMP`QQ P RP :@@P \@ R BP{  nP@@{Q`@T``rp+iP/P +ip+iLpUi!1TpppUp Xo R 818a8p? 0R @dP:TU o P    ] RT 9@@pq@@ЍۍHU-O--..S-! O-O--,T-* L -. . p@-0MPP `,z 0@$P L 0Ѝp@P @ 0ЍpO-T A-M\aPTPAPpP 4jP0 n@P<   R0 00 @ @-@U)  0(6n"P}Pp@U PpPpD @P  @ pЍ T-O--D -S-.Hn( O-,M,rPbP@PB PGq `mP.mPmP` CP a  2x0    ` ,%zmP=D 'P7 % !0  + @4U/  0(m(P}PpU PP川 @P   d < 8L ,Ѝ-O- T--u S-.} L H-0 2P  1!.  H-`Ph@\ 'pP D 'pP, }'p7= W q A-P  ЀQp`9@P lPQp`"QQ l@0L"Q "R  Q S0:  @--O- T-=L-.H-MM P@+g#`vPP I9P /Pl`p %PP o/@oPPЍۍ! O-M@T `PplPPpWPP`=uU@D` 5uVS:TAPp  PA * aV ᤜQ#*glP*` @P  P `V: B Q* X @P   ( 00S 0Ѝt-S-@-M~yP@ ,<P ( QPpPky@ЍS-ht@t-H-P P#Q  P p\Q H QA@P ,P@O-O-O-O- @-M @!   R Q Rd fQgQ mQ kQ Q bQO OЍHn(@n(p@-M@`PPQ *0*pB QQ PP *0p) QQ P *0``p`<LP *0`p,.Ѝp >$T- T- 4 O-pW% Q" S AP\ ` @GT ^ *p\W ^p2P`pW ^U1:O- MCPpA`A%[ [ V* `Pb[.KP :%[ M[c n[ m[^ c[P QDP8c[.[0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^0BQ- 4 BV*.0.[NV|* R07 2R10v*`.a!QPP V  m[.P| R_ `PtꀡlAEVS*% iLPHPb V  RA `PVV8*% RL:2V-*/   R)*<00 QR937 2R1*+0R*00 R*`>Q V  R `Q   ЍHU--k_--- /O-\MMp`@^ 0  ;7 nP HS +7d dP P R PUP ip8  Gp* P @pG <8HP i  -p0  !q(((7 0|wvp0@   ; 'nP  +{dv!@`[Tv$P+8pP! H0 m=iS00@,a@ SBCc / 㲀pvP v#P #X!vAQ"P<`  P*T0˪p ThV} `v`<7 \Ѝۍp_!8T- T-Mb t   |0H-@Pk0H虪p@-`XP@ArP @.@Q P ,//OP/  . .'k p@-M` 0BR`0p0R! P X 0X0P 1 P ܍p& ,㭥p@p d , P DX,<(܍p@$< f( .. ' G-MMTAP4  PP bp)4!Z`p% PPM 健A+a`ypPP Pv V V!$@DH\ Z  0d$$Ѝۍ rR Q hLQ1@. w *(8 8U 00:ዦ  '(pQ! .f(< , u O-$MM̢@# pPd 9 嘒 @  ἤ դ  % \#P` Ǥ#P P "`@%' Bq@8 @#@P `Q< ᡤ# Q#QP-  P'X X  X LOP <` $`@V SP P#  P@P # BP ݁OP  ` P0x @&h< & pZ$Ѝۍd....\... .ps ' \  ..A-MP P ۍ@*@Q:ۍA蘁P ,p H 0 `P0  ۍA9 . . k @- R R0R0C PR R RS@@R `S RH-  ). .K-MpP@a? 0k E! @DPt| Ph`h@pQWYXF0Q s0W pЍK' ' 0H-M , PBqP ލ0Vp@P# , P匣U 刣 v o| < j oPPP8j ʀ ps ' 0H-M@8/LQf( 0P009Ѝ0'(o.@-` 0BR`0p0R P X 0X0XppP P\XP L@ L[P 0@7@f( . 'd.( O-M`P Ţ#ko#D% ӢU P PpP``[/ R  㾢pI `>`psO@P -Pjzh ZPPzZ Z Z PP  Pz Z" P  P P PPK PP p  p OP [QqAP  D<  QPP  Y sP > QP Pp6P` P-nOP s? p0t V0lW8`8 ݡP ЍOa$..v ..\.'d. ..  : ..O-M`@ @1 [P) PB ͡<P ||p  [   & 㱡 PЍd.'. .A-MP  P ۍ@@P:ۍAQt`P P`[0 @PP P e< ,ۍAQ . . 'X ` } ( H-m  } .H-BM` 0BR`0p0R2 P0 X 0X0,PGxx !mmT!@#DD /xTp`P. @PpPPX~POP p P0C  n#mmBߍdݡ*m|m@,'f( ...\.d. ' ..H-BM` 0BR`0p0R2 P0 X 0X0,BPG 垠GmDm`!@#PP 嬠Sp`P. +@Pp-PPX,~POP p P0 e " mmBߍp@ZWll@$,8f( ...\.d. ' ..0H-M}llSp @P PTC}llЍ0 0_tllX/LAcP 6   0_ f(v ' p@-M `GP @P tP_ ҟTT ͟H nP,Ѝp@Ѝp.*"'. . @-PMX @P MP @P 4\Aᮠp >}PЍ .' @-@8弟T (} | . 0H-D|ATP(P6_ rF'd.p@-M< ,PH A !00 Xe GQY c? 0S$ {/x    ?0 0,S/܍p '. j.0H-0MP@cpgP \D0@ ! {!0Ѝ0d.j.p@-0MH`@P\c4g P  b!0Ѝpd.j0H-,P,@ hE 0Had.zt @-@YT^@0H-@PP EPP 00O-$MP]P@ԥp%5p ppGp %~`tQ; pOP0@ Q,* 0@$%$5`% pa@Q4 ԉ   T D ` EPw FP- Pz   Px  3gP PP`P'gPe @"gPe 0g죟`P PPFlP`/]P. `:P} B  `` yb0 0P \p]P*V  [{IT`D~U QiQxA`fP @!00$BFjCj@j=jA0! pA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=| Xx|dPE '`.t.P...`.\. .t~/ !T.!i5 &| * f .`( !d .A U F f("'_ u H- 0@\f( H- 0 \f( O-4MPi`oP7 pppqt`@``P- AP  e4 P[p Q Q R:@P`@TipP@4ЍaX P 4@ +9i0 (.\.,.`.d. t H- (.,.K-M܅@P @GTT@PV TP /Q%- ᫮P,JppUp` PaPQDP4U0 'p  U p UP(J: QP"dPP /P@初P 4td@0$S \TQ DdP RP (P : tP RQ P do#@: P: P: l|Ph: `PH: D٭P(: (ѭP: , ɭP: <P: <幭P: 屭P: 婭Ph: @塭PH: `噭PX: H呭P 4Q,(Q Q  Q Q  Q A )pA !pA p @@T ,ZP |@Ѝ<0 4u u u pk0.,.F ] 'd " "O!P.DS!.. `.t.T.b \...G"':r" i!a!V !ّ!(`.p.'.'.E!.s .r".! . .!. p K G-MP@^ VUgcPED0P>,_$$ @ @ ß 凛兛僛!gl#0SMpQ PRU(C 博PJ ㆚p<^P dbhr`嬒 1vP 0@ Q :p  ᢹ 0@EQQ@U+  Y P : , =@a,TP  @RXX!0@` DQffffp P X/R P  i@P PPP P@P  | ` h \ 8.<.@.D. & P.L.`(Hn(T.T.l E d U F f(r X.'5\.'y 2  H.`.d. h...... } . 0H-f@(( P of( 7 H- P  .tA-,aPATP qP >@IbP! ``AbpP ;bPP 5bP 0bP  ᰀFPZXPpTT 00#000`V'.5.iK>t!!f( 8' .p@-0M`@P] 0P  R l/ R R   ,B  c/r Ph0Ѝpd.`.' _.O-MQGP ?lallp@w l Z  &0p/oS"0 0Q Q Q P  P ;v oRQp\P R R P  L P 'H.d. h Hn(P㙑PKqG P 0 h8, 0`mP)PtV "PD % " P `P p piP P> 0 !P   - GH  &|   .. .(`(.gz& v.8!` c f( [ d r  ) < 5 G .H- uzf(Z"@-0(, @q] dzf(Z" 0H-MpP    P 0=@P ip P @TP@dP p DЍ00 0. > MH-M  QЍH Ѝ/.K-MAP`Pm 0@ V  @p  P p H   0LL@p 00P:`T 0 RJT`f0d `@Vp@p:H0  }.&X@\ `0H 0P<.pp@0@X (Ѝ.  f(;! MH-M  oQЍH Ѝ/.O-dM$@pӨP hͨP P(0[8`4f (p p,@PLH,/o[ "QP X ( D$(h(P]P pA,@,X* Z  H t , P  D l XXY (Q'H(, = |(QQ.H,(q(QH,(g(H (,  P (H,( @ P u (H ,( C( ($H , P _(H,( @ +  P (H ,R    C (H  ,R ( P 2(H,( @ '( 80^P  (k_p48P@ Y 9( 0 Q(X,  Y ^( 0 Qm(H,P ZeP   8p ` _  P^a  X(Eh84YZ lf c Z:(&hͬˬPdЍTCtptthhx.`'\4L' j z   1 R t .W <  MH-M  #H-rpq#@W P` ግp P pWPZO-lM $ЦͦYPL0p88PY  CHH0 @ <0 0@ POmP @PpD ,㄁,0`P@p(@P $ (P#P@<4P ,(IppP' ( _4p@ pp(0rP:|P@p,  XPlЍ0h @rP*@<  p@$ Up P PT@`<0mP pP @ @(`$$4$,t@&x @p&Ds& w t v0P$   p,P @P @Z (P" !  u G-@cS $$PYUP`Pl?G#1R# k:Q[.0kUP0`vX$$ R$P N`DTp P-P+PPQPr p IU`FP N@DT`P P QP7"x$tBPP`w$$PPLp$HB$P<4P (1V@11@DTP S7)P)V)P|P P\P3U%gectAPhhTP1PhU`DAdfPe $0q  (P @P f1P6P0PuTT SESN $. . .(.LS.F v" ,.vv 0. 4. hS.`., R.&(k_pS.S.H.8.S.pY.z V @-pʈ@@x@t%,P nRTPDP <5R%#If[L.P.h.T.(@-@K P @5H-PH- T  Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SK-0M│ P Y! t POp!\ŸQP >KPP'P8PM KPM P\X i!00_ P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " t0tp`P  ,Bx`P (@婊  0Ѝl.p.a..x.u/...@-M4 P @"P \n@PDP"P KnP0 0@PT x"P 5n@|!@Pl@hj"P 'nPP @8P,PЍht@ ϯ!. $( Co. @-@P @nP @C#.@-M A @R@  @ (Q  |p"ЍXP<(P. 0H-@POP0 Q 00H C#.G-M$!!o" ! & F P00 BPPT%%봕먅%%HuEPt%t5xU|exutEtTT  HP P<4,%,E,P%P{$u$P  m$4tPp pR P P\dV Rl0$ Pd \ CTPP@$4 6, R PP@ 'P P#̣P  PD 3cs  0@00||#|3 pS dh#h30P0L#L3<4#4PP PP PUP`Q  `JBD `!H "" |"P `R PQPR L ` A$B `G r " P!PzP@tP Q@@PЍ ((!.#.C" f"#. #. #.4"#.!#. #.r $.$.$.$.$.$. $.$.FpPX Q?\ЍC  .0$.0H-N4P$P.PAP P PP |P x s P H@P0P NPU0H0H[H.pS.S..4$.8$.#.|$.h.S.$$.S.,$.\S.$.$.G|$.B$.@-@PPP|P pp ,dPLT #HP(8 $.pS.H.S..0$.S.($.S.8$.P/(.$.x$. .$./H- @HH$.,P/ Q /TS.p$..P|MPS. .D$.<$.@- P p@T ``` P @9000 P @S.|$.$.$.#.@$.<$.@-|@ p X @ (|S!$.T$.l$.d$.\$.0H-P P!`@ l \ LP < P;@0(X$.`$.h$.T.P$.$.H-MPP+ pP' +P@p%`3E-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 T  ( ( ( ( ( ( , (  /QPB@ Q* H ( ( ( 0 ( ( ( 8 ( @ /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 @MPJQ00 `/(0H- P:P @+PP+P00H00H|@-M@P MP!  +P PPJpP JX Q8U[QJ(~ЍЍ@wS!F P [ J @-@@@   p P@($.< 0  !1``@o/( P L((. t$.H-@M@P `PU PPPP$.O-MZ댣 ZZsZXPT hch@P uP+P G-Q   uQ+P  GP TH :P KHbPP .P bP wP pP cP P@ Z Z,PP"ŸBp`Pp`aq0!001qQPp0P  A1 PP1 PЍd@PD 3ZP8@P (@P@P ,P'P "PP yP 0p`P 0p` V C &.&.(&.4&.* R &.&.%.%.   % Y S d _ Hn($. $.( $. Q p/$.$.0H-p@PP\PPHP 8PP(PPP0%.&. (dS.( p/$.H-p0S :Q   h \  S@D4S@#   0$.$.%. ESC$.@-MP&@PP tTQ @0$44    0 Ѝ$.$.%. $.ESCH-! RQ 00 R0 ! P!R 0 !Ƃ 0? ! @ R 0 !ɂ 0?!  )q 0 !̂ 0?!  0 ! 0?!  ! 0000 ! 0000 ! 0000 00?$. R R R R P/p@-P@P `PpP PU:` q U Q P@ RP@- \ *0 B @R/o"@SJ0H-P@@P:   $ X ,?% ? ? ? 0 ?? ?0 P? ???P0H-@P`P QSpW`QU4 U1U uP Uu```$.0H-p@PP\PPHP 8PP ( PPP0%.%. (dS.(H-^Q R RA 10S* Q1S@-,@QP&.(4 1S10S/ R/2#H-@P/ `P+ PQ pDP pQ`tQ pDP  pQU <@EV@P@4(8(r O-MWP D T: DP.P bP cP$T*@z GЍ$. 0H-LL444 40<@PPPPPP0(P..L..H..@&.@..D..(( (0/(D..T..P..O-M@;PP- 帠帰p  `@pT*BP P PPPЍ$.D..T..p@-ML@@:PP ` iPPЍp@&.K-M@P@=pQ0 P`  d 0Q B QQ P `HQrBQQPЍ@..D...G-MⰀpQڠ@堐 ` P 0 E=PA@P  AP( ЍT..D..@..@&.H..p@-M`P@D:   @0 ЍpO-Mℑ|A pW=P `p 0P G pPWa 0QqAQPI̐@8` p ARp@PЍP` ~0 I B ZY@&.@..T..D..H... 0P/\..X..K-P3 `P p PU @BP@ʘȘ PpUp W BP ps ppS.0H-8@P(P0 PP0(X..@&.O- MPP xP Qx(x8PQdXoP\ ` @`P p$`P`AxPqP VG0o"0PP@Pb    X ! p! d d  8   ! ! 4wPO[M P P  ЍPU pwʬ&pAp@嘆 [@@Ts ` PvVp@P0FP e[ ^eP ڗ8Ep  Q  p PY  P PY PXeU `E`HuPP Ir A)  @ QpP ``ᏗpPd:X ЍO&T[Z@U8T(4dP P Q P PD P?CP1 PZ 4/*|tT dCTP 4S$0cP P PPP P |PP PR  P P P X} P P2,,"0G0bP@PW P* P T @P@@P PP@` V:`XaQE [,qH q \[ [ @P` RQQ 7PXPi PPP P\PS iI$.P..h..`..L..X..(l..t..p..@..@&.((....x..p_! !(H.. p@-`P@,7 ,Q:Epd P:00@T0Q: Fp@&.@..(O-$M$q p0@ P1 0@` ` @SP @b@*PpW 00@C @RP p0@ P  0 ` @RpP  p.P  ;@$Ѝ@&.  Q/P..h..@&.P /X..  0( O-MM@PzP(8Po pDxPjJ  Pf`ᢕV^  0PV p z PO #PI PpQ Q Q   ] P  W P  Q P mP "PX Z P@⨠℀ ⤠|   4/ ٕPs 4/Ѝۍ$. ( ( Q  FR/2G-MPcQaPP2 fPX 5  5 Q PQQ<Z  @ LP? @ T@ wPJ  PvJP ZPdP% dpPp Q@`@ Pxx p  0 T 22  :v ᾔЍ$.L.((* z + p@-Px @(P U p@lP>`P <>P p@T\`P p k_i!p@-P@Q `P Pz`V V U  p@Up\P XD 8Y4P ,$ p@Mp (( zF H-M@pRGP 5`pP`P T`P`ЍP 0 !P `P`@&.p@-M`Q.  P@0 PAPP <P @ PQʬ<PЍp@..D...G-Mࠟp BQ` @PQ [ 0` CVQ @PIP Q , @@ЍH..T...@&.@..p@-xPx@`V ?F RH 8 @o/o"pp@..@&.(\..@-PP D@@88 @ @&.H..@..(\..H-P ;H@..p@-MP-4@PP ` @PPPЍpA-@  `pP t P  PpW<r  pP AA  " + 8 H-` R V`:zLpT" PHao@DTB d...H-P`P p@p咒TPP P P7P @WN@T @g@....@-@9  ..@-@.( @ R  ..@-P @P@-u@ ..O-LM/_e00OoP}P KP PPQw>t/A8P P vPo P P dP~뜿PPF: CA`xHP :V P 2:K:':8nP@neT PeePapP6P=mP /PPP  P> W W=WOP ,KP P P.W 0G P:$ ,MeP. ԌmdPN RPp 7P iPP bP P \ QP `P miYiP iVPIcQ B C 4C P= d= = hC = = C C D D > pD D E E $F @F hC F F C $B : G TG G G G H ,H @< @< 8> HH B |H H H I I pI I ? hC hC J 0J TJ J J @? TK dK K K hC hC K $B hC hC pL L hC : B hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC hC 5 P[oY`py艟j#P; W W PE #@Q+:IPP\PX p pPS `@<9P  `BP @P(34IP0 WMGQ  ,= D@ : : : B 4< : B t? : : : T@ ? : : : (@ plihP PP P6P aGP30@P6P 6`/E!W @W *WPmh'7Q  b  ,& wn P `Ćg\ T, |rˡE Pm%H P P P Q.``. Q`+P`%`m z堅EaE{5P 0T EH 50 @QV @*WVW !WQU0EP(. g/(@#0881@Q* @p P   P 7Q /! Q aOwȏoeQ OP PP P_W-W +WQ3D1P FP$  a@P3$ 5P  $Q .{Q @2 `QRfP$$@"pTNP {uUel Pe Pe Pe  Pe  Pe ?Y+1FIo?Epˡ>J7apm P>;7 $ P ! &>~>&7pˡs>7<Q& P"T p84l PX>s7 P v 7I>d6 p .X.......pS. lpp0>K6D....a.P...? 9P@ Pe $ Pe  Pe  Pe  Pe >6* ...\/.pe=6:{k ˟ 0` 0`<;..et=A6=),pˡ=26QM PEHpˡw=66..p=6$$ ( P 7 P44 P@@ pˡ Pe$ D!p0?=Z5lP] P ' P   rˡ@-=+51g plg p rˡc<5 p|P 4<5qac$.Ie`pPk ^Pj  Y(U'! pˡiHP IS.( pˡ{HP= `<N5/DPexG0 ! #ep x -rh><45 p ! $( "$V .>0=xPe= \Pe7 @Pe1  Pe-  Pe) (p..I<d4 (..@<[4t +..0#@1e`l.u/%<@4P 0C  T.b/<-4 Npu (h6؂ (S  pˡk Pe 32P zP h"p| pB;4tN pˡP Pe `"p P ^..:eA,5P` P 6`jw;K48P&3(``/P4!`0V(0F`˱0/P p0p  5eT>e;.(T(bX...a... .pS........p....  ..(2.`/..S.$.] ('!B 5 *  S.  k_ 0.s  ....0T.dS.....&(K S.S.S.tS.G-p8;13`W@̠̐̀@q WP`RU  i PU 8W2e Qe2.a.$.K-`Pq@  A  P.@  <`堐V VJ  .  P  |<`@,4T KK.... H-@PPPw7P 0s  xPQ`@`PP`p p` H$(pS.H.8.`/.\S.$.p@-/ ` k@P@U@ p@`PV P U U@44p@I....^"k_... '!\/.0H-":=2OPY @"P.P=#PV $PZ %PPI:%0Hf4 P8 P P< P9!P QP  \P0\\PT@+Q Q LQP Q2 0/P% 7P. EPP (70H~$P PP$ 00H 0  0 0HxptP 0.0X!0HV@^0HB..$... .. ...........A-M   7  ?  I  D  ? :  5  0`@xP1  0"@TP P0P <Ѝ....  ! p_!\/.Q/$.0H-P@U }60O-$M@`S   )P `nH@@P @ pT W QlAQ >P : 0AS R 2@P ^P  P *Pp Q:Y@ P P [p /@P  JI Z P Y:HUq P@TA$Ѝ$.H-, $ H........O-MP9 `pJP,@ PP PW)PPP@P PPW@ppP@ W:PЍ @-~2FP @@lll 0OP \\\ 0H<PP 0CP ,<< 0@;((2 Ta D U _ e t 0H-Q P@ ߅P $  00 0HZ2.. 0H-Q P@ ȅP $  00 0HC2.. A-@`PQ ?PT pP 5/@ԇ*PQp$PQ  pP4  pᰇW A K-MP@QAhP=J` pp4@bP.  0.p"  hh$ 'WPMP+P PQ P@P M@ch@Ѝ[GP`@VEPVnPVdPUppPuP cP ePPU*6vP#PU*PU* @xP@$.....p@-``P@PC C  0C 04 Up...... ..K-PG @`pAQ"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi ..@-M@d P PQ( QЍ....Po//p@-R @P `AP pp@0 H-M 0Ѝ蜧 G-Mp|`PhPЍT`P D@`PQ hp p>iPU:P PVUTe`ЍG[ @R d 3  BP`d`3`dV P V)dppU PAEPQ`p.....p@-`Pe@V p#U `U aU`B@PC@HC@PB@( @Q!@#%" .`/.S.p@-M`6e@P-JP;P)-P%;P"&PV@U AU hB@PC@PC@PB@ mQ 0Q@#!ЍpS..`/.O-MPPp/w YXpP YP ! 0@@ wBPP Ѝ`wp 0G?@ BPp/w P ?wp@ UBP O-M@`$&pP&PUP)GPWP* P Z P@T: <P PP @Ѝ((0H-@Q P% R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@ P PE00H 0@-MP3 p Q, @T T pQ#  :, /孄PPH  Tp <, .Ѝ,T.h %" @-0P(@P P @,T. .P H-5 H .O-M★P@P P  Z `z P 4U Z z @U Z @{ P  P``pPPJ)P @~.  0p@Z` @ L D  PN G 6 8. 0 p PPQ;t 3 0. r, `@ P $ZZ P P T :@T( PU ` PQ@-P CfP0,P (@ @P D0:,P / 4, -P -P @D },P v@Ѝ-P |-`P  HP``P Tk-pPp`4c-P ^-P Y-P "P -:pppkdpڈpPJ P*P X@- YP gd*  .. > k_ S.V (/. 8.T.(T.@T.a." (..0/.8/..2.(T.@- @P   .0H-MPP" n/p   P @ @ $$   Ѝ0 .8/.0/.P/ H-@P`Q p ᣂ ែT,Hp@-M@BcOPP JcP@k-P``UAU DU+ OUaU dU$ oU W-P ctP 0) qci(p@,Ѝp. (S  O-M∱@PP j @`@U  #P-*P@P U'*  pW " P*p@P W *@PV ` @V P ЍOz@@P  Ѝ .p@-`P  P@_P U  EP T  =P p@NpH-tP  H+H .H-8-'P (+3\H)(/. .k_  .  . .A-h@P`T%+pUP W PE` a.0H-@P P PyP0H0@-,@P |@@g@f .H-p )H)O-MP P7  R  P \P P:P A` @!Zp P `@V J2/ PP PЍ "A-@!QPP( P0PQ@Pt4p`P`!pPP PW tP@P( J(H- P JO-MPP!pWD ! P`P@W WV `P`p`\`@3!  pRP@PWU P [:I!@/ P0 ᄾ(@`@V 唐唰Pp @W pP pp P :@U`PV Ѝ J(@/.( K-M@P& `P" P p p}P XP 0! 0X @DapVa @ Ѝ&"!@-@N @A G-00P@`p#Q%QWWP P #Q %QP  `Q `p`@#Q%QTTP P #Q %QP ᩍ `Q @. .p@-`PPq PWX 0@ᲽP`)PP|zp$. G-MP ЍP RP `P|qPp3  0 `PPPHQ# `@P!0C[1QP`V p@ `V l`V PDP ~$. Jk_ ! @/. ((* A fG-MP@P>  0@ &p6 `,`P/ĐĠ@P `P DP  @`P 7P  p=PPP `V:@U@ލ$.S.H-M`@P ЍHTP Pn`k`PpLD 0!ᨼ~~ 8@x~ЍX !(G-@dd3P EHP & `Y Y~5Pp@Pppw W 0H-@@O(PP ,I(P D(oR0k_ > p@-M@P  P ۍpO-M`,pP PscPw @PT|PPE-PD (PI De  %R R   0%S sS4P-+@ `` 0p}!`}pV3 U @ T@ ^P`p(p4@߻P pػp[ :P <@@Np}Ѝ$.S. k_I > A-MP8P Ѝ`P @ %R R   0%S sSPЍA'P/p,`)p 0`Ph>}<}@7}T ЍAm$.x H-M _p   @o Ѝ0H-MP@P _p&PP%  P! *Pt _PJ  PP$<p$PЍ0S.((@-M@_PJx| 0#ЍpC-M@P `\_P h  #D Ѐ # "q p RЍp .0/.8/./(@-@|Pp/Q@0H-$4 @0!P 00 00S 0Hs0HP/.PS.p@-l@P pp `t(@P!$ %$oB@$.@-@P ](P@3Q/~X/.O-MЁpWP@P`'P`iD$@TtP WSXPN@PH0PC,@P`T(P`%&) p 8  p W  08P`l :$@ b$@P`$@TfЍ T.T...2.#.@-@ ,Q' @ T.O- M08p4P@P U P ڐQJQ@P P`p TP 22D 88`1Q`!0 `0 o,P` P`Z9BP @P &% '|'f6]'&%A(P 'k'P R"4P1PP #@XSWpW`P ,P` ! %P"' ! 9(P(P$ P`('ZP< % &P P O#P@X @'P`P @P 'P ЍOHX Z 5{4 ЍOX/..S.   0F(*ЍQ O 0H-M@P>4P  0Q  JЍ02.O-,MDDHp`wP - 0W R V,WPSP {z@$# T T  P P p ip PPP P(` KP` $ `P`Bp P X r P0PP X XY `Z(I[ @TE(P@@PUPQP X X +&XZ`Z`A刱P P P P P  P P PZ('y P@$p `  &P$P@尰$p `P9 7  ,ЍDP B 0 PS<P=Q P P=QP=Q P P B  d V Q`U`u`Q/ Q2 Q$Q:ڱL U u Q) Q, QQ* C^P4tД`$`jt娔1tQ`Q LQ{8QwVt` Q Q q"Q#Q P Q\Q Q Q Q PT PP[ =dP pP+P/PTpsp0Q Pqe/QTPP P=P PR/r蒟PU P PP=PTKB/P P P TP Q Pq,/QpdQ Pq/QdP P P /`P U U U rQq唑kEPU U UP pyP pP<QdP U UPU" p.p̐P \Q Pq.QP.\P| p. Y$$Ѝۍ h/. (0(p/.t/.l/.&(k_f( #env  ] l  A-MM@Phhh `0$ Q ` 0(Ѝۍh/.p/. l/.H-Pp^P$ \P30 aR>0BPz*0s01 00C `@0TP:Q s P0 P0r0 SQ 0P0" SQpp0kB P0`男 T T h T T T p T x Q- `0TS8bCPE d ( 0 8 @ H P X NbR eRPR000thlCSDS LS RS *1S BS $US! XS   C^P$0#   h         ,0 -(P``x/.( > =R"h z("0H-L@iPD@aP KpP d\ @@-P>-LP@:- @$T40 1.3 1. 1./. 2.2.$2.H2.P3//P2.p@-  | 0 0  0 R @ `P``@@ @@P@ pppp0@@P@ @@@@@@,h,dP, @$TPp1. 2.2.2.|2.`2.P2.X2.\2.d2.h2.l2.p2.t2.x2.2.2.$2.H2.K-M p`PP/ PA5 g P 0s  W  R !Q |q!P|0p a@0|@(p |P 0pa@|@0(p|PP7    @ 0AQ 0p|`QQ@`|@0(pP 0<|pPPa@p|@P(0P|0!|0 ((0|ЍS.T.S.((2.1.S.S.X2.000 00 SR/S.S.S.S.p@-\P` VH@!R', `V`| `p1. 2.X2.H-pP0O Hm`XPPVv@)@PFyPAeaP@@ P P 4@P' P Pxx |pt0 @@ @@ ,P *@P@@$.1. $.$.$.$.H-f@@0/88 0 $.$.$.$. 0 /1.X2.2.2. 0 /2.2.X2.1.Q/H-PH/1.0H-@P P4P @P@01.1.p@-@P` KP*P p@-@Q T3 Q \T,QJ  R  R DoQQ P T  EP 1.Q/H- JH/{nA-$b@PP  Td p  P\p TPAP   P C P<taP, TqP! Q@QH!@ Q(("P8 A_ A4  P @  0*0 S P P P L P$x2.8T.dS.p2.2.2.2.$.2.O-MXLfLF pRP P -P' P$   PP= P^ @Pd @P[Pw(*PW|PK TQPF 0 0S S CQ= e Pd b @P"vmT@w@)d=*)Q@tTttQd8*@PqDP w?P P4#@3#Q pp P  QPA)"m@@ PQ_W  P_p_W PpP_PP W$P& QP! 2 |q`0RFNQL Bp1Q0BR @EXPW]i _p CpW p!0 2lPQ> PoSk 5ܑPp P^@ )`  0PPAJt!A@Dp\aP@  PPEU6@4 _pPPPwyP  0ЍOPP  =P   0C@P@pp@ЍPE2.h2.S.1.l2.$.4T.dS.(/.X2.(!0T.2.2.d2. 2.2.H2.$2.VUUU2.A-\PPL`@p/2 0PpW@2.2.@-(@Pp2.2.G-`B`PH8PY( VP(BRr R! } @R a   @R |`aQdqQ88!   A Q 0 0S  v  QPP YPQ PX  S   KxX@ PPPp2.2.x2.2.S..d2.X2.`2.\2.1.S.2.T.#.#.S./.0H-Pm P lP@ p@TDP08P@ p @T0S.1.F 2. A-`xpp@ PP ʟP`88 0QT$0 pp1./.X2.`2.\2.@-< 0RA ^01 0 R1. (/1.H- R  R P @ P X |0S1(00 P  B! ~ t2.1.S. /d2.t2.G- p`r) P%\p" `p堠@P@UP@PF@t T}`pYXPo`Ppa./.1.G-餐pPNh@Jh`TV V tjPT ojH " ! bj`jPPP/.1.O-M Pp` >PQP8@P@ P" ذ`v+ UpP 0@Q: QBQ* PBPE`s` P`pZYЍ`p/.1.a.G-M`VQ &p@  lPP  㵿  @P@@@ i 0C`F@ VR:BA ЍH-P@`pP 0DpP @8@ pP+P`2.1./.G-鄀`l R@ 0!  Lp`P| 0R`UP 0!  V..X2.p@-@PPJ`U  PP  P dwPp(P, '/ 2S/Q/2S Pl"R PH"R P$"R P/T.(H-PC(A-M@P`p P P p P@"PPЍp@-L 0 S < <0<@ P` F P pS.X2.d2..O-MPD@` p U  0 #0SPQ0P) | R6 @ @``Q@D P p PCpW@T "P@0 p$ # * p) T @U r@ P  P@ 0@aP V  -`q`豟Qp # "qP @ @T$ @xx!0QTH1`q 008pX@ @T`Q0U q$ Q%PR 0ppp0pqq0 R A Q x@` @PЍl2.T.2.2.2.|2.H2.VUUU$2.1.2.d2.P2. 2.X2.`2.\2.S.0H-MP P@QP@p2 0QЍ0S.H-l cR:TH0P Dc 0>:0   2.K.K.K.K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 0K.K.K.O-MP|P@%$UDrP 4r `R`P|`p !Ѐop!p1VU0R`0^0.PXЀРXdap  0 D(!@ [X  0+U ZP  & P&ЀРp U `  0B*! X* U   00  ЍS.K.K.L.a.4p/(P    L.S.`/. @-X@PJdP 0  0PL.K. O-MPPpp@Q ` 0pRp!# " p.P4 pS"p# pKp R0UPpFPЀpU 1`  0p + ! XU ЀpXx`  0"p + ! X  0B ЍK.a.O-M@P`Dpot[J Q@`p!&o T@P` p| P`& p'0pЍ.K-@P뀀倐`PpP 0 0@p`g 2.a.0 R/$ P  R/T. T.O- M`-P`]  Uٿ =FpFo!pFHP% PP! P uP @  @q  08 eȺ@TP@.P ^P@PPPP [P @PoP cPIP @pt@TPD@ HP 00P c@0L.R. . .Q 0H-MPP @ 4p D0P0P&0 c ꈾЍ0 .L.H-Ma@QdA@QLN@<'P #P j  ЍL.^ H-P  q  HPL.@-M  r @@@0 k΄0P6 ;cЍL. .L.p@-3P5 P@jTp `f fP& cfP P`c`<P`@P Pp p@kpL. .S.0H-@P 0 R < PA0 .) 0H-l0d 4 0 S@0%@$0 :p05Qa#3Q'L. .H-(0N A R qL.G-\P@rJP z` Pbb@D6tL.O-$MP&   ạ@唐唀` P r 0I pWp  P  0 p嚡 ` V$ЍS.zL.k_B p@-MPmPH PP``P= @ P Q `@ P-JPUP UP R Q @ ` QJ 0 S  0 S  B0`S`# b `ηЍp.0H-M@Q Ѝ0HW P P PᶷcPJp ڄ 9 Ѝ0pd᯷LP@P a\@a3Ѝ0H莿$.u (.  00.@- MP P P=.P(1  R& "0s" @ uP DP0@0S |  @t Q \<8 Ѝ 00(, 3 S. [" H-M< R J0 ==90 Ѝ(.S.@- MP P P=.P(1 3 R& "0s" @ TP DP0@0S |  @t Q \<8^ Ѝ 00(, S. Uq Y H-M< R J0 ==90Ѝ(.S.@-MP @/P  @* Ѝ @-MP @P  @ Ѝ p@-P Pvp|P pp@ ံ)@P p@Pp ` p@ $. S.R.0H-MP P PDpV\P@PTP z`@{Ѝ0Hq`  Ѝ0&(& &(@-PH@P 0,$ @LS..R.!0H-M@P P P,PlP=P MP hPP|  mP wP sP@ XP@@P0@P(P@`ӵЍ0`S.|Y. &(&(&(P/S.P/@Q*P/@-@| plPxPPLHD@<8@g5 &( ; R { K  @-MP` cRA0BSA@ 0 x 0  *mRnR sR uR+dR kR%       1BPhd R, PЍ@ @p,@  Ѝ T. ' O-MP!@pP`T* P@W@ T*`0@ P ? : 0Ao?B `W@` XP`T* P@WT ,PVV 0 `@Ѝ/.((K-MM@P P P9ߍۍKȐ@ 0 S `Pp,W:ఀ!~pWP < < ~0 @ ߍۍ("/. "(A H-MP P P*P  R Q ЍHxx l0 0  00 D< (( 0 Ѝu ((Q 0H-MP P P(0@ PPݿ@|tP lX0R>  <P S$P Ѝ0S.k_  S.@Q*P/4. P/P QS.@-P@PpS.@-MP ,@P  eЍS. @-MP ,@P  QЍS. H-P0P(PBpHNT. .H-MP P P D^R Q  Ѝ ( 0H-0MP, P P+@P,P0,, AQ  @0ěd@X, *Q @0Ѝ0,,P T.T.` P #X  6 @-MP Pb P0QSSEC ^: L L L L L L dSeC ^/ L L L L L L C ^& L L L L L L  #RS WS ^S   S -S rS wS S SD 1 CR C 07 E  F   K    N    R    W   0 >0@@ 0RQ-,0Ѝ T. m <<< 0 PQR0/T.S. T.$ 0AP/ T..S.@-鱿@ |R. O-MP H@P Q Q 2/P d@@P EQ D4 4 4 D4 4 4 4 4 4 X4 4 4 , , , , , , , , , , zP@ T  pPaGQ3Q Q =QU QQ D |aEP3P@U @PA8 L t   o  PP[P~   Q Qp U nUzPPnP Q @0 PO  @R 2/T [QS?@+پ4 { 0P. @+PP [|-Q @ @@SXD+Q@ @ +QR !\ 6Ѝ @PD< P @S. S.LS.R.R. . H-M0S8< 0*ЍH蝙 *㖙Ѝ S. H-M`P@6p-W0A Q:UT h pU-W` U T  @Ѝ " A-M`P) @p PQ$ pP \Q`P \$Q T `P `Q,  [``ЍS. A-MP @pP`@W @ h ЍA9W  Yhh -QQW W!  @PNXW4 W/ W>oQ4W) W W. Q QV$WV W W  &QAP,  o  P PV R X2/@PX U@Q *p|P X ,Ѝ X S.X < s `/.- P/So/Q  /p_!H-oP P/S.H-M  cЍS. S. H-MPp`կ 0B PW# &`0a@ S``3S0D0@B` T:V S     b RWV  `&Ѝ"  RQ/lS.LS.@-h8P\TQ @P T 2/$@P> LS.$(@ 0S/ S  C Q $0/$(O-M`Q0S@ ` pW) OP@AAQ:-P X T T BDo᠂P p  p$PZ  RQ   Q P   Ѝ$(H-P FPi!|&(/O-M4\`@pPP`pP/  pp@P Q@  Q P 0: ?PJ |QpQ Q? C  :PP 0!U QZu P #P UQ      9\P P 8ЍDT.HT.a.a.`U.S.2.|&(HU. ($T.$.@T.H-jHT.H-M >wH-M@Z`PN`K`0 0pP劖Ѝ 0H-@N`PPP 4x0IU.y!O-M(,P 0`p5@ !W 0!u(  &&*9#Wu(":#%"0p  0j`VPP3UЍK-P@p`%"Wd$!y (0$5# 4!0 W0 0dp W2O-M@p 0P` = @$ U!'  % 0$7#z4#j& D@0[pTpp3WЍH-MDQA#| "B -=)/ 8ЍMbH-M |pP `@P&VI `@PЍa.`/.dU.0H-@XQ 冲@P@P: $ @0lY.&(hU.hY.@-4 4@P ( s8P&(hU.&(`/.@-@@&(Q/OlY.@-P @PG-M h!O`P 0 Gp  E y-PeЍ!G-M h!O`P 0 Gp  E y-PdЍ!K-Mh@Y p`piB PPGpEy-PdЍ!O-$M¿P`p@0@ Ya@QW@A@Q7@2YJY 0@  0@G@P PPT$ЍO-M¿P`p0@ Ya@QW@A@Q7@2YJY @?@ @o @@? PPPXЍO-MŸ@`Pp@0@ Xa@QW@A@Q7@2XJX 0@ @9 p 0 @pPPPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `ypP%rP `ipP 0P `[P p@pЍ@-M@ P @@PЍH- @Q 0% pH2H-P@mP' PDְ며 `n@|P PdPdp@`댰Q<HR HpY.S.$. .$.`/.H-M0 0Ѝ! H-@P`pᗰj 㼰1P PPPP @PP @PvlY.0H-M@P P 8,00( (0 0Ѝ0 (!!! 0H-@P߯P !^@֯P 8P0՟ ~QT㊪0.`/.K-M@jPPPV p㧪 0PppV"㛪`o"Q ]pP TX TP T`WpU TЍS..a.!@-@P mTo/O-|Mⰰ夀堐P@ ;/Q00PP 0  0`hoP  #` 0V pB `CR JS0@  S pwp`pppp@@P0S 2<`0U,0 [Q0 02@Q0R0s0Z0PU p[W 2@WRp0pqQ 0S @PE T:000    @0+t`` '`# (; 1q0WQ|ЍS./T"p p p@@0@@/.tY.N-DD p0SC P Q 堎tY..K-pDD0 Q 1PC010CSPʁ蠋tY..H- P  .tY.O-MpP1PQ Р +0* 0 P Р@+0`* ` BSH@@P@ *+@Ѝ.xY.tY.A- R*AQA 1 0# "  l0`0AP 0$ p%0 @1a^ @ p%` $ @P@.tY.0H-\ @0\0H0^00N @@\@ 0^0tY..0H-HQ 0 @0P0s0: Q00tY.. @- R <0A01$ P r :0Q tY. P@PP@/.@-|嗨xx@x 0tS፨`ቨTᅨH Hဨ< <{0]1#LS.|Y.1#1#2#0#&(0#&(L1#&(O-M`P V p9P:P ?P \P@P  `%P6 .P P  @T `OTgaDQ} 60686X4D6556666X4L6`66x666566666Q O@T k`bDQ 5666,7476T766h7x766766\57666(8BDQ, \56@8886666686669s !0  0BT DTLTLPH a! @p:TT? P80qPT5)2 K P .P#\ P Po!  'p PmPP`H P $#0 #P RRwP0 X@@%Q P  ^_w PIp)P@!%pWo P0ja  c"2Pu@ Qp@PjP/ v꺯 Z  r' P6 p !!1P 0  ?FtWꚯ 0 R : p P1 eP ᅯ 0 R : p0  /  pPQPG#  | 0v= Q Ѝa.Y. .p_!j !,. T..2.T.S.k_0H-@b AR0P;PQ0P iRjR tR mR BR bR0S. 0>S:S Q\S 0SS/.SQ?S/&(p@-@@@P@`@oPBa p`S.LS.|Y.&(T.&(H-@T@pP<` Q P  ]a.Y.p@-@`0P C/o"sT J@`@T @O !0  /o"Rpp@螮./a.H-@P dPT`VxP lpP@" r &n@@T렪@`X/.a.L$..O- M@q B ((!P8 P P'@P`p ! &@  [  0!   R᭪ժ@Ts Ѝ ЍO ЍOD((L$.X/..@-@PLT !P 0o@a@a.a.a.!@-@P O@a.p@-P@U `O}OPV,,     pa.a.a.p@-@`ҰP , 0 P PVPpa.H- P BR Q9 bR4Q& ^ R N Q P@pR @pR Q Q PPPP P0H-P@u < 0P !T @0a.0H-P@]P 0P  0T00 @R P@P0a.K-$P Y@pP0`#( P%`$ % `U0"0^Q  %0$  ! R (QYD 00 R 0 PR((S.a. [ ` ,@ J<048pA 0( Z p V*W(P*PPP%  /", @AP< `@p X` Vpp`,JJP @< r..S.T. T.a.S.T.a.0T.dS.8T.S.a.a.a.a.a. 0 7 0|E W ) @(pWQ p< 000  00B P4PЍa.O-Mp 0 \@@T5 P @\ @Р @\ @ (@`VZ 0&@T @Z@(@T  @TР(p@ `\ `T9 " p.*0~ ЍT@p% `$p Q p` "p. 0bp Pp p Q p` '0&@Kp P   pp}} P `X00SP  p XWX W @ @;p@XDp ЍW O$O4p@-P@U Q``㽝P0㹝 RP`P p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLpH_p ppp@ ppLP^    QY ?L Z   Y I$Ѝa.H-0J,$ Q  H_a.DT.H-P 6 P.l+(XH$!H`$.a_PaH-@< 4P H`a.DT.H-0,$ Q  Haa.DT.㬜A-@T<  P뤡)H((@P xxpP`uQP P00PAja.a`/...X.S.0H-TP@T   FFF 00000&(a.a.a.0H-P@P" P P tP dP 'P J'@@@@@0&(+!1!8!>!k_O-MM@P `pP T |VN|||  FP  HP 6P @ Q ` Pp R} 0 p @ 0pRm Ri Pp`@0p@p W P0@`P@  pW 0`0@ 00RC `@` R< @ 0 0S/ 0p0@0S' 0 0@ BQ QQ P 0<40   `FPkX P  `PEU l` 8FPv p!P  FP  'FPd P P^Q `Q Q Q@LP   P,  ^R  R R 0 \R0Q  $ 404 RR0 s$P$@o0 0?+10 [PA ppp!7p;0yPᗾP5`FpV1cpWp`ɚ 0`pdW D᱁DXP  p00pGPd2Ѝۍ0pX a.!2#! &(&(f(a.Hn(&(a.a.2#O-M`PY   ЍOmP@pHH  0 p @P@P'*1 P  0PG`LI ` 0M 0rD`oD 0X , Ѝa.a.S.S.{!@-P\\\ 0S @T 0@0000 BRa.&(a.@-P\\\ 0S @T 0@0C000 BRa.&(a./a./a.P/卿a.H-P p`˙@řQPaU 㷙QG-t`P@p ᆝQQ  QQ  a.H-e{P %p$PCOIH-a.//H-MXp@G p P`p-VUPPЍa./@-@P C/p@-P@P`Q/ ! R:3+`Q  ZC`@pH-M 0*PЍp@-R@P`@TpQ/ A/p@-@PU`PUp/@-@ R Q Q! R * Q QS@SJ@0K-M,`(S@Žx0V"@^QpP` 0000040 00P0ЍO-OMM 8봿P  p{P  @ @;PP#P    P u  ZL pR 0``@D  Rpp`V /`P {0S 0 S@W R  R 0 @  " `V R`0tLuuЀPvx G,R @Q @ pP Q @ QQ @ p{P- h!P 40PK pp@;P p{}PJ \PPA $  # pP P#@P$ #PU[^ X@Jpp @`@`Pp$I p\P T P  P"3T 0 @ R*$\  $00 @Sr  0S:P 5\P&P$\  $$ @ $PPPPA@K$5@P$ p @pA PA ``\P PB% \PP  $ p{P @K P Q @Q$PM 0Gp @K 0Gp P P= P`P (08PP7  00@v P+p {@@QoPm Z :P@c(@PGP@ TQ   Gp/*P ( Fp%*@UT `H t!q !Q @ $@(p{7`(;P }P+Jи ȸ$ A @ $@ `T R \` @ R``P1E Q*PkK _?@b"P tڄ@`@@@hU HUIU gUPiU pU,U U;U# p{P #G P=  00@ P3;P1P(-wU  R 0 @ JA PR R Q J `@ ᥙl Q  , p} P p $0S PPp @\S p{R @   R e`  @P P@Z  \R R  0S S  @P E PPH`  Pvp{Q @ QY p{Q1 @  p{Q @X N@Q @PP P @0"@S.@`qW PP pl#@ p{<  ,. p3)&a.a.Hn(Pr``뼂xxCQU pP 0H?>PW`VP Oߍۍ!0 `0 PXthPTH0@ `B2#U 6T0 /L%|pdXLd 0$H<$ a.a.Hn(Tt.Pt.!N !? !l. !t !t.  ! ! !- ! !Q|j.^ !9 !2 !% ! ! ![ ! !k( ! ! !!!c!M!!!!P !|.|.|.|.O-MPC HP@qP{P tP rP 2aP bP.`V P p0"pS pX PP  =@TЍ(0 $p0 p`yj.Pt.Tt.2 !|.A-MM@0 A R * <PЍۍ.Q$Q +Q(/Q \Q  `NP P IQPR IAo`AP,,0 $0 )Tt.Pt. ! !p@-@0PP@ R RQ <4 0=P `pHn(Tt.Pt.A !O-M[a [h \[l p[] `\0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" P]UPW0C0 U \U nU 00p]Q pRp00ЍDD0 D㋑((0 0 Tt.Pt. !| ! !O-M`Pp @\ Z \Q Q: . AR [Y. P[R[) \0S$ Y" IP ]Q [QY[[Y][Y   P R  P R[   pR`  EPX R5Ѝ,, @PE 0t.Tt.Pt. !|.H-M@`PpmPn@ P2Dl܍܍|܍܍܍ aP dP fP       P pЍK-@Pp`?V?PV @p`?P VPD`P00@?6SC 琏hhhhhhxxxxxx?Q7@?QW@Q?0|/O- M`PetL:C@@sXL4X ~QHPa@Q%pА0@dEP GPX IPvHP\!X@2I  "@ P 0㭠P Y 0㠠P \Y @\!@~p%<0APU  @PPU p00 0p.`@p pP PUlPTvD} t.k !f( !t.~ !t~/ t.t.&(t.t.`(&(a.1t.H- 0yvf(C!O-M袟rಟ`P P P5 ;Pg婦&Pr PQ QxyP X H P" 0?#n>P:.AoRy\`nX>PsPQn\,0n(>PV;P ?0  K=mP PPQKQPPEPPAP l>0  sKH=Hm<PP, PfP( Pg >P0PP P YK!H!M XO!pQ!H- 'khf(w!@-M@#P   p Ѝ ᤀd!0H-M@P  uP P Ѝ0"Pp H-P@P Q `6CP {<P`P $CP rQ c<`V@-@P t P 偧 p UjH-aq1S  @ P PU  @S*QQ0Drr0S  0qq R q0CX3(H-%%Hp@- `!R 0@T 0RpQt@tQ  tt 0Rp BpX3(@-Q@L@@-R@L@H- 0Cff(!0H-@Q0qP0 y]P  㾼y̗P哠 ᒠ ql@@(XP L  B<*r000h~.P) ?Pt ; J*ڥ`pa 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0Sx`"P0A@0 B0!ARP !@ B/!rЋϧ$pW e凞P刞 0eP Pἧ(P嵤epPU$ pP X PQ XqH5 㞗 0ᙗ 㰽,b PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ  [)xP EPPAqP(Pm$rq cpp|r0S! B  /) +)Dcp| xPQ zPaPxP@a@(P(@P  )t )bmQ(q P 庤U4Rpf ׊ R  2/p[ P!PU   M p `P 嵣 夓 `劤埓`aA7 p P 垣vP 'Q P`P ' P`qV4 R  2/l PPP f P,Ѝt 0 j (0  _D 1`P p }f^cUt~.x~.˾l~.p~.8u/Hn(f( @-Q#@<\p|Qa & ,! 3+t ` H, 4 80SP B @.K!ftp.N @-Q@\| Qa (,$+ Ot |0SP B L  < P  @...ftp.d꿃Q Q Q/(  r n`...0H-Q@ <Qa 0q ,PX PP,+B2 0H5!`.r ] Q Q Q/,  q# `..P.aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-2!H-kYH-2 !H-7H-~.H-㰄L.H-9H-v2.!H-G:H-A:H-;:H-5:////H-,!/W.H-,!%W.H-,!@W.H-, W.//@-@0@-@ @-@@-@D@-@/@-@1@-@1///H-.H-.H-.H-.1H-MH P`0 0   0 Ѝp.H-M@     0 Ѝp.H-M8    0| Ѝ.H-M4 C 0j Ѝ.H-M8    0W Ѝ.0H-M@@  0PPC SЍ0p.H-Mll"R \, 04   d 0" Ѝp.ftp 0H-M|P  K  0@ P < [0 W00Ѝ0p.p z H-M8    0 Ѝ.H-e5.H-~./p@-P@`0  p@{f<!H-M8    0 Ѝ.H-M8    0 Ѝ.H-M8    0 Ѝ.H-M4 C 0x Ѝ.H-M8    0e Ѝ.H-~./////// /.  /.!H-M4 e 0 Ѝ.H-M8    0 Ѝ.H-4./H-M4 e 0Ѝ.H-M8    0Ѝ.H-M4 C 0Ѝ.H-M8    0Ѝ.//H-M4 e 0ЍP.H-M4 q 0Ѝ.H-M8    0xЍ.H-M8    0eЍ.H-M4 C 0SЍ.H-M8    0@Ѝ./H-M8<    0)Ѝ.H-M8<    0Ѝ.H-M4< C 0Ѝ.H-M8<    0Ѝ.///////pQ!/!/!/3!/9!/H!H-ML 00 Qa  0Ѝ.H-M@     0Ѝ.H-M8 3   0{Ѝ.0H-M@@  0PPgSЍ0.H-Mll"R \, 0X   d 0FЍ.ftp 0H-M|P  K  0@0P < 0 {--Ѝ0.p z H-M0 00  0 ЍK!H-I~.$$ " A/./H-ML 00 Qa  0Ѝ.H-M8 O   0Ѝ.0H-M@@  0PPSЍ0.H-Mll"R \, 0   d 0Ѝ.ftp 0H-M|P  K  0@{P < ʂ0 Ƃ'-%-Ѝ0.p z H-M8    0VЍ.H-1.$$ " A/./ /.pQ! /.! /.!///////H-=@-M} @P  z]ЍH-q0H-Pjp @} }00H-@[p Py}{0H- |lz.@-$@~P _z.H-)~H-#~0H-,P@ |!} Dz0.p@-X`P)Q M,@  @|A/z 0}p.p@-h`P)Q M+@  @|Az 0} [}p.p@-``P)Q M+@  @|Ay 0x}{p.H-}.0H-HP@ |! y)Q ~ 0X}0./////_!/g!/o!/x!/!/!/!/!/!/!/!/!/5/ba!/C/} /!/!////////H-M8    0Ѝ.H-M8    0{Ѝ.H-M8 j   0hЍ`./H-M 00 Qa   0LЍH-M8 q   0:Ѝ`.0H-M@  0PP&SЍ0@-M@d ,P H 0  d 0Ѝ! 0H-MP  K  0@P 8 A, =**Ѝ0p z /H-M4 e 0ЍP.H-M4 q 0Ѝ.H-M8 q   0Ѝ`./K-@`!PpR "  "r  Q0dC0^Q P0`x Q Ua rwQb ( dr `Y `80S  3/PK*!!!!A-PU@" Pې`ԐxpPUzPWP:@p`P P`$$ |~.~.~.~.~.A-M`Pp z@U@,  pp& P 0눀 0p pPGPu LP P@@@Ѝ@C0|~.O-OMp7ǟ W@&@b@00 @bFPP P  -ePP&V6@EE E 彯P} hFlft8P,  J,ePoP pPP rP gCPN DP_0fPU@oUPH  P@  @ _PxEp  P @T`V p=Q @Tp(pά ᳱ$0a{ 40pDdmP,pTHU8_P@  PPpP @PP  PPU:kh   *zP Td@e D@ 0ACP P 9l,lSCLIF||@@@D@P8@U<K p`PH Ao,P 8DD@T 8>D@T88D@^T+P& `8"1P2T    0p P<{`8`<TpP@T  ^P @ yO"KrPzP Tv@tT<Oߍ8@08 %@ TP< 0,㸵Pp 0㯵.. ..H.. 4#.!...p.C!L.t~/N! xvh!o!f(z.t!!  !P HA !O-MM @mPO `hPI 4P/ p  P; P !дᰰ<"P)>pP!  [P   P ppm  m / PxЍۍ܇!H-A-M D3*P~ Q upI Ph Y] 0%Pa ,GP\I% @I_'$G^PPRJ\8SP"p"P7 FP. @`WFp $aFP!!"Pr\| X)P )P P  P xFP! b,Ѝ pP @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p` FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0pp`W:U `pEP pPUp}L... @- M!(P: @.  P1JA$*!P RQ 1/P $1/$+R @JFP JPAP=P + Ѝ)Pa  Ѝ@!EP @ g[ P Z_ 0$PEPHF#&L..!!8u/f(!.p@- QD0 @8``P Q 0 p@T.. MO-jMp1s? 0MW, eL`P6 Z PD @pT)p4 pEZ :[2U0*P @P,  p=)ppP‱NP `[ PP  0N [pW M{X4P 0( 0yNjߍOЍ/ .#!:!B!xMO-M H"/0PL2< 0@T 'P P  @'үpPp  Q P Q G0 P P * %R@RA* I`'P`V*PKP/߳P pI/CpX5 ṯ,9P& G(, @ .P  vhP &P U  P7 4( 0] U f芟@u  tT4p Q PQP @ 04IP ᠣ IWu 0x  0p;p Hɟ< @$YP   PP P xP s뻢p PP( ~OP {0 缨   "" $ ,P~v\p\\\ 0hh `l`p`+P @pW (@PWP4(v  0N  p P[` ,@P @ ||`Wr0Dw,-@ $o @Q (P4( J P (pO|9@ [@P" 0P  P P" ,QPTiꪻ@P &,@[ N Lp7뜵2\P tr (P P! `[ P    ,QPtp& X@`Y V044X* ʂP˂,DX b {Y P@pQZ ,{&c(΀p PCqr `HX\ ;`w{뭂끉V u! X ᐂ@ԡ ` `Z t^{[{g@P 47y `jU V7rX x[  Us(B0 P @ P Y  ߍOЍ/ H``E WX Ja0@P @K@3a 7a bo BoF0P , vKAtxP  lKkx FP  @P @< @ @   <  @<P <<P @.h*/< D*ht@P p h `  uPH 8P  P~  0 JP5   DP/  >P)   8P#   2P   ,P P P  0P p' 0{P. < 4 ,P] *PWH8Q,j8K,dp$4P 㙪P<P) 00GP $@ [ '$0P #P t# h[tdPV W `"@3xxß  F0<뒜P  0&50P2rP) !2p' @ > MP B_ (`P`P (~lL!2P AᥨD0P P }!y0QSpooߍ ۍ0S " ㏨t 0㉨CP@T ,~.U!ӰHn(!6#͐!ߐ!`~.6#S!8!e!!nfsiÑ!..!L ܑ!!!!!!!*!:!H!&!K!`!.}!Y!ʒ! 5ђ!!.!!]!.Ћ!6.X!.ڌ!....\!g!r!˂.^ ^ !!*!ҍ!! !!.f(+!H".`"!K!p!!!Î!.s!!H-MHA0 PDP / 0 PDP . ܢ p. P@(Y ͢ PQUAx 㽢AP `X@\pP` ぢ }APPЍ!i..~.8i(. Q!0H-BM`PP .PQuP @0 P䅢  ~Bߍ0讁..H-@ሧpPᄧ` ,lP EPQ.P@`P 4@P0\ ' H"讁...!P/ 6#K-!MP<|ჰPPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ QD!ލ!!! 6#!G-PB@U% 堀嘠`pW Y /W P EQ 0,D@  ᮦP p`T:Hn(j!H-MBQ DD6<8 4 0/S 0CЍ.f..a! v.p@-M@P3  @ Q ||| E 5pPt@0h` /QC50</Q PPCЍp~.p..g..a!.@-@ @2p.p@-MG~P Q ? ; @P dd d0#PXX@L40  }C<<0 xC@ލp.nfs!....2!..H-BMP P RxPhhdP X5TrP H5D"D2 @BC4K6@P$ 65 0 bP !5 0P !1`  l?!1|hyxx6P, P4d nXajLgd8aP ,$!\  XP  P LpGQPdP _H\T pզBߍ~..!;!.6.!.!H!~.*Y! .y!&!k!..!׏!!!L !!!.!! z.!ď!.!!H-pP@ p `㵱8 p( @~.G-BM@`ZPP hp? P LLL X    0@PBߍp!q! .u!. PP  P/ ,P  ,P\/PQ !PHH/ Q Q W R] w/ "6#H-M, 0 0 QЍ oH-MP@ 0 ppp剞p% JP! ` 0 pppzp d1P Pp4/P &PpЍd7#!p@-@D `8TPPn ;UPpO!L 0H-@PP Q P P ToP P0\7#P7#H- hG(O-M`V! @PHp ]P tP PP `VЍH- tG(K-Mpp$a [?P9FP H@L! 0 p4/P pP 1/$qp 8 @1/pЍ[!O-lMP P< 8p@ L03/P' H$  0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-QMMz@L@ pXp/ @PHH`piH4@V@gx@P#^4@4@LTN/ W臟g0^ N/*P  ᏬP P0 }PTX\ 3 ".<  * @0!pK`048q00[,aH!L1`A [@[R$()!( H!L!,!0!4!8!(h` V< lV!a\fPYb,bn4@$ $(!0P,qP,q048!HLQP0 5P`V'#EG pP@pP@le$;$BP@DP H!L1  $A@$)p$#B :0r<8<<P P4p8 lP ^ P P $1/$@Q() Z}P $}PK? @$LPLPY @$48!LHATY0I Y d#0?0 P e Pc A/ 4E0p%A_0l>\ 1P <5@A/\5p ̜P4 4`A/p4@00Wp`X:@P ;xPB 5/P  /P  xP;B 5/A/;xP 5/< PRp B<@R0~tP<Ap|plp<@RRi R|00S #=xA U\pkR` 0<RdAEp[00S "=(0S "p= ,0S "p= $x"P Pth A0Xr@Pp)(P,Q !=A p$PAxphtAlp\0)pR00 A ^hA? "Y  2$P A/A/@T pEd/A E0A/P A/\0.!!!!!0!d!!!!˔!ה!ܔ!!!!! !t!z!!!9!@!G!N!I e!g!*!!!!L.K-MMpQ4 @`P  j P* AP #PĨP" HVP0kp W V` } 0`C@PpЍڍ p p *  YldP UFPPJl@Q0 0(  0#!!T!!! H-PP 0 S,0S ,\ SHQ S:8 80S:^3O-}MM4FP`*P.T/A. pW 8. 0@=Y=  D)QB ^ P Fo P x  yP 쩝䙝Z DP 0uPJm@U @`PF^  T:Z0S h 㹞z P TLPP@T: (P P P$TT 0^ x`   H 0 0 ;6/`PV<u `QppP P ȣ 瀉<<<<<`L3P+=3D YP  P sZDTO<p\P$@p<iPH - < Y 0P@`TpD8p rŸ@㬒B@ b`RP"  < P( H l, 8 @0$`@PLPp[N: r0D ^  g 蹍䉍Oy/ P`V XD^.먁P FD@|stplmP X@!fLPFP 0`` 1q(Q4s 0 !P Q---P --Ah}ߍۍ.!d*!.5!l!!Ę̕! ! `!_!!8! !!!!! !!!!Ɩ!!!!f!. oΖ!!!!ؘ!@)-  01 @@pW > OR 4)Q p! @09 \#P0 @P+P@pPT:  #& ,T*d0`48 xP 0 ;`5/P a LL L0l7#!!!! !7#!ӗ!!m۶!D!P!..!!d 0v0t0H-P0 @]P0. 0H,!߇ @-@  p8@.0H-M Q 8 P Qp  0@xP@ 0 0;5/P @ PPPЍ0.0H-$@P  PP0.O-MP PV@<PI  PDJ@ ᛛTA q`BI P R  qP  qP   P @DPPP  XpH  @T v ЍHn(@-M@ %Q Q P 0 Ѝx0H-*JTR0G-MM@08T<4,[ QP0 `$P P0A`T4`0 P{ ,Phd2}T8 ppA@ 04Ÿ`P 0pp_8 R^ P4Ql @0R 0pW PpRaPVW:( R1/4@TP* \O@pp@P@TBP0< `Y ѣP K? 9P 0P4PP 0`4``N@TV  } P4Q @0( R1/4@T:0 ߍڍ`_.|G(`H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU Q003P  L03/P P `V:0Z `Pp Pk (0$`P4 ($`,q P( P 0QUQPU Q003P@ L03/P P  X:0`V( < 0`H   0```np <`8`$`4P4`*8P  P 8 <0p!0$` PtЍD`O-MpPPE ` Q7 pp @p  L0 3/P! ppt`0 1P 0*! #dSP P  `pY: ^ `ЍH.7!0H-@P P 0H0p@-P @`Q0  p@ = A-@ P" Q ` 熁(0S `V:0S P0QqPWS:1/A K-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMPx` ;p@p p6/P  ;x` @p p6/P ( 0~oBЍۍv!G-vM`L@HpP 9HP PN i" Q Qm tP! aZ'Pbp$`Q a$qU(1,!04# @` VP P%`0@ꛥPC P?Q; @>P7 P 2 p^ `opm$P  5$@0"PU?@\& P5 &P2@4zP- (vP) b/P$ K?t # np5qޗ G0PPA@# 0`5@Yt\ 7bo3H  Q唑pP P1 JJP@p TKXq D0 H @  `P\`TNP P K?tb # `5\"pru{AP1 p/67NPEQ* FPXQ&g !0&p A0y 0sK?a # ^`I5! p; ,70@` pP(Q0030SP'Q 0W'pQp0p 0WP07@&P: Q@ RQK? #p ^p 5 ` 0M4PPPNvߍP7#O!hG(tG(ffs! &}DER!PR" Hn(!.QQ`W ɘ!!H-S P`V VVPU  0B `SV VV U E0\0@P`pw` V :w\VQ Q `&c``a0````0``Q `0RO-dMMpQ:P YP dЍۍ 巟`P 屟P  _OV7 ++|/+#(P \R R 0S   @PU2 $P  R 2/phQUc++/P'`@PaUj:2aPf+א$$P  R 2/p pP0 _R6rP['P K? Y4P ` R 2/p1/4rN_[p$aV| /x;@@ d!PQ9 P P;P-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍh8P$(lxG-`MFPpW~ AP 8P l0PŁ L'Pū ,PGPHPIPJz~Pł q~PŃ h|~Pa``~P$ R p`(N~ p`P$ V:pp0  Y4Qq$ Q $Q$QzY 48PQ Ql$ Q\ `$Qj X$Q P$Q H$Q @$Q P 0 "HL "HL "HL z"HL s"HL l"HL  e"HL@ |^"HLR d`ЍGU"PB 0 02)( @P 3"Q 2 `ЍG9"H\"@PP!t@0 2P@0 14b 0P(b# H!@PPz 0"`ЍH \ CH ` 0 Hd0S? ! + W 0P 0DP!HQ,  P`pdp``I 7/(20  'Pp 0\@P 8H 0\ .............l(x! H..С!ǡ!$8P<h!!!!!!!!!&!+A"ޡ!O-4MPp YPD P9 `  L03/PPP` V:&p@P$0# " H  %  0  "^ T ^ ,0S PpfRp 8`I 4Ѝ 4ЍO\.A-@P= P\1/0 ` 0`0F?o2SP( p aYP* 1 `OP pbH"Purl P 1  C0"`r@AaO-$M@\1/Pp`Q `V` YP( pW 83 0P  0Y0 01>0  08 1V0 01e?0  B 0]ŸCPn_P Epp`rPC" ppJ0`PŸP\(P0ppp,g< 0 @ΰ0Pd (`pPV pPP Yp`Vp 8I gPpuY  PW`PW:uʣ`lp0 pP :P }pP R 2/pW,0q0Pp(p(p p(,(Wp,$Ѝ(( (0mtȠ.4 ! ! !. !K-@Pap `P6 pp Q h`"p?qhp" P bI"p,q`  p(p崁$Vi`tA-M@P `03/P !  0P ` 2/ލO-EM@ $B3PP} B@@Lh`pT<Pp T@PP*u @ 2P p P*0簀GCp0@P\ pP@00@D00 $0 PX00PPñT0p S ZȀ Zzzzz] @T ğA  0害p P J 8PP vP Lp,PH1/PD `'@@LL X4P0TPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DTh k Hh 4pl0 0p0<80`  0P@4P/VD@hpL<8 PU:@PD`Pd Pp!@ a@(@!PU  AL " oiPB U Efa"o P6 P1 $1/$P  0@#P P@H!L1 @ 01/P !PRP$HQ@PRP @ RQЍ@.)@-Q @T R Q p0S@@P@3 @@P@3 i5/H-M(P@U #`  0o1/PwF@Ѝ/H-hMP; a!1P@pPPP  P P P 0PPp 0 0@dp P ` 2pPhЍsP.!֣!ߣ!!.!!!.+!!/H- H R!׏!///p@-`Q  0@RPU @T00Q0SR p 㴱p@z0H-0M@l    ,($RP Pu  Pa 0Ѝ0.//H-R p`@PTPQ vP `Vp@8$ PR PkuXP!.0H-PR00@t@Q" % %!$#0H..H-@@P`uP $( pxg H.H- P Y~.0H-@P0\.0H-P@0 AP U0s!0H-P@!P 0+7 U0,<P000d!O-GM  xȿP @蠟P`耟p埠P" P   Pl xP d S:;  Gߍ.פ!k..!!5!D!a!G-MQ@;`pLl2  P PP PPU :`l` Ѝ^!!G-!M`P@90q<!P㬁N?Q0 P/ p PP d ᧈPk` [$P=P%  9P 6 [PP2  0 l+@xs0[ 8;_k @0 6X@P L l4 4!ލ !T\[!x!.! !!8!H-P@8hp`0P9 T`,`N/P  < p zl,, Xץ!.!! !!0H-M @|wb  0߰P c TP@Pq@ T8 @0Ϻ$ ˺܍0.!!!ʤ!H-H-ㆯ H跺d!O-[Mh@P@wU jP b(PY Y Y$GDP `"P 8P0 D" 1P0 P9 N)`!0X (`j0 (`jpWO37# #La!0ع8Y\\\! p`P P P pppp @`F@ P^ FJ F0 0 & 0'h 0ppPP(@᪞1[ߍ0M㜮|PJPTL.tQ(!!.զ!<.A!7!\.k...8u/H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|Ѝ.O-M쥟@P )`Qa(P^TP%5VkPUP Qn +0<ጅ 0 0RpFP0hşh R0```Vp &0PHpTPPP@H@Q>@ LPLPJ;P `P TPQ `" R pQ 2 !0PpW:T`V:P Q CTP :@PP;T@PT:P忣(廣$帣嵣c&3pP"0 @1@.`!0)$(0  `ߤ$厣$刣H`@PPzk0S @8 3/P PTH`Hx , `Ÿd2R0 :<P ,] H `Af 0` `````傗p] Pq,>ŗPQ P`M׽JP ӽ ᶗϽLob?P P  P* pPH` L03/P PU:X\P P`<Vi+`P rP R 2/@`Ѝ `:T0S H2 m^.L. 2!܎x. ...!!!!O-LM@ PpPD@0  A@x0xp`0 b]oPHp1`n_rP,p 0`B Q$$ $0ygD.Ě؞!!!O-Mp@啠@呠P` p P |  0P\r0 cLLB <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0`Vp@PL[:`@ӷB %,  PH⌿`Cߍ$./O-MPQ `$@@`(qP `"pVZU $Q 8 Q "GZ@p@Ѝ;#H-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*8G-M0PPWCvWPnWP~ eWP \WP TWPŁ KlWPū BLWP$ R p`(1W p`P$ V:< 0 RZf Ȣ\!|qQ0 pq|R8`pdp``J 7/ $@P(0  9@0 E_ @0 <_ ` 0 P0/_ xpP0` pPL `p 0Q $0ppIލ........ǡ!H..С!k_K-MP1< @Cp(0AS*d`80 6/ 0( \80 pp 7/Qh08 3/ލp@-(M@,0/`߳PV    Rx 0  0厏`p MAҏ(Ѝp耧K-0M8q L0 3/P  @ p|1/ P@ p` U0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  DQ 0P``PP 喝P p@ 2/Pv 0``PP |P`@-@Q 0 A2/@P 0 @ ㉚ @ꜧ @-M@8q 0 3/P9  Ѝ@/O-MM^ Pg[P ┗P] OP ∗p ʘ>@+PᆗPd0`0 㜥D@ lj$@+PdP 0 z@+zP mP"0fP tBP`+^PL r0 L,+NP0 = 6Pf ,P\@+,PT0 PJ( @+P0Pu P,m PP.묰 +O[ܠ@唐`p  0ICP  0ۤPE u P * Ѝۍ&봬!!Ȭ!ڬ!ά!!ì!!!!!! !:!!,!!9!J!I!R(a!O- Mp`OD@T: PY Y4PAJP, pQ:  P  0xrp|'JPP Y Y 40w岳nB ЍT!a!X!0O-MM@p/PP PݔpX`P` P "0@+PO PS*A@/jXPP `P FQ Q/R ⌕P8JP P) P Xh  ፔP&J/Po!0@n+ O`+O P]P J P+N P:ba?_a`@y{Xa@PЍۍ4!P /PP) @P`P SPS PT x+N P*+N P*HpHP#a> a@@P!a!8!!H-) p@-M Pl@PJ  @PJ P` V P: 1,qQ0OЍpO-M080 ` 00z @(8pD DD DP 8P 0T 3/P[ P. 8phAg"80s" 80` 0S ФP L03/P hl ! PU:P8(P"8PpW: p0@p` `%0000 ,`Zp5d%XupXg@&T  R q p5@`TP7 J50 `0-` R4@$ X,`@0P4$@,p0@Tw  00`Xh`P7D00L`,!<HHAC ` [P4<xP@[P;8Z C[P p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#X 0 0h@@P忙  `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`YU`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(8 i7 g!H..8!.a!!Hn(0H-0MP   !0Ed @P6U7C @ @$P L῰0Ѝ0H...H-(MP@X-(Px(p,p10 (0R0< 0F0P0 000```Pp&p, 0,k(儰0bP`(|(`(Ѝ@,; P0  ,+) P K|n*! dg-0TT Z@F.44 40 0Ѝpi! 2!.W .n!<#G-pMQJ@PPe : 0 ` V " 2p 09X": r`T Pv#ϔ|"p` \0 XL":0 w<"J& ,Pf 㱔p0"(H0  R P5 ` p=TX p!0 Q 4 t R8qT TX `  P  }@!p(0G p r `p  h p( 02 p`+0 0@0 J pV UpЍ8=0p 0h` >p@ (02/`P H.D g!֡!!W !!!!O-M)$qQ `W W PQ% P!T11/PPP(0`o"P Pp`H!L1 ` 01/P p$qP P `pp@ L03/P P P@ `V:@V?@ Q<@pR  7p0S P1Ta(h lP`0 0S h 3/,4w 0#h*Gfbb 0!\%0`匓p刓hb&T% 0 `vprhb '0 (屔b^0,p`(PP[T  |p`'p ş5u@ PBA@@@,p0  :(P` 0<] `Apf0` `````Yp pH,(ᜇ0ppW PX!\DGP.@X1/`h`plp 0HP pM`ph@l1! ,1/4p<pH@1/ 0`C  ( ```4/Pl`h```!(0l0h 0 Q  01/ Pp 0 0ZtPUi xH QpU^ p`@,P3WPo `VppUH ,0 p(pW%  p0UU: ,p`e PUU(PU  BppV+ P^P BG0@ PX SR bpQb 8L0( 3/P px8 08 8 p( 07/xPPpP P t0 P |xp`Ap`ЍpH 80 L0H ( 3/P px8 0 8`8 ( 06/x@DxtPv<< <0X.L. 2!Xhx.x!! !!|O-4MБVp@ `| P/ 0`厔 /P PX  B/ X P^VP pP[ { `嘑 PY:P(p`P, pap fP# (phR ! p"p  kYXT,4  `8`卹ⴁ4Ѝ`L.O-tMPl$h⬱pP @ứP X$P    Rp dp`p:( :zzzz`]A     0ppU TT垅 ᷫ`$PAJ(P P: P!aP(PpݩP- ``@`r@@"Bdhb"pAp X 0 P8PPh h@lPh 4 h9 hl5`o ptЍ.$,/////O-lMP8`@XPp 0W 00V0 $00@ `` 0@ pVp`pQp pP *.M륷  P:R ,0ST0 S Qp xlЍO 00 8 Pp $,`X4( ,$P `Q Q 803/P ,(Q  RR(  (  ,Q BP J B p,P P(4Q4"@`GTP TP GpP,,(($`P P p X:(4,$($P Q `8p L03/P LPTP P (` V:(8 0 P- 88`p L03/P HLP 08 < P    R pW:H1/` [*k8q p Ѐpx@p@ X0T0@ 0 !k , P  0 2p@P@0@ X* S0pP AhRW $0@ [ 51 07 5$P X*1h2(0 S&*1c20@0WP0@,  QP@p`A R80s@0p 0p@X0pP0@WPZu$4p W!*!P: 0` -Rg [0p@Q`@`V 0@Q@$0@P [#* 0P` RY 0x/0p0S P  2p@@0@0XP0` PN0 @ Dp @P@0@ ? P<0( @,Q :R*Abp^ q P rPU  P$0 00Q* 0^qa @PPQT  lЍ@<#.!a!@..O-CMPp@U\0`dR `80 R0P pQ0s  BYO p㉦PJ ؠHppPV p fKhP0 dpp`pPW:!8phP @T pPp JKh L0 l@3/h @T:Pd@E oq/AQqPHp09PT 8HpH1/PPD @RL `T` < #"PLPP{0  + @p8q ``( L0 3/d0@TpTDXP@P L0p @PX PPdp0`Y:[4*d 8 pዑk< @ pR P D L0P@P `PPp "0P0$P``P `PPU4 P H@\ Pt`Y@( \ [ H 1/d 0Up`P (``R$` cX' <T dH@0h@84`,`pgZc PHp85 P \ 04 p0 Xh < \ 3/PE ,hl$R8P0  p p p0 :0 0S O +&0yPU  ZGP QU}QU/e  +PPQTQXQ\Q})<, 8 "8P a/Qbしb_JdZ [ `tP }AQ  Q  Qa/@T[V  4@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8@  PU: p| @ TP xtlhp| h0 |XT\| T0 @d@`@$P  D ,$$@  0 ., , P H4| @0 L@<@8@P ($ | 0 | 0<`20 `00 (Pd` `00QARQaߍH..!`.p.a!.-<....t.8..x1d!Q/Ѵ!/P.O-Maa8@PhT4 }Q|! R0" ߍOPxpW   R/07/P- L03/xP PP:~ɀ`48K00PS %`_ $ 0R ,Rt;$ _`p," P  PIP TDP`,Iph!P RP,1U A 6 60UP @P 40#<IP=@D$ L0/3/PT"0 P t I `;P @P  JPIPHRHQP "I 0@ ܂@pRoP  s6 o6P8p@T*0x 0SU| C`"T3_"IR/P"I`0;$q _@py &' @LU Ro %6 !6 6$ Hq;$ _@pQR/0V<$ RoG ` 1"` I  R"% @ 3@@- I    I ߍD! !/!!7!!! !L!+A"! %!!/P.O-MM/`p@T! P|P $P 1/P $ R  0P1/P 1/P|QATTp `P @O~<`8P P / 0  P  _ 0VS pPQ( XQ%0 ᫧PPTq 0@xp P` `7/, PT0 0xp0H0@M `7/ %,! Yp@PQXQ% 0 uPPTq 0x@ `` `4/T  PT0 0x@0H0 `4/0  ,p! W~  0$ݮڮpy;L<  0P  0P|  P `  ܉P `^Z38 PZ ,|,D`D@P <P @ 0 P嵉P P$PH`YV' <@xP 0  5/ 8 B$0xP0 05/40<  刉P!@Y PP   P JĪ@P < ,8 : Pr  0x BQ8!# Rd(@@;8$PQ , PC =PLp;`| 4 48P@T8!(0S )  8 ,38(@$P!,0S d) s 8 ,388p!00S ) a  ,38  0;P,p@0`L8P  R8(,40y0Pn0 0`4  3T(y0\Pn0 &  3((8(P 0   3'y0lPn0   y3` P  8P '  0  f30@8 PP P' 0  ,R3@P0LS'   C3T0S&   63X0S&   )3`0S&   3d0SP&   3h0S &   3%   28   0400`0`Vxp)(@$PS8   08Sqpq R  R   Qx(@$P,8P,Q@|P 䄟8p;P84AP 0P`VF $ Q?  L0 3/P HPXP$ Z:)  7 P/P 7/ P 7  P{8P 48` 7P47UaV{V 8h<P4PP 8`x Q74# 0Pc 9P ᘤP 0 S0P市P(80448!0I| ;\b% P  -P 0P0PPUOPQ 9 9Q Io0F0F PQ @P y8PPPP x 6< \P@P < UPP t NߍۍP.H..A!8..!*!İ!ڰ!z!!!&!)!>!S!f!f(!W!<. .!!x!`.p.!! !(!/!6!=!S!Z! !a!!Ф!h!t!{!!!!!!pPd..a!߇ ,!!!!@-@ĭ P P @莆h.!p@-MP& @$PP" 0PP `HP L  05/PP 8!$QH`R UPPЍp.H-8MP8P= 8@BT5 P1 $q'$Q P ^`P``V Q  P ᗭ  z P A ᔮ 14|8Ѝ 0m A!o!{cH.G-Mp8Q 8B`Y rP $A1/Q  01/P P1/P$QPH1/`@0hBW* 803/P <0S  3/0X `````3/PppX000  3/pb h L03/ { @  p PA @` L03/P |Qzp `V:W$:P" `p㘀 L03/P  |Q h l0"#v` pW:v ` ``(  YT|Ѝ$$ $0m 0 @!o!{ca!?#H.p@-@`PQ  D@ (0Tpp@W<ȎP PUppH.O-$M\)ĀĠ@`p\  0 PU PPU 0P 0`MPU 2>P Q` V$ЍOȢ`$Ѝ!.H-M!bAP8 @Q`V P ' ypQP_ q`P x @PPQt.l.l.... /P/-iAxhh!h1lq`Pa Pp paWP@ 0 P`G& 0p`Pa PppP`a 0 Pp \`XPp@88 80 `P!PЍH...!lAD8F|F.@=>8@@t.tt x.79h<<.1356.O-M@P 0`a q08 0000 pQ7` RQ`V, P&" R Q "t  p 0P g&"Q!! S 8  `Ѝ- pK-MQN@1P223 3@3\3|33 Rx` . .́pPPP XP .0 }.,p! W2x` .X n.LpPPPXP  b.0 ^.,p! W ܍ P x$0 - Px  0% Pw 0Pw p0  Pw P0  Pw 00  Pw  0܍Kiꪯ!!! K-HMA`PDPp]  0  0ppk QM `l@4444@54 5545(5 PPg8 gP1D gDPP$U)P$`l@ !n@ `l@PP`l @0X &pB 0Pp @z+WPWHЍLS(,S( T.O-4M@Q< `PpPP TL0 3/P Xo R r P,`! VU $@Q:P P+E⚠+,, PJ4Ѝ, .0H-P@P ?L $P P?0G-(MⰂ`p-W BpPv|2PPpG wppV777,8l888(9d9 @v0 | @v`QP !0 !:! p@\ @v`Qvt g0SP  QvD!0 qp@: P P!$1 bp@+ P P (1 Sp@ P P ,1 Dp@ P PL 01 5p@ _v(0 g(ЍX.># ! H.K-MP P@0:::;(;L;x;;;H<   0 `P``y /P @ ,!01@/QPPfPo`PP\|0,!< "0POPoIPPE o @ PP< P9!Io PP1 P."Jo PP& P##Ko PP Pn0\ p 0Pp x~UPWPPލ .7!@-@Q -1P p$$ PUXtv.@-@C=P < $1(!,048<G-M] P`pu +VI==>8>`>a@p@PP  + +8p@T@.$/ @Hu 0!(0S @#,0Sd @100S4 @2 %u 0܍軯!! !K-JMdAPp]L  0  0pp@iQ  o(@X?p????@dP-P+ 3  0PPw5`l,@6`l0@0d )p 0Pp wTPWPPJߍpS(PS( O-4Mp`8` P`fA`P $$ L0 3/P`8@ V V 4Ѝ@-@$<(,04+x<ߡ$Q"d  @@Q!A-BM@] P`et * VAA,BHBdBBBB C4C\CCC@Mt 0o9 @Et  0 s: @9t`0c; @2t`4\@,t8P`/P] #tPd 0RX0SH! @=4 @t`d:> @ t \0+`0S @?h0S @Al0S @Bp0Sp @C sL 0 @st`Qs0 \Bߍ豯! !ү!Ư!K-MP Pj@oXpDDDDEE@EXEhExEEEF FP EP 0,!< F 0A0Po0;4Po458P PG  0Qv'dPod!I`l\p J`l`pK`lhpolp0 . 0P  ,vSPWލpP PptPotPP P .@-@ Q.QH-@ P`ppp p;@`g$Q"d  @H虭Qܯ!p@-@MP@PJDP R ,@! p``P T X0d)P @ЍpH.T.O-MM|?thX0(P pW pW rebq(@@BP   ,0RU]  0    0``fp pb&ghPJP`,吁!(Q !C A ,R㐁 `  `ߍۍT.`O-$D 20P 4 vP1x@pW W   iP"  aP vP 8 R |8Х8d08 vP PJD[0`V: <@P1 DP 8 ᯥ880p W P p8 Pp8 ptv@    `9`V0   ᖹPGߍۍd@!!!!!!HXX[!µ!9!A!i!O-_MMP|P pP ;v@P _ߍۍH@'`Z0u@PH0P GDh(PēpPd T 0,`@f$<YOp84PpHLP\e`"PG P [ [( [TP*T  `/\  ܔP \%eXePP    PX  ÔP d! 0  㸔 `T`p  eP P  P  P \P)PdZ 4 @ $8H@W$,L 0HPp<4eP X\gHLP6 Y P0D` T0Y T `PP0XԐ84\< P .T P  Q <p<(ΒPd)HLPp <@84,0DP<h 40p8@<8@B0`v?E(D_/;` W/ ,0`0 R 4P @  PPPQ088P`8pZ0W PP0@,0a[/ 0plfP<t\~Ppql0 [/ `f`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R `xp W:᱃ eD@7$$ $0 D00.!D!W!X.k!h.}! x!m{^A#|db!G-0M@( s`P HQP PX`TP|8`P&&qS8Z`0  $00Ѝ 0/.!!r"@?#/ /H-0`@V PpD_-P Z-P `pV@p@-P 0P@U  .`+PV&p@# 0/.!!!@- @s@!A-PP`@pW P"(@#h.p@-hP@PXT P`VPp,P,P `VpJ`FG `(`H0Ip4 4800KP`,`$P `僽LЍ$B# G-8MP' PP# (L 00 `@Q0  pp P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`")P p'W1 00(pbRp`P0 E $B#O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @ :/p'WlЍ$B# 0H-MP0!814A @kd  0PJ X Ve  0L@T 0 4/᣿Ѝ0.1!O- M0 >,0LQHA04q8a6'W X   ?V   T0`  R Q  0 p?`\p`  ЍO/ Ѝ.UO-\M RW  dLA p0P o P0Zg\C`@>PQ @0P ] P0HgJCp@P@P?HL P PU@P & 0&/%$X P@10`d5/p`\Ѝ .@-@P* p.0H-|P@Q Q0XT D 0"!Q@ PRUR0 0p. .H-@P*p- 02 H;  0E-*$F#}!ķ!{c0H-P@P |T T TEU P *P0T T 00 0 0p. .`9@P PP.$p 0 Q ' P`!R U R RR "q pRp a ` ^ P@UQX p: 0(Pb0P!,Q Q0p p  F  P $p 0 " 0M pPM 0 [X0A8PU qPU bz@<P@P(P P" 0   $?` p6RU UU `LT L0C:b>R R@> + pTЍ .}!!{c̸!`!!O-tM8^Ph 40@ SD0AQ0R^K0` p@S[ PPTTT  rp 0`:T X0W0,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^vtЍQ @ P`P ``P`  T1^ [ :^ q0<>02 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QnB`0Dp  W T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ xP  <5 `p0p LQ Q? `V@ ( @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP ^  P $040cvP 00U,0`ĢB4`@"8 ;qPJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@%@ B R R R (0"r" " 09 0YR0pW ,@$`PBrP T `p W,4,apNoP" @0g 4P pP,| {t `0 W UPD (pX OPtPUt4PJUz%  P-"P(8 L03/PLP  @RD @P Q1/  @!U ptp<Ѝۍ$`(p 0 }!D!W! .K-0M8"rP/ @P`TPV pp&W? " `p>,0Ra V0  "P 0τo@0Ѝ 09 }!!W! E#O-TM $H0$P L0pPHJ0H 4LP`P0 4<($D @0YP.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    0P'"X$! `VQZu  吵" ?Y@Lp?`HL Q pWp  E 0B%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍ./p@-8MP HQ2"d@A` p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&0=8Ѝp.UUUU3333O-M4@pPo? FFPP Z QPکPW   pP pP JzPP PBPTW Ѝ!G- 4pq=pW$PT \ '0 ?@`RU U UU R, @"0R Y X'P  GP:Y W ṉP?6"R 22  G .4JO-MMPP TQ4pAn 县 @P w  ;%pp   T@XpZw pS0P 1/ BT _` r`VrOPrPUq qЍۍ 0k h{dЀ}!!!H-MM@0P 1/ ;δp `PoP p Rq"SzЍۍO-M@吰px| Q94`0߯`H pG0w@0P@PЍD# .+A"t.p.Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @p. .K-M─ Q @4` 0ሯr Vh p0(@~DD0  p"!@@@@Ѝ .+A"ڧ!t.p.K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 08Q 4PU" pRUUO`&n`V!n4W  4 ]@@PXRU PPO`m`Vm긹!O-M⾀@p_`EfPP V QPکP"0@PKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0 }!W!s!p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`P8㤕Eu  OpPePfP lP zP6bP eP  0~$ 0~ppW @T  GNp / Z8 X6T4 <F +,嫩Pl OP$   P #`@p imPI $ x#p]plZ' INpʔP;p|KP(N N$M(M#0P 5$ N$M(M bŸ2 pRp@ Xpf@ p PF/5Opt!P  fPt pINpTp<1$[ A~N$M(Mp M  Mp@P P( ZMpnQ P 0@T aP 8$(vM@^Y ߢ`   R0q0 P0R0v 1:P V V A Y kP@ B/(B/!t~/!Q `(! )!(!ht@f( P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM p !Ѝۍ!p/H-M`P@R   `P K pT1Ѝ0H-@  IP  PU P R qhohP  R chahPU0H[hO-MMRO @ PT k p`PH`Vp@U+   0p HiP e#P* PT" m P U p PF@P R@XL ED <0@( (700'Ѝۍo!!!+!p@-@$P`hbP 2 Z Pppp@-M>P`@*p! 0 @pll0< p D0 @pЍp7!!,O-lM K @oP `2p- @ {p -J Jp P :&{P P P U e{0A-(MpP@`l6HP$p P8 Vs P !U LP pPM` Y6pP P P bh:D PK DH!| H,(ЍAd P9 P6PXP6P L'(ЍAp, j,DP $P  ppP 4U(ЍA (ЍA\l!}!!!!!!! @-M@pM0$1p   b Ѝ! !H-MP@p\P= + 0 + );P  0 `6xQ Q RQ 0 0 R\ W P6TP HЍ ЍHҽ!!I!@-M@pP Q @ pP t 0_ЍA!@-M@ P Ѝ HD  P Ѝ@#@-@:d+LP POHP P@+t!}! p@-@`HPp P$  P|: !$P p,A \p p@|!K-M@q & ` 0 p)P2 PP0 px P3 @ P  2> $> >$QE **AxP @ P | t\PK JH[K{p7vpA@ Q   x@ Rpx DH!@@ 0@pV e PHQ   Pb {x!pЍ-!C!!! !H-@P `pxt , 1B`UP* 0P P:H !g!O-MM` *0'Dp $$@P+B` !p@Zv7P  PP@ `Z \!`1 p)PO PxP `@P T`V* @Px  0Px` xQ@ DH! 0 `' `V:ax~xP x>ЍۍW!f!z!Mb!@@-@ xP HH R$ @@-@@?A-@Mp@PR `P V :-07  @ЍAP"R P 0r>pWU# * P P `* <0! \ p <0 8X>P * s@Ѝ Ѿ!!!2!H-M@`8!QQQ)Q7 Qp P[ЍH QT , ApN||ЍHQ" Q/ QQXtt!a0 Q< QF,,,!V@p0ЍH{  !J 0P BAD!\H1Bq 3 P0pP  n Ѝ@LL x@T p@HЍHK긼!O!`!!!ȿ!!!!!!!!w!p!xB/п!p@-M@ 0mP* `HD1 W8!@ 08P0@00ȌP 080  P 090 00 Ѝp@ЍpO- MxpWB 0@ P [ ` P P PY P [ U) PP! `h(  J 0? U    ;>QpW Ѝ!K-P 00`PdPp88PxPU!  P X `@YP @W@X &p4  PU I?P&xPU P X `@,P @W@X X&p P88`88`Ѝ. P Xx`@T +@  0P`   0`xF PX!!&!6!?!`(~!G#g!@-@ P   P@:O-M`PP4`0` @ P P  8p* /8h0,d4b>pu>pn>p & d& N夿夏 0@`  0@ p?PMPp] 4P* 6PN@Qf@ Q# \\\  \\ \\ hL \| \\\   DoxP(o   x\ٶxnn  ꌎ@E,P A xG 8`‡E|Q 0p) P, 80 P+pW7 xP8@T 0p P `8 0X ,\p@   `/*P J D@ `:1 W *  p@ 0 `Qa xp$ $V P]  < 8@@rpb P 8ĊpP :   @f=PD P PJ8> `0  !/q ,8p/@T0 `P,`: v`*zVpVp8+0p  `L `N#PsHH  8 3p@ <` ` p@,@8Wp  84+ P Q R000 . [8<P [$[8P[> kP [P@1 e @dp xu[ Xp[ߍ, <pl u `%z=p P `(d =p P d(`(V 84P pq@8 4 0 I@8P} 9 ,pl!/,p /p,G @T8p )P(8 -  7  pp ,6 pp$0S  pE ePE pa?`TT p8pT8 uP H@VQR Pc  P_ K&,`Hp 8p `<F$(d;d58  Up4^<p P p @,@#PY($ Ad!;d58  2p wPD pTPd$ 4 0/8ppZ %+& @pPx4 pp0E!1R84 P: @P d t P P0!@Tp,@ @W  0S, QP A8lhTp"H p*<S!!!pW @ P  @@bpW!8P4` 3 p4p@8p`V p P Pp`V @-0 Q `VxS(l! @ @ ( W!1 R  1Pd G#~!}!8-8@T LQ P  0@H@T`p,@pXcp<xS(!!!!!t~/`(!!! ! !!8!xG#!h4!O!z!r!!!!!!!.!7![! E!P!- "}!!&"!!!!!-!dn!!G!!!!!!!!a !!!f(Z!G#!0H-@H@:p P;p$0HH:0Hi!!Q@-M@ဇp tdPt :DЍ@0d @Ѝ!0H-M@ , 9P p<,,:,Ѝ0R |l0`XЍ0H<PЍ0HUUK!'!6!v!P!@-@Q  ``-p7P  P@VP@yK!!O-M@`PP Р,(p R ` `0 P    !  H6@}8 P P  @ P@Ѝ!!0H-@LP PPXLPLPXPTP PXXTPTXWXdP PhWdPdhWhRU P  ,PPRWlRU pP  p,PPplRWl0@-@@!@-M@Q  b 8p PQ `0 @kpЍH<Ѝ@ Ѝ@K!!7!p@-M@Q  ] 8p `PPJ|rWQP| h0 ! @.pЍp@4Ѝp@p7``kЍp@K!! 7!p@-M@Q  44h_? B|8PP p L8Ѝp@b!Q| A0S|`XP\P `@P` XX  P ٖ80 @p Ѝp Ѝp@ K!!f(7!p@-@>P PR u<`0p`> *>@p耼H-M@pP tq^$"P#(P pPpPP (QP@!U8 >pQ: `l!R pP 0sP 00.'p$$lP >P p *P> +>'nVptqЍ jx`V >P`lP x[>P p *`> >p@ F!! !#!v!!J!/K-PE S `X!1Rq@p U,PU Q P P Q   PxPP U Pp@ `崑U 0G]!;!!!H-P q R 0S  U B  05!!!H-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;H-M\J8 ^ 0Ѝʚ;G-PM PUO @`SO*$(p`W P P p0pW P 4 OpPP# OP( `P Q   Q,p,ppp,<< D0(( ,0 0ʚ;!O!t!c!!H-M0Ѝ0H-M8 M=IP̎.à( B 0Ѝ0Mbp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p 0G! !!H-P T P 0)9!$!!H-PT 0+!/!!//H-P8 0!;!!G-(M$@T < <`$`Q ``` pP8@?P:<! 0`V: 5p <Q  ` P8 p <`V:(Ѝ 0YG#!!!  R/ 00/|B/B/0H-X R@P P6p P@0@4@(@, @@#T0 Mp@- MPO @`V P`q QPpQ   p Q5@SHSU HLP Q   S Q ,  S(PQ 4  S0PV Ѝp@ Ѝ/@-@@SO-MP @TPȲȢPP @@ R D2/(`V P P J `P  Qp   `UVPP/ pLP*H tP% HLpH R 0s qpp 0P   0Q0000P0   QUPH 0^P*y7P3 8pW/ `VPTPP P     `FQ 2/V pWP,1/4P`4`TP\ PЍA` 0y|B/B/!!!A-M Pj50` O0pQp*0 Q  0`0@s Q0  0(PU @F`pPp*` ` p@ pP*W pGp@ PUЍʚ;MH-M  0 ЍHЍ/G-AMp`@Pp `[5 0Აp# 3 VV@ V L ᰀ@ D啒 S   ~ZAލ|S(f(MH-M  0 ЍHЍ/G-M@P` p 0o7Z0 pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ//|S( p/Y|S(A-MM P+2`p @ PPP ,`,$ `Ѝۍ|S( /|S( @Y|S(p@-P|XX` ;@" ` ` YU @Vpf(|S(uYP/@-@7ID @fQ0H-@"Pp ! 3p ! 3PpP03@-@q c2p 2@ #3A-M P`@p  t 3Pp !wv PP 03pPЍi$  H r /Q/ !/p@-XM>PU U"7V)@T @`Q T TPUA @>@P@ <0 8 > "P> *@vXЍp!@-@T B@A-M`V @P P  TP Q  0R p B`VЍ 9Q/@-@T B@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`FP @JPm [pi UZg  NRpR$P  PP aP ZM@T *P @U @ P @U@Tu  T@PY( PX 灠P TP UT\X @` pP \@T\X,LP P [P L[LDo,  U( Q [P?"P $PR$PRPLPH (hMP @` ,\ X$, 0 @R  pp 80  @D/2pA@ 0@S/,CP !5SO S1 >,TlP5TdA(ThQ`P P@Tc!P( $P,SʇCP#:SS S (XPp X (@L TaT@, 帒*> @RX { p !D O!pDL}D $! 00H ` d D@Naߍ !i!6!!! A- MP `P @ P P yP:` Ѝ:UP `  >p8W p8 O P  !00:P PPA`p ``0`P iQ.Q  ` ``Q4Hn(H-@MP @P`R ~p `V pT GP P `V_`@Ѝ xQ/$ /0H-M P@c    00pЍ0~iH- M@0 P:`V 0 PpP P R: R #0`P`VxP Q  Ѝ/p@-@ M PP ` `,PV:PM($P`P` ` (`,PV:$PM$(pO- ( 6@0  00  @W8    p . 0f _X+ P[,@Ks PPA  @h=d<@(P0:`<A80 P`8@ P4E 8`0p4 L4@ Q P A P PP 4 ,(   0jP4P4PP  P P 0 s\P 4P S  ` P`Ap` @R `,@V:@L @ pP ``,@V:@LA `0 l2p0<@  8p0 @` R ,P00 oP (,8@p80XP4 H4ZK4`Q P @A P P2@P@4@@[ U  *BP NP0 IP: DP@ $PM WKx:P [F 4P  P P  @r\P 4@ R @PT Q1 PPT P $PT $PPx Pt[p, (0@Jd` dh⾰P @4hA墥dhP dJ$P W LpP0! R *B <Ѝ؍N#B/!8O#xP W!uU! !!G- P@p`P `lV?@ QZ 0  GGG#*!+fQ/K-PBxP Q @OK@QIKP Q @@K@Q:KxP@TF Z -K+K)K,(VP Y,,PP,(VK40VP K4,PP40V K<8VP =<,PP<8VJD@VP /D,PPD@VJ J KJ` MP T PT@DPH- D0\ CϠ%AˌDq   0+":+ 9!Q 0\ RH@r0 O-MS pPQ`  @+N@0 W]p 0 P @@0pU   `p` Ѝ`(G#~!}!t~/O-4M@1CpPd `P` \0XVyyVyVyyyyyyyyyyVWWWP ho\  Uda^\ ?ZX\vRBp 0  P 0 P 0 0 P4 .f\ ZP$ PPUP2 P P0Ep  `V0P !!!PUP P PE : `s@P p0!p  pp pV0Q ~!\\  0Gp 4@!!!A \A 0p   @V0 R +5\, 0p   @xV0 R K"!!!\ 0p   @`V0 Rw bJ  ]D!Q  Q QhQO7PQD Q Q@@@Q=  Q QfQ5=P p *!0    @V0 R*  0PDP$ ! P  17 44 4 0A; 4 / Pz@P /tP@ T p/P pP{vqhpPU.Pa PxS(|!o! N!"!! p`DLP ?L`P @8LP 2LP t-LP- ``\&LPj L!LP <LP ,LP7 L@P  LP L `P LP KP KP KP KP KP KP tKP dKP TK `LEP 8KP (KP KP KP KP KP UQ  Q Q/QUQ 1p@ p,d a UQH @@ s0 pUP zT  0Sp 4!!;!@ >PB  8PM  2Ph  ,PE x &P? d P9 P P3 < P{ (  @ P^  PX  P oB"  ZD Q 2pPJ\Z  Z~ p2PmUP M43[o!,4tzPwW:R7Z  pPp Q QQ4I WpWPE P PGQ  Q QQ@P Q QQ+@< PP (P P !c!!cT` P Pq`l+B  P$@P4L 'A0Qp P 49 Q Q Q`$P P P{PIC!PP(P P PrPCQ Q QhL#4@, 0 0(08p@4vEQ Q QjE@,0 2p$ ( P+p GP ,p 0 8(  "@P B  P G@PpUpTpBEP_ P PfEE<Z1 0D p    S0,Q! \ z!Z3 , pp P P0p0. + 8,(  P B  P P PlEYCu!(B g@gZ /XP @@Z @W  @M@h  MPT 0 ``` `R0(Q t!TDX  o@@!(H`D! E E K L G GLL!7!!F `V@  P,:` P   -@ W$U ` `Q  Q QQ``@Q Q Q@\HP ښ`P8p4ЍB`$P !! PQ 0 S0S  ,PQ=!RU, ,PťP % $(d@ W@ ` @` ed!J!!!`0\pJP  PPP!!!!"!$!g!D !!!!!H ! !!!!!!!` !!8!!!!D!!!Qg!*!G!?b! o!}!!!!!!!!!! !!>!G!Q!e!!r!V!$!  i!O- MP`p#@"Py"PP p U [VQ UP X` ~*`VU\P @mPsPnP9 rPWUY UUPTPR 0P. bPHUJ FtP> xP@ p 0pp  0@  P5 U 3  ^.U!   0RP P  ^U P U U P X: PpPPU [7 ЍHn(O-MP`_P6 =@.P5 QU ``V p=@W P! `VX? 6P @ EP5  A ЍЍOU `'P P p3? q p c=P      (ЍO?V!b!H-M@PR `P /P p   Q &UT `` pU 7P W /G`T -PT`U -`Ѝx!!G-M`PᙘP =P ⍘P p ᛣP @ q =PPP< 0 >>ЍG !K-@M @P  `  p  (P t t@ЍG-p` V1`@P/P X FGZ : J 0pQ00@T*H Q3/K-T`V0 TpW1 @HH Q Pbqp ||PPPP DDPQPQP3PRPPPLY $0h 0c!!!!@-@cq g@mN#N#@-@P @H-Q# P" gPP# @ ,P ` %TpPn`W9P $$ (03 05!!!n!H-P TP gHyH= 0!P!!0H-P @ PP T 0H0@-P @c g@ 0[! !n!0H- @P PV= PP00H-P g_ P @7@P 0F@ 0[!!n!H-P QT$$ $0 0! !!!@-P @PT@ 0{!)!!@-@P X*@H-T R H 0Y!0!=!H-P @ c_<P ` 5pTP(`Wp@- MQ @T R R! PcoDP Pcl ` 0z Ѝp<< D0(( ,0  0z!!X!b!=!!O-MPF pQH H< @ 8P < Q`TtPP PGP CP V  @VH0t00V td\ 0 &ЍHH L0 44 40 !.!!! !~!b!M!!!!!O-4M@P$dp P XX!$8`a2+P $ |bdP ̠$`  pYT Q  P P T8pPP9PP`P [YTcU|X P|TTQ88oP3  P ^P P P}P \P TT R8 8<PYP XX3PxxQgpVP xc_ P; Ȱ` p`PP*9PP& PT P   #p dP `P 9V P p@`P D`l lpP$yv4ЍN#N#!!!!!!k0Q03Q/K-Q TPp Q 8P @PnW>W+ | |TTQuPttkP88fPM ` p/P+ @))P" `tt TTQ88DPxx@Q o᠒l pP `^ pP @Y Dn@xx@`$$ $0!|"!!!!!!H-P Qs/ 0;!Y!g!H-P Q_/ 0Q!r!g!H-P Q QoD/ 0}|!}!g!@-P @Q QoB)/ 0a!!g!@-P @Q Q@@oB / 0E!!g!H- MP6 @PP 0@_oP!PU ` eP `/PpP `VP ` Ѝ(( ,0 0'B/!!!g!K-PP*~@.`DTǁ `YiT d\`QP/ 0nB/!!!0H-P2 @Q5 PP QP P 0Q QQ0Y/P@o!R1 AR #P 0H@0$$ (0| 0iw! !!!H-@PpEUa ?@WgxUȀe7p@-Q( PR+ `@P P pQ  0p@ 0 p@EH 0vPp(( ,0{& 0_!d !!!"H-P Q!. $$ $0  0w!*!9"g!0H-  @PwQ0N#P 5!O-TM @PP@tpR P P0up@@@@uPU A`@?P: @PUPU @`@?P:y @PU ptj  0PPtU ZPP TЍG#xG#G#G#M0H-M  P0 .xp @!9p@@Ѝ0HЍ/G-R'P@U`  R R* R/ `PPPpV# P* ҜP a ZpP dd d0DYE R  @T:q 0.=!!!!H-Rp`@PWU H0 p P `p``P QH RU p`T" }!0H-P@p 0H0H-@Q pPWP @QH` PP5PU:X!f(A-M@`PPPT  up' p P$ !R* | 0 p PP ` p1OP ,' $$#ЍA QU p` !EqPUЍ P PP!p0S < ,Q >0$ !! B!M!d!r!!!O-M`Q @U 7yzMP P;@,(('P p c  p Y  |p p P% P P P P P pP `PY 4 Dp !<p x;@ . PP 0S  p @ |p DP Rj᭜ps @Yu   Pok,%,5   p` H0  e%S S pS D pM L pG $ pA  p9 LP pM0$p ` p'  tP <p ;@ !Vx`V# P P   P`@Ѝ`Cp D `Rphtp  P `  V  #tp T tp  `P6p dP/ 4|P& $wP! rP mP hPn c!P PP_ P[  !p}  pw %P  pm %P x`V v%P`V 8pU  pM PP 0S  7p9 @ /p2LH &L !(!F!M!W!t! }!!T" !!\! O#i!u!&!{c!!C"!!!!!!!N#! !!!! !!!!+!A-R 0S P`@8p p 0S@Z8@VD*p^ [A @@@ .Z:p WA @'*^^@NY `Z:`^ ^ N KVH"`Q V`FЍ:774O-Mp@QPh2 @`X2y[ PkJQp a Q @YQ& \Y PJ \Y!V< WW\pG`5V/ WLH! pG)" `( P /Y YV W50 )\0!00 0000pG` V W! pG``0@ U:@`V W  P P@7@ЍJ Hn(A-P9 pPW5  e0`.Wp@`.W&,W W* W Up\ 0 -W_W  >Q0p P MpGXp H"pHn(H-M`P @P pRW LP p-M0# <8 W 0oЍ8!R!O-,MP0 @ \pP(P  0dp P P( `p P   0 p0P"L  pG ,`Y:(PW} $`    08/P(,`Y:( $0p8/PX (P $`  R 6 Q $S 0p(,`Y:$( $0pG(p8/P'<$!p 0!pth 0,ЍO&L@W 0( '0,Ѝ!P+ pF`c   " P `hp F?`> * F?`Fߍi0H-@M@Q@8 @PoQ Q@Ѝ0< X#H-Q  RRL` 0& $H 8ii@!!H-M 0{Ѝp@- @0 Q*P`E``U`@ Tppp@-MQ @P P R xЍp@w4P5PIP' @)/$PU ` :x@PU x@T `>P* PP @T@ЍpQ/@-P@@@V@-P@@@uVP/  X#O-Mp(@@|$@&P\ @t] PpTpp`  06gM p<pP :pP   p- Q'P$ (`   p )  p  7/P$  p $D#P 8p  (@Ѝ! !fB@lB!O-M`P    Q4:  0Qp@T W pPP uP   @ 00 R :   q ЍX#H-M0  ЍgB@- M^ *@ @  0a  Ѝ@-@  >(@;(@-@p  p  p~B G-ZMP  x Y   : D   d`!. ZߍY#Z#gBxY#Y#K-Pp@`\fQ™\ r崀`T 0R ,0TQ ?f_™`,p V:T 4` 0fP,P@TY#>!8!@!O-MRpЍ@PU.* U (p `p!W*P%W Q  7PPdO  0fpp ZO  fpz(ppp"!!G-MMRp @`0GP P Pp  &pPsPЍۍ iPOt [fPp XpG`W 4(p O HfpGp%(ꜧ @-MA/( R r@Ѝ @R S 000P Qp@DTD@O-,M`P$  h  @  _@  y0XP 4ou 0HPk PP*P`JP=`p  Z8PP6@P4 Z( Q( K j0$p t$ ( $8  P`X@: ` P"P ` @v hXp T`Y@ !0PP pLPJP `Q( # Pm ( Q   Q  Q$ t (p$m8 j P`pW:0p QQ 0p$t@P- 0pP$ p P$($ P P( % "8  P`W:`,Ѝ p!t!O-M P崀P"@40$5P $Q``pW pWJ M0l  xp P" 0P` $Q:` `jM0  ^p 0  Up P" 0P$P MM0  Ap CM0x  7`p 0lP p$`,C$ 0 `p 0,P ,@$`%,  0 p @Q b@L,`@T:A{s R @`9,`@T:pQ lbp+,`ppW: Q F B`0 P1 ,@`V:6Q pW Q, P" ZP X!(p   0@}P(P:0P (" B0("   0P! @`p㊿0P0P"  P ("h0 0  0@`,@V: ߍH!Y!k!}!!!!HO-$MQR @cPPSP Vp$ЍcP,H Pl  0 p YU*`V VB Z  X4VQS0V   `W 0 QT"P  BR    pP   H  0 0\P rW~0H-@T P  PPPPPP@P*"02S @"PU 0S, 0 00H-PU @L0@-@\Q \W\@-@`q ``H-M`# 5@p4 P0 ppp% 0 pp 0)p   V  p @Ѝp@-M`@P5 0>hh \P  R h0@ P L0DH   K $ Ѝp@L!!!!xp@-@`hP >P:&֢Tx R RQ TQ  p >P:  p@!@-@A@] xp@-`V @@PpPX 0$J 8L p@]p!|#K-MP@p `$PH` " 0 `` 0  0  *@0`PHvH V  `z0`8PG PK:j @   *j@$NJ`(0p  Ad$BJ T 9LH0:HP[P hI 00RNHЍKe$48J  j@   4P 8P  @  * @  PdQ Phq $I 00 P<PPfH0p 4 1@8 1@0 1@4 80 48@P\i`  0. p(h`Hbi P hdFP ЍKNЍxWyI 00D Q8@??!6!=!Z!a!!!!$!i!W!E!A!O!H!XU!!!!A-MR @`  0Q 8p0 0S  R-  . 0P Q :  PN } 0P Q:3 P 0 P:P 0| P;P 0q P  60P Q:Ѝ2  0T!!!H-@ P`08 l A\ 0080L<c u`Hf!!|##0H-@P P Hi$ hhL0HI!F!!H-MP@`p: P P P dp` D0 @1p Ѝ,uЍH ЍHl$7!]!K-P`p O @Q$   P":A  P  @  P  0   xP d &P  0$ ` KL :4 HK K!!P!\!!!p@-P`K@P D 0Q 0 pKpcSc {Q0S/080 dQ Q/ !A-`@VP 0Ap ,1 P i P P<P $rG iu - 0Py Ps PPoHPP hPdP[  $Ag!O-YM`Đp@R L@P@QP1P}PLP屠 @,Pn  W/$Pg  W.!.. R 0S  R 0S xT0@   XT0P`p (P @  R?, 8`h4P KKPP  8dP GQ* W8 (R8Q cR R SRcQ8h (> BP* ]0`  Pi WWU8,PT0S @$0(S D`VW W8d R 8h``S 2 8$(00CS*0 8`0050p0$0 S. D0S+Go <0Q$ (AQ:8`6< 0n8 F~ ((!Q= ;WW 0W(@P*8  00zDW  0`DP}W0 (@P:20 0 0`YW 8`W4Q (AQx:300(@Pl: 7` 0QK 00$ + ` 4`  ` " `"4` `P` 0 `W :R $ (` V3 ` $ 00 `,0P:(AP+0 ;0o$0l `P I h6$P$ Pp`U R: ,P+ 4P `PP0`P& ",P,P `"4`PW:P ($ P 0` l$ 0` ,0\$:,P$04W(@P:9? 0`p0DP 4Y (APM ` ᶿ08`(P (AP8`=( ᠿ(0W0`   4WDP (APd< ဿ 00`P :4 Z (@PF:0`P0WR  M 4 <CP Q ` 0Q7 (8P@f`P,P 8`  40!`( AR 0QV 0` C  0 ` 00`PW  DPC+JPEKKhP[ `ph p8`P^ ,`  C 8p PSE ㆝w@ C\P 0pw-`  *,P2@P' !: 3 0dP $` 0 PPU`P ,PX  0@Yߍ<`P:!.C$P!+C$H! Nr / @,\X@<R8HNDTPL@<< TaDp R{K(APp 40.4^!(@P:0`t0!!Y#!!cSc"!!N"!!Y!K!K-M`pP@P P 0ЍKipG ᯱW:@Q Q ЍqW:<Q:Pp R:pP P p pWP C 5P   `    a9 ov4P0q!A @!!!H-` P@R :Tp `B0 HpPd!@ 0H!H- pPP @T `dPB0 HHHQ \Q0 H0 H!!O-M@p xPU% `;U PQPUT P> R* ^P( ; 0Ѝ!0H-@PU `^ \(ZX@xP P QQq ap 900H-M@H PX P  Rk (>P: ' P 0+' P P0    }iPZL @  +S00 @Ѝ0Ѝ0HzD!\O-M Mᴐ @(P8p< pH PUP P`i`H 0ȀpPp@ ((q. `DQ& P(  B1p 6 @Fp3 #pЍ ۍO~  N>@tP([ @(((> * (P >Q 0*< ☯ 0< ␯  pF @L@2 @@ S! ` iP'   0 ; g(taP( (((1pt!4 Ѝ ۍO +P+Pp U$ PP   ;@  50\AP   ၻ$P PP    cQ0S0SS 0 PcQP 0$P 5@Qi cQQSQcQ0p i P Py cQQtSQcPo l@TP LP ZP * `EP PP cQQ}SQcPx$7@ L . : 0<A@Qf k2c \( P `PP  ۺh dPh{0cSceSPcPhe    .d@6 r 0 `0 P0R  $@ @@480 BAC0 48\ $?  ~Ѝ ۍl0 X wp57!!t!%!L!b!!v!f(!! /!ҽ!!!$6`5!!0H-@0 0PUhP00Hy\O-MP@pWQЍP PdPd  0oPd  P@Q P;崠8< h $Qhhd@ P  R ]Q $'<HHP P P? `hy `{P P  0 Q 00S A AR:3   `5!6!!!K-M@`p P P$PQ6> i+@P-  #PP w 0UP Hh<8(! H0 @Ѝ hhFN!! ?|#0H-M@0P Q  RU 1Ѝ0 "#p@-M`P@\P Ѝp @.P\ 0 P phheP TTk@  P@%7!u! W(h! 4G-AMM`@Q\P  F p ]p 0 `V\PU  P $ NAލڍK!! G-hM M TX pPP0`0@@P  XV@p XX U `p ThЍ ۍK!!RQ:0AQQp,| Rp/O-MᴀPPT@1P> R *xP  0ЍO P (L Q Pf0 q W 0S: @^= nDQ  0Hv a V^ 0S:  50P Q  Q @P  yP P  p@h$ @ @pLP`p0  0PPK`VP6`@K   60PP@\5 @< ЍOP`00  0P{PP6V`VP l 0LPI  P PA P 8@  0Ѝ@ T  0  2P P   P : iP 5兿PP < <Q 1P P@P  0%`#JPK? 0R 0 J@PP 0 =  P `  b\T t i 0Q @4RP} PPL P ` Q Q@ QVPM`@`$QDN   60PE QB:<@d 0 P hh  02 ۾) "P)   P0nP QZ Q <`:   P0RP   : 0 6 0  Q*P A  P\:>! 0᝾PL ( R h1pX! 4 RP*y P   P) 0@k v^ `l m H偾\PP!!!?!V!!r!!!!!!!!b!?!r!/!!W!x 5`5Q!!!!O-IM \pP 4HLaP p` X! ;lP IߍO! P @at Pj ,0 60$@@z$ oR003p 40@l'P $ R ", R QP ,@$`%0 P:Z   `W @@ ` P:Z x@dX A P@0 IߍIߍO!!_ T!!!!H-M0080 PP@UЍ`P  P  p&@0H-0M@: 0`P P ,,P    ,3: l * 0P 0M;0Ѝ0!0H-@, P' !L 0H! `5 H-p@`PQ ^P P P(  P H տHH!!0H-@0 PȿvhLh0H!0@Pop/A-`@ P:P qP@P fP/1q/P /Q/H-0S ^ Q 0 SR 0 S QQ/ ,03?#R/Q/@-x^ 0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUp @  P ĐY PhP dPa  Bd P PS `d|Hp |Hd H 9 P$  P" p8fP2P%  `4N |  ԭpP }p  $  GP Hp`Hd8dX V6p  㦭P ` |xp |dXP H  ㉭`P$ PUOH⠫ uP P. P* 8 P% `p @oW W  P P < 0  # P  PĀX  :P$p <`5$Sh0`O Pc pttXX  8 `X`dxQ XSh06 Y` P `FH VH P `Hp3 ۬`P5  < tk5  < } D`\Ѝ 0*ƻN#b!c!s!!!p@-PE P$  @po1P kP gP cP  9`V  R 0S `Vp0QP    U dPdh 0q! !b!9"@-Q @b P  !G-M`@pP# PPPU4< P P p  PQnU`Ƽ@MT  R PP 600@ Po @L$  `p㠠pq6  0H"p  PP@ ꤼP 88|@ cЍ!!q| !!K-M`pVo @P d$P R3( ,0 aP  h d  JcPFPPU E=hP dPH0Q RQ PU( Q,Qh  XQhdPPH塨pЍ!9!PP    Q/G-MPPU @ `xq 00  0 PTЍO- M0@< Rx!R P PP p`PP"Y Y V' P PA 1꺻귻 ЍV P PP1T= 0S; Q4P5 ` P` ` <500@ Po mK[P: `Y ЍO. `` ЍO9!T!@-P@TQ    P@ p@-P= `${\< 1 Q(  P:Q0`Q 0@PP@\Q @ @CQ:Q`VQ`C`Qp8@P p pB/B/Hn(B/p@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0  0ЍO- P 0D@4,`V Lw4pZ@(pPP `l` SP ,(p04 P  = 0 P~ @d(P :PH8< 0-`<8V vev :h= @P`VD L@0S@:S0A0`Q4:V:0(0 AR (`40 Ak  Pc 0(04 A` H A F  `Ρ ʡ8[ L= K4@Pꃹ@K @! ,P  = (0,P $ HA[ i P ) ] ` Z `<Ѝۍ , @P i  ,P a8B/B/W(G"/W(H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P w((( 0000p@B/B/B/B/@-8@P v  0000B/B/B/B/O-MM``CP P R4I Pq sP 0SA  "0S P   AQ 2 000@:R#RP\@o"t `P @Ov  Pq IPq P Q ` QjPPpQ\Q ŊPQA:Q @]v T\ `@: P90 Dv+  R :R|R   0v`P P $v` d`PЍۍ00S\S000B/B/!B/B/Hn(B/K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `WWX@XHXpqP%mRb0BS`WWX@XHX:NR RR TR nR rR tR     @Ed P P EP P }  ~P  < PA-= wP- `dP* Pcpd R:R pd :@@ZP d`dP@` wd  eGP  7 dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  PB/B/@-<@< P GPB/B/! O-M8P R`$$r & UZ  PK oA쑟` 3P( pt[ ᇲPjfP  P J Q   P Q  @Pt PpPZЍp0 p+P ,P S 00P P P S0RS0B/B/B/B/F/H-pS 8@ P ll@p@-@8P  PG@DP8`8PP tTppB/B/B/B/0H- @ PPP sP0B/B/p@-@ P  P@DP8`8PP sTppB/B/B/B/H-PB/@-@P@B/O- M`p[ pPP[@ @P! X P ႱP P[ X Q UP0@0``P s`P ЍB/B/B///////@-MPPP <4@ 0PЍJ/J/8J/@-<@< P N\FPJ/ RNT C , ]ЍN/\N/N////O-M4P Ѝ $Cp 07/   #p07/ # 3c@ P2Rr"T` 2U06/"2b@ 0bPS2Rr"T` 2U06/rRbR PB1/! @6 1 A葟ءL 0#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X PUP P P,H AqPV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R \``ЍTUU(N/A-M@``>Q$A QA  * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ $]?P^ {P=`0P*0,Q < (0VP 0 DQ* }R X g. `A $  $ zPh 0 @-0  @&0@  @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP  8 P  }RP P P* *0BS p`v P D {R P*$ЍN/Hn(K-M @\Y  P:PH```JY0JIPA0DDDDDDDhhhhhhhhhDDD/y`qPLP  O$  F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0Q @0 F @Q*\S{Q $YЍR`0Q* 0,R<Q*X :0VP  V RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n N/Hn(@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A ЍN/O-4MP@Q * JP2  JP/ @  UP  S00@C <P* ^R 8 P*]Q -Q- P &  ] d0  $ 4 Q }*x0]Sy  R*-S]P$i-S! [S'R%* =R9 :R Q:P ]R-RPP KjpPA*0-S=Q;* ]R8 -Q/-`.Q:P]P-PP=p PJ*Q* =R]Q P'`W Qw:\P_:WP WW w  ppQ PW TP 0!p`PxuQ*x50 `@V:P  ᘒp p P> p WP PIF!  p`PP !  pP !  `~Py ?yQ:fP`6/P  u ,PuQQ`P pTP 0  P\*P* :R]P  PP s P g r0p00B^NP  - Q|*]PwP{8 P 8< Q  P  0`0`&$PxiU `P P ] PS `P`` P PV`pP x P`{P'wP' w? (p P@@@P  APt4Ѝ,PP  E@#4ЍOPP(p!!N/Hn(i#k(@n(# " P>   oPp  hPpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ Kf N/H-q`@PPQ  ,( =RP) ,( ,P<P 0Q< Sr1`` Q  Pr0P  k(N/@n(# RR: -'R:0TTT\\p >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  x,0  X:  ` > g,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$Fb,0P pKZ-p`P0 -,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$ b,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [:a,0P $PKP#RR>p&A Q llllll$DdR p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpTT@HhTTTTTTTTT ,hTTTTT2 Q@  0p@ @P> @ X:} P78L8>S 0ph `Rd\cA^^ p @ :[0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00Hn(k(@n(Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q xHHxxHHH\H @R p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp|00$Ddp000000000D000002 Q@  0p@ @P> @ X:} P7  (      >S 0ph `Rd\cA^^ p @ CU0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00Hn(k(@n( AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ k(@n(#RR>p&A Q LLL0R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpPt8DXh2 Q@  0p@ @P> @ X:} P7| | |   T!>S 0ph `Rd\cA^^ p @ O0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00Hn(k(@n(Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,Ѝk(@n(HQT oD o , o o  o o  o o  o o  o| o d oT o -ЍaQ P m P = T. P B &P } b O-MPQ`@T P p P P nPoPoPa@PThhhhhhhhhhhhhhLh  }P  }PZ U }PZ T }PZ Uhp x}PZj UZ< j}PE ( d}P?  ^}P  X}P  R}PhZV U4 D}P'  >}P!  8}P | 2}P h ,}PBZ6 UZ UZ UT13TTTT TTU  Ѝۿ @ ˾ M L+}M ܽ FM L _ L 7 ' p@-`M`@048<@D F?P@@@@:ހ2 0P p$ 0H ᴀp ᥀p  㱳@p@@@㷀PH 㝀뱀P寀P  㜳멀P`ЍpO-DMMp@|"0B| @ @!y PB  " 0! <R5:0V/ `wvt`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp {T{@P3/H%P  BP  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻxP7O-MT2PXPP@P" p P. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@P   >P  >P  >P hP P @.P@ @ P\u@@ddP`T q P Q$u$Pp@qP QQ  =P  =DP@  =P  =P  =P d =TTPP | =P d =P ē P < =P $ =P CP  =P TP pg`@sPAp l=P P e=@SPP @ \=P ( U=P  P  K=P  D=P P  9=P 8P sP@WpP` Q P `@ApPJ Q P~ P\{#! 0 0 .R R  @P`p 0 POA_PJ @`oP Q> P9P P 0P @PPP`PpPPP P# dstdayminsecPhf>%  t< <> y > A A ߌ @(BH3 me Je & @ ύ f ff ' B +  >0H-PoX @Kp 㰧㭧㪧U:ڦ00at PP0 0P Q/0P  Q/ /ᬑ ]0H-|| 0 @ S@ P   P @PU UPP@T0 07 h]H-H  P 0S !  P@]p@-t0l0Q L F P0Q P`VP  p\H-PP @p PP `QP`H-d`@`P p `P PQPP[H-d`@`P p `P PQPP([O-M`P6 PP5 @p`P  P QaP{  `pPY W ]e Z`P Y```nЍ9 Z H-P@Q p`)P `Q0Q  FY(K-MP@Q p`P `QQ6 Ѝ FY' ]r apPpPPPLrVp!"PpW Qp  07/Ѝ8Q$ DYtXɋ Y YX @-@ @O- M`pPP PPQCPY @PQ P G L `$PD `nPoPo@o`=\dP PPQ gP Q0  HQP S l`P DP vt@ Ѝ 1y dV ~ O-MMpP@q` ZP: dPq  ZP /P P イp d⪽Pk -<0 ppp]pe 嗽P| p0 ]pT `zP{ `尒  n`Pn  P 0p  ᦥpv @ lP$Z ^E 0~]p#  f^2p` ^!p`p ^pP/gs w^p`p` j^p@ p`Ѝۍ 0|p ߣ0`P  {  0`pX  0 `zd@~ : t  s ]c % b e: A: З  u> = H-M   0\pЍH-M>   0\pЍH-M?   0\ p ЍH-M8  0MR pЍ蛄 P  / 40H-0H-@]PP :p? $  0(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(408 0@S4 0@P4*# 44P*``404 R*>(4 8 0BpS4  @P4*# 4 4 R*p4 @ P@p(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(04p8`@Q4 @P4*# 44P*4 Q@<84pA 4  4  P0R:X @4 Pj R*>0 k04 R*#004  4 (P4 80pBW  @P4* #004 4 R*004  0R@0<08 4 *04  R4 $P: #  @P:  R*004  R4 P: #  @P   @4 QBLЍ%#jo%juH-M00YЍH-MPЍ=O-MR @ `pPJP/<]aP D  0Mp4 ЍkkЍܠ P8 PPP   0P p-pjP  0pjP jP8  0 Ѝh x"  x? 8q   p@-MP @0`0 5/ЍpK-MMp `@,ᷝp P/P /daP @ Q$  P ` R _`W Pp   PP00 PPP|jPwjOЍۍP O-dMMp P /a R: rRP;Kd`+WX  >>>V \K V  P VVK ajY P BB`qV P >>>>||||AW ˼P nnnnT aT 嵼P  AV 埼P T B T 刼P hh p?@ hȠHČ pp`p P@ P @0( 0 000h 0 00P00

Pp\0` f`V2 Q1 p P @kT,@\0  V 封LP:4P0pȮP   pW   Pp\0 H`P!!rAD |  ?p , @QPJD$喻,pP @pCPA!X!F P ADX   P PU`,   X Aq P:P`cP  `V    H`  HY `P R 0'ACH``PAD | !  &?p ,H PE U @D⼀d$[@\$DpWpCPCLPpUPC@`H PCT@C H UT4``0`W`@ PP\ph4`pV,APF`D |  >p3 ,H PU@a @L`8PA PP VP`p Vd,PFA`D |  >p  d,H P U@a Q  `Q`800P \0P `䰝p,`KY \`B AXZA`@,pd @ T5   P PU`,p  T డXP: PIP  X    T0 `VEg\pW QD<   P @娲T`,` W\[:P @P^  @T  48qL` TAX@0ZG`,@di Y: d q PP @]T`,@d YdడXP:TP@㷬P d [    8P0P `V4H`,ZI \`开 q, @HXJ@T6 Q  P `V`H`, Z X:\PX`P  [   ,LPJ `唰p,`K dgLpW5 dQ$   P @崱T`,`d WdL[:P @Ph d @T   0HYZh `l q, @K\X 0,dH`I@TA dQ(   P ``V`,d YdH`[: P\㸫P d Z     X@kߍ`@xXp@-M ,,`(p@0p 0SЍp `Q/p RD D  <0($0 0S ?@H/t  4 P/q RD @  80($0 0S ?AH/p   P/p@-q RD  XT P 0P 0?#B0SP \H 0 Q ^,@PA@@`0D```PUh``@2p < P/H-H L0?A00S 00ȠČ0 0̠ȌS Dl  O-,MPP,Ѝ۷P |80Ip$p 2;`ɷP D V P `Q: PpA pW ` P㦪P V ;P! 0p ?c00D |LW0H0 u;/;PQ``VP,@PqP@U  F; y,ЍDp@-`T@PUPpBPU_@pp@-PP`@Pp*P=G@pH-Q$ H ?30000S 00840 SX0  | D0R 0R0 0S 8H-P$ H ?30000S |00840 SX0  | D0R  0R0 0S /ḓO-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`pl mTpn`PPD\ 8pЂT X0 0p`lmn Q T(   MЍ|X|$$tXX|\A-MpPPHPP J`\P @ T  ``> /`*pި`zPY t pU npP pQhPG  0PPPPP(P:  0PPPu(P/ p+ $p'  0`(P  'QLHP =P  P q^PpW Wp@Ѝ |4p@-@ PP T^(`V (V`&@ح\֭Qp@ͭ,A-MDQ+PP- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0Ep!!QЍ  p 11Q/K-M`pP+㵳`(P UpfWP3P^ >㙳<㖳^㓳v㐳8#㍳:㊳0'ㇳ#ㄳ #H#zp-u-p_k|gobp]brXvyS/zN{IM|E}@9  H  %, 0!<+6>:600/ !C-:0 C?* ;0.E?* ;0N/O?* ;0.*%<0.0*#<00,#<0= !> !? !@ !A !B !C !F !D !H !/G?* ;0I !%.I?* ;0J !/M?* ;0K !*.K?* ;0L !/0*%<0M !/*00S !b/0*#<0E !v/?*:0G !/.?*:0N !/e0*"<0O !M-=0P !/&>*:0Q !9.*0R0  R 0S  0 S pW$ s`VJ1`1p80Q  l0 0OD`' p'~G|||| 0( Pp Ѝ'o l  \H-0' 0 ( Q(      /ᴛ4O-HZ p`Q "P !?>`APQ0H P P{ p @`v @@ KQ f p  `!>0@!Q QJ q" R R !0`Qq  0'Q`Q 0 pxAT `Ta  0 `pdQa @ K. A7Z Q "P  P P p9 @E`vX @V@ KQ p(  `` ?>0 B!0 㴯p;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!IQ0$hX" 0O-M@0f  P`R`P KYp|0 R  L Z 0 R LPm E( $ x!R  Dlh<p$( BP  ~KTBP  rPC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj I☢Pd P``p$V <P>HPVHxP P`@`p$V <P>H@PV 啣@ T [  QPEQ QP E W QP~? @ pA `pP _P \[ P TP#  ZЍ\[  QPP@YQPPPV QPQ QPP @Y QPP P PV ~QP( c ! |l0H-L@bQPJ 8\QPD #HQ08 QP@Q8 P  P+mQ,P P PmQ! 0 A R:;Ao0Q 1 A R:;Ao@;Q 0A P3@@00   @-"TXl@000  |@' ,0d@@0XL@ 400@VtP<Td(Q/  X/p@-@P`` V PJpQ PP皦PU唦p@葦O-MM@PPPT M,P AqDD!D1 0prppp P 0 "pPU) aV 3G W ,B )GpPHX`  0"`VpЍۍ ̭?ԙ O-M@PQ PsPp8$Q  BQ   BQQ9&$ P "P  0 P 0`0Q 0`01`N  ojQ @85LЍ Q  A AP ̡P or8<Q q C Q) q-(p J P@ x!@@; SP7P3 L'jp  <PJp >P  XYJ X PO@`#{<\t@- (@\:p @ @-@Q:p @H-M0< R    ЍHO-M(`p@PP U PJpQ Q 0Q[ЍK-Q1Q+ ZY# Ep@P@DT P` 0"`Vp 0 "@K-P`p Pp W PJpAP P QO-M`(P @ `QPMU VQ"V Pp  ppp@ RPlP PH<|  @[ op^ w  !΂20q P( PU YpD ǽp P wd U Ip8 @< ?q#BH" @" Q5! !@10q! PQ p RJr0"1pW TpB0S 10Sp02\XaXq ?#>pq`B4!Q p@ QPPojPP xp|`Ѝ|| 0 lDQ4T||H|,|(||T~P~ }}l|d|4 x{T{d{4{{{p@-P@p p@@ QPLPojPP 0(Lp H-PPQ oj@ S pWP 00A  Bu9 @H-PPQ oj@ S p%P 00A  BC9 @H-M@ R  0 Ѝ(Q/  T/A-`q@P qppϠPB PG      papUqP UP , Aq@ll0L 440 8CWߩR D V % lO-MXK ,  1!q1saqQ P `V EP j W*  0sp Ws: W`D0H |Z-p ap W 0@ !ЍЍ@- (@6p @@-@6p @0H-(M$ P@ \(Ѝ0,0H-(M P@ O(Ѝ0p@-(MP D@6p `q :(Ѝp(Ѝpp@-(MP@6p `] &(Ѝp(ЍpH-M   ЍH-M@  ,00   ЍH-M ,0 0 1 00 0 Ѝ0H-MP `@i6p  ,0 00 P Ѝ0Ѝ0D0H-MP@N6p  ,0 00 P Ѝ0Ѝ0(Q/6 b @-D@@p lm$  0@O-M   @LP oFP  PeFP Ѝ6*0lm0hF p 0  P, 9PЍ4h@-@= @P l 0 \  /*4 ` 01SPP@-@= @ P  l?:X01S6 ` PPHX\@-@= @ P o t Q 0OS*` PPA-,A=~z@ P D _ZQ8 ``: P - P  08 PQ 6 0po8PQ*P8` hP@-@= @P  R  "+ 8 PBPp@-@@PP%`= ` P   P  0oS*` PP p(P8<@8p 4A-P=njPQ z@Q$  "+ 8 PP Q v@Q  ,-  4@-`@=@Q [Q  ,-  PA-P=njPQ ?z@Q$ @BK@8 PP Q !@Q  ,-  @-L@=@Q Q 0 .G-`=P`Q @ Q+  @0p,@-PP@P@8 0pP5P Q  @Q  ,-  H-4=P XH-4=P TH-@= @P  R):d@ `H  P t PpLpp pppP A-@= @P U R dP0@ȀplPdp<L 0pLl 4p0pP0P8@-P' @=@Q Q,@0A,@A1@0L 4P@`ĿL0H-P5 P=@ PP  R0 T,  0P!, ! !0P!, ! ! @P0PL P0&P00茿4@-P' @=@Q Q,@0A,@A1@0L 4P@`H-M@ P{?mQ DQZ QP1DQ块PP@DQ 0p  tP P0j5 0 b5:  < 0 0U5PqЍh4ܺ=P/ᬼH-3舼H-L R ,PhBPdH-P  Q PbP( Rs3 /ᬻ( Ru3 /x8 0S s3/D,/* Ru3//*/p@- M  P@ ` ```} `` `}} z} ЍpA- MRPQ =nj R Ѝ Ѝ PAA@PIP CJp! Q` 8JLDA@P ph$ 0  Bp6( qp|P  o5P: 8  c5@@ [5 XU5> 0@p @*PtP Ѝ]]]l]T]\]ضA-Mb=`Ph B@PsIP!   Ip`| P=~p QP5PH@@PQQ  UQQ  J P@  P/UЍp00 R/* P@@H0S 0PPht@[[[\[D[t@-4@@P$HhYdHY@-(@@PHYY0H-MP@ P,P }p PQ \  TLPP  Ѝ01/Ѝ0ht@Ĵ8|XH-M`P ЍH D   HЍ4XWWH-M\P H<  Q, HЍWtW\WdWH-L= R ,P@PH-8  PP謲H-4 , P?Pd@-P xQ |@Px@P @  34/*@t<@ȱ/0H-P PQ @ Q Q00tQt0QL0Q 00  t39<0|D @-@ @P P P tPl P L  G3@ <$ P蜰hDhH-P" p8 ^8P, (@0`P0``` 0CV@`V0PpW0H-P ^, 0( P@PPP 0UPAU^0P/0 S/,/p@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V P  B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pQ  R/, B0BR P/0H-^, 0( P@PPP 0UPAU^000H-^, 0( P@PPP 0UPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-QQ,0 (@0`P ``` V@`PF`VPQpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^, 0( P@PPP 0UPAU^0P/  !hBP/0H-PX@tQT X0,P /*P /p ,P ?:P A/0,P /*P / ,P ?:P 0/ᴧ,P /*P /x 0P ?:P 0+/4@-tP MpP @pQ 6@0tP C"t@0P /*P -/p@ R Q/*0S/ 0/0,P P /P P /H-<P P p H"耥H-@T& mpP @tQ &6HN0tP |Q pPpp|PUw tH40 lO- MPE ZCz P=S;p0R@P @pQ  K7`p 0PJ尝P  `FPG]P  J0  Ѝ` ,P P /O-MPpW!  K`  0* ސP  0`p   0zPP WЍ̢p@- ]P >|P @`B|`0@V;px& @P@|0P Q @XPPpD X|$pp@pAp<; ;dp@-@ P P P``0PVp@G-P @?zPP  X ` @ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`npP `VO-M  Bp T P  [T6`p 0᧛PBJٜ [`Fp P bP P P(@ PJ JP Q P@U  BJ@W  7 J@Z   B @ЍO-TM +p R TЍ]p!R @ 0 t0-4TЍOT.tATW |! BR8   P,`5 0TЍ € 1,` `VS@4p  |pʀY`t 0@ 00 0Sp p5 t1 Q 0 0-+p # YpG-` PPp @AAP@Y ZXT  P@P QPK-P pP2@ớP+`P:՛P$JћpP $A`V(AV QX !`6p媛pPV 壛pPV 圛pPdH-?Lp0 S @ 1  0  謘PL 0H-@P  R"4P PUX P R 0P R 0 0R00ؓ0֓,ԓ`Q Q QP 忓ὓ0H/$D  R/P@0?30Q/@ 0<( /P/0Q@?R/@0</Q/ lR/Q/ @4R/;R/p@-@@P?`/pS/p@-P?`@pH-Q`QX =@ 80 0@08 R($( @ P@-R0SX-@ <@ @ 8@THD@QtOX0H-@PU XTP@? @<8P@@'080H-@PP XTP@? @88P@@0p@-Px @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP B  X0m@ 0$`0 @ 80S@pp0H-PP @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@     08Q@ @00P@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQHH-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQ耏0H-@ PA2 0HЍ0H-@PR J 0 P  S )2 0H0H-P@2 0H0H-@PQP J P  Q 2 0H 0H-@ 8PA&p 1 0H0褌0H-@P1&p P J Q  P01 0H0H-@P&p 1 0H0p@-@ l`P&p V J P  V p1 p@{ꤋO-MP@`p,>T'  㔀= 0 ᠀ @D PT  0ǖpڔX Ѝ O-Mp` 0P=U(@ 㔀=  0᠀ PE `U  0ቖpڔX ЍO-Mp P@=T'㔀= 0 ᜠ堀 @D PT ` 0NpڔX ЍH-M 0 0ЍDO-M@ %p2 p`@=V) 㔀5= 0  ᠀S `F @VP 0pڔX ЍO-Mp`0P=U' 㜐< 0 ᤀ娐 PE `U @ 0ĕpڜY ЍO-4MP, A\pXaQ  @QB \$YIP˖PK X@PzvPX @X`   T@>U8`F  PV p pc `VTU8P   :ꗖP X@ T P8P  !p aX@T PpP' 0 @T (0 pQ 0 Q  0hPPf @Uq, D0|@0縐3p H LPEpG @U(0@   X@QZCAZNTQ8P % (0  p0S0 RPD|p HLP`P ( 0A@p Q0@ TP,X@` (0 P P  @ xtH0HSD#P0ᰡpP:Xp@@ P㗈PN @pW@ X@ZPpG pG?PW P  Q%Q{ `Vj,@pQp_D|pIp HL `!PVMP[PT R 8P R P P@( 0@ pP0@ aTP,0( A % nPPP Q `E@(0F  Q  * P4Ѝ,, a O-MP @pP H`Pk\8 Q A ЍVrXTXP ,EP8  P  ,Pn:Bp@㤰d: 0ⰰ pG @W ڤ 0 `1pڤ[xj @Q _ T P 8 O Ѝ, X? @`3xt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q HLP/88!R!RQ@@/yzP/48!R!RQ@@/0z<Q/(!R@ ,@ /TyyP/$!R@ ,@ /yLP/X-(!R!RQ@@/xP/X-(!R!RQ@@/P@/(xP@/A-PP8@ `@Q Pp fp 4P ~ P@@uw w40S \/A R QPT/w\ Q/A0SRPT /$  RP00T/vPP00T/0Q Q//v0Q Q//vuO-M@T Q lP\PHX P\T \ ARA `PhVTV[Z IQpI W @ Z+ Y  0@IYʔ ` 0!!-G W`Fp,0!PPPPPPP,!PJ ZQ`p,D |    MpM p`WQI P pIV 0!!-`V,0 !PSPPPPP!,Z!p WPP`,D | 尡  p `PVЍP U 0@9PYP ЍtsH-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A/P/P/P/P /P/P/pO-MPF @P H?A,0DP   p@Y*  Xaq | P]p pW:0@  $ЍЍLo@-T0 0SQR,,r@  @ Ap@@( R/,0\  R0/Q\ @@O- MP5,`p@䠟 @T)Q PPaBQH0 0A  P !(Rp (X! 2/p < 0 Ѝ Ѝ4onA-@(P $Pp(pWa,Q 0QaB8pP,p0 p,Pp@-@(P 0P`m(`VpH-H  R <0Q0 RG-P pP%  0 @ QB `P V ``0BV` V `QB   P BPPPC: ` P>`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $0jlPklkkkjijO- M@"ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, ᆆPPl j,0~Pe ,Q4rPY 0 H0p4,PP P4Pp 0ZPJTPP*`pPY, PPDp`F| `Up 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/`gp@-`@/P`*P0T0p$ R Q P8U=Pp gdG-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@lf deddLd0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P aPU   VPUP0 P EP/8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0pW(Pa0H-M @0P@0Ѝ0p@-MP @lP```Foo0 b` P `PЍpP_P`O-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP DQ HHP `P$p(PPX`@p GpW ,[D 0`@P"0S  P0_^`]\H-M  @ 0Ѝ ^P Q/H-M$000kЍ]O- MQ@R ЍPP @P, `ނP0w 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp8㭂P4D pLP= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R} !Ry$Rv RdQ8pᗄ ᕄᓄᑄ@f8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0pW(`p@-X ]80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8pP:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMP@PQDЍl`hS`F@RN@^A@VL@`t0 L`SC 0 0RPPppP oRPB 0Ap0 pSPVPP@ x b 1p 0 V` ,  [P*P [Z x@  $P  0!P 0  Q:VUP/H-Mp@pQo :  tx 0P`a%P?9 D 0` FA/   ЍVSH-M 0  ЍO-\MX0P8  P0( G  `PRR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S,0spqs p8E R :[,@``v@[P Pp,0PPE1PPP0PP 0P,p00C1@@@000~`P8@ 8,@t 0SO(,p,@ ,08q0 (,p`(0Q pR ppW8` p@(p@W@ ppW8`,@" p BR`p@@ F`0 V (0  B0s`Tq t@A@T00T@0p 0sP<@P@0$X04 X <0@P X T @q Sx!Ttq0L  P@D0Hp  Q`Q@ptPUHPD @Q PD@DpQT:P @Xp0@$@wPP@pQAP0@@u@T @Pq@pEPEq@UPD4P@LUHDLp|P00p pw : $X`D0 !vPQ|Lp 1q pyb p$ 0 `( AR  p(@p`GT`:p@ p Pဠ(p p`GP`@0(@ 0@T@P0:,@  (0 R (0`V0 `V(RVʛ\ЍK-MP! 4\008@?SPp ` @ BpGR@DApT0  0ЍЍO-0>P |' \XZ 0\W@P M@TPI=p?L?$R$R$RnH%R ,`  & 3  0@@($Ppt& # 0@P & Pa @ Px `(X=0=<|><$R$R$R8LQ2 `, %   0@@$Pp%  0@P hq% 0>>4<Pu  0}d@` @T=P txp $ $P 0T@P @TH8$ X 0d@` H@T`0 A# s,b$ k$(P p0S@Pc` Y@T `PT<;HP P,  0 c@` H<@T9$;9:xL" . *0R@P L @T`0 Ah"   0$Pp(T"  08:LPE , Q>qxpD! $P= 0Q@P L@T.9 R! ,0 0 SR ` R  ,0 0 S,,!,1r 0$%7P975 7(7664445h$<5(3\31t322 3P0 0552).-+p+,+(/@,P*..)-,*)<+)1-++**((/1H)**|,M` ` ~` -,O-MpP <ɯ80P@Zh0?S\` dlpЍ`@ p A@DQ BH@R0 0pP@p948  A@ t%0H-P  oRPlAU@@, T@! 4@ @,0$#P%   @ @~ ?+ /o" T  @ @ |Lh  @@Po00H L'%'<%&&$$T&$L% &@$8$@-P @ @Tp@-P@Q iP3 P"\ <PU(($ `V `V`U PPPp 00Ep PpH AA!HQʯ{ `(  1ppD% %D#"$"p@-U@P@ ~ ?+?c XTQ @% ,@ ` @   Q $ @ ` @   Q $ @ ` @  tLQ \$ @@<Q ($ @@  (PQ  8PQ # @@ # @@ tc`TQ  P  @# @@  P # p@@  P " a@@   P " R@@  P `" C@@  P (" 4@@ 4P ! %@@ P ! @@  P ! @ @@ P H! @@@ P ! @@ @P  @@pPLQp  @@pl!`#!H"#,!!" 8"X"| t !! 8up4@P9$e`  w @pPUG/@TPP PCA| 8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P   P $PCA 5Wg D@# D @ P    Ѝ@PT~P D" 4P ( PCA  @T(QapP` qpWMGxPP PCApp10d l d`P D<D0$  ̾lhP<,$0 x`LTD$ D Ի\H(ȸhhH<, dX0|pعD( TH-LP @.88 PC B;صx8 RDQ/lP h%R!R/!Rt%RQ/ P/@O-Mⴤ 80SDPUЍleVheVaV h p S<`L|\p1 P4V0$TPP\0`pp $  P # ' 0 p@0@lP h0P0P0P @  0 00'ΠTʌ `ʝp ,T,(PHJ\pr ,W000¡P?W00?0¡P8W?001¡P1W?&02¡P+W72003¡P$W7>0?3¡PW?7J004PW?7V0?5 P   pppp0 R R /*p`0`B0 Sokp0#7 pa0`( pXZp# Ha<  Z# PP H \H,pp W !QPPP P 0 R00@00ЍaVteVeV 5S t0Q)x,X@A-0P Jpa``VPS Xa``VV<1oj00`V%`AVPa4 (40`BVPa4 (40    1oj'NJ Pr`"qpWpr`V  0PO-p! XS T(D$<XE @ T T' Q0,[S qP0PU00S0000`VP 0`VP[@,`` V T1p00PQ 0pW@$@-^:J00`0S4'>:00?:0S0C^@1,0 0(0AS@1,0 0(p@-M@P)J\ R ڌP v`P!lP0ok Pr`l R -P 0 0 @ SЍp@-\JP\@ T،r@L@@v H- 0R0 t ?; "''.*@P 0`H-D!?: 0S%0@S 14 (400AS 14 (40  0R0 l ?; "''> :@P 0x@/G- R t" @  " \R@P P hP9 P{'r"QJpP p! g @1@q Pᴖ ql! P  QEZ8'QJr0"<p(P p! / @1@qPᴆ q   r"Q ]=  q l  ` f@0@4<$D`0H-xP@PPPTP <  0@@0t/ 0H-h@ Q pP QpP U  Pj 00H-@ Q pP QpP U  PO 00H-$@qPC 00H-@qP: 0@-  0 S QPSZ\^@, T@@@!\@@@@ @-0P RQSZ\^@,0T@@@1\ @@@@0p@-P0SpP ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA```DO-Mxx#p X  Y qPCZ @P@P0DUEp ЍO`@ F@P ppp TT8  B,!!g1Rv`@ @Z}0 @00(@P0S0jP@`p' U!` P @iT D|^pN HPEU KPE[*Pp?P P尡 : @`@DdP+ P `VP Z 0p`!pp 0p B Q( 0A pQ 0@XpЍpp괮 0H-@ ,Pp 0H 00H-@Pp 0H0   O-TMP" `Qo ppPC[ cP @P G PPR0@[EiTЍP$0 A pR? 0` L  pp WpCI 吇(+$P @ P TU8  P PP P P PXppH$pqpPCK $fpPC P  Q$`$P@$V`FIpPCYIKP3 @Q! ||h 1p@H$pPT@CEt!)+ $$`pPC  APQ J $ ,(pQ1@P0W1Pu p@W1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@T @PP  P( A Q PQ pg3TЍ L0H-@ 0P p  0Hn00H-@Pp  0H`0p@-P 4@`p  p@MpH0H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>P [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr P P@7/@DT PH`DpP PPЍP qpP@7/@DT 00`B/P[^ ( Q H-M0 R!R Q L ЍH/ $ R p\H-M<40 0ЍH-M0@ 8(Ѝ<`@0H-MP@PQ PQ  * P Ѝ0dQ\QD  x4  ,Ѝ00,ԐȐH`A-M@Q,@PA P0 @H* 2"!1K`p@pA% a!a @ paP `V $Pp`Vp fPP@ @Ѝ赁N$d A-M @ R  $ P? P0 ) 2" 0C`p@pA ?> @paP `V $Pp`Vp nPPOЍkLO A-MPQA@PPX `:0 )H!2" @ pA0p$4|q@Ap " a@qFP* aV$ @T $P pp@T WsP .P`V X PU  s`PЍ-?L*Sd  0 O-DM4lPe_Pw $@4:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1  80)84U<%%!1KP@%A % a!a@pQ `P =LP P4pq`o1h 80(84T<%% @ 0A0P$\4@$A #" a@QsP8  >P01 -  80(8PS<%% 0CP@<#A ?>@pQ ?`P g ` -P2  ' PP.   P*  P& | P" h P T P @ P ,  P P   ! Y P P PaP=T ,@ q @Y  q@V c@ ,=pG w P`Q6@qjP@qb@DЍV xcDЍ-?L*SkLNL ҥ Q[  Y {  O P   y ' O- M` ]P @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA` 0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ Pa @ $<p 5o/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*8 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0 O-Mp@`PDpQ$ %QpPp1@ Q:/PsPplP T TX " @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ 4[<[ 00@4@Pp$[P, 0pp$P  PJ PQ$ %QpPP1@ Q:sPPlP Z Zڼ 0@Z @8PH  T p@T` Q R c ,Pd  4 @ `@%T TP`%V `40 P:,P|^PI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @  Z  pPS &FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo @ Z4 0 pP*,P W,`\P 4,0` 0ᮜpp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP PT*1@P OQ!80!0! !P  P @ P`V  P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 p6Ppp2@or.Ppp*PWpp$pp!p W ᜶ppP}P}PA ~V OQ  p OPq  P %A@Q" OQ} a ARI/A AR @40 P*,P _,`[PY 4,0`T @4 @y  APT:r k %Q Q    ;R ?R eRP P @Z ,pL[P 4,0p  0.p444,  ,p+ psߍ{z< MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//UK-Mp`PQ`-`P# P Wp4PpyZP  @TpT Q# X+kX)QX!I T tXX; P XE X9 X6 Ѝ ?pP Q  (P P  0{p(P  ${pXЍ<4, ht@  ) S @-M0S H@P - ЍA-P`P p N@[T  DpWP P P P P |P 0A? K   O- MM pP /P  0 ЍۍOP= Q/Q9 fP6 @`[V.Z`P& @q[T  Pp  0`][M V Wg@? P$ @P`t@:PUppGTP:PW g U g  0PF]P P9 P 0 @P 0FP% @P@`t@:PppGTP:PW g U g  0PF"P P ЍۍJ   F  O-MR `@P pP %%XP P  !XP  P  vXP  GP XP  N rPp R p P pP 0<@p  p `[ `Q'pQ Q , p`[PAq 0Xp`pQ pQ [ ̌`P 0VvpA  !P 岐$ Q$P | $P`P PR Z$POZ$ WP$E `YC [ PP0 0Ss0   r0P, psP nP fP2Ppp1[p p2Xpp[ `ЍG-MtPp!` 0 P4X@PpP+q QC@P v 0Lp pRЍ P 0 P  0pP  Pp p_ ^^p^H-@`pP! V 5PP`P |P p@U %oQWU oO-$MP@  PP,PSP  ``YPF p|P  刣P  Pt @@P,P `ZSP  P`  Pp@ WPg  X p[X P pPPWP PX P `(, (, PpW< 岰P`VZ`VJ $ X @TP VP $PRP ( $@X㰰( ( `P!w@IcXC$wPZX@L@@PDPTHPLP3 Pp`sV nV fV    Pl &  0qP @T pX $Ѝ,v3   A-@P P|``P,PPpRP  pP $K h A-@p P`UP VPPCRP !Vpఀ  O-M`8P. LpW @@fP@pW PPr @sP nP P@@ PZ  0|TpW: 0Po4sY nY fY  P H DPUP @UP'@P#QP H @DP pH@HH@sY H  nY fY,H (@0H0%P' ,Q0@H <P00@H 0ఀH @ H  HH @HHLPLЍ  0H-@ PUP %U0WQP!0@- \ s\ 0@T sR nR fR 0S00A- pW `@`pW P`P sP nP fP` P``M0H-M@P 0 WЍ0HЍ/K-PZp@P S@P N`( `8 H0PP*  `pQ`   p@Q  p岐Q   pP @p @,@P ,(` @ `<@P <8`0@ `L@P L@HP@ PA@-0@@@@ @@0 @DS  @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B XA-@p `PVP SP!PPP A pPF  H-@`PpWP SPPOP `  P  O-DMp @ P  ,P ^P00\P00 PII|P|@P@P\P:  DЍZ P:  0 T P: 0cPPRP `< P`P,PZOPH  P<`TP#Z4 @ P@ ` ,P= ^P00\P00 P`F2``P,POP  P^<`P ~P T<@TTT@TT T0TTq `FYP {T8Zd nRc #0P< P @ppp Z <8,P < R  0 S PC@ rP@PP <  0f4P8080 PS*W$P  @P@U@ p R@Ua pPU;< f0@@ @@N80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p<0PP Yz0R < P Pp\pP@ ppW <4P80<Q < 0 0S 0Q  p<0PP84 PUR <0P @pPePPЍ0kL } 0!S/g~ 0H-M@Y0  2" @ PA0P$4\lP@APH " aP@0ePPЍ0-?L*SP } 0H-0M@PRP 0Ѝ0]P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-PU@``P1 Q},``P |p` `Q  }W|`pQ  pP|37`2`F``,@-P @OOO O$O,OO  RȆ /᠆Q/ሆԉ Q R/$ R R 0S/0 0S 0ˀS0000 M <@$0pPT/Q R/$ R R 0S/0 0S 0ˀS0000 M,04 <@$0pPT/K-@P P P $ RpWPHP`q&0V`v`fVP8Q(P(` (2/8 (` P $PP QQ @R 0 ) /+ 0 M,@0@4@ @@@@<@@@$@@0pPTH-`R @1P8S T, 0PS(00 0$.*P$(3/P `p8`@ jP P$ (2/`谂H-PQ @1P8R T+ 0S(00 0$.*P$(3/P P`8P@ +P p$ (2/P贁H-^ 0S$0S\ 0Sd00SQ q Q@0 ^<@<<@O-lM@Tph P $P[hPlЍBP T/ R R \ /+ @ / M/+(  A?04 \ ?< /P0p$ t , X <@` p 8D   P\pDppH < 00LTtX`P R!\|,<L0d< H dp $L@ <  Pf `PV*U 0EV*S  `PEV *`PU X EV*R `PE`PV`PV `P! V*`0S]  CV*R  CVR  CVR 0C`0`9V`PU4  EV*Ry  EVRp  EV P`V*`PU 0EV(*S  PE#`l`P Q?:P`$`0Q`P A p w:lX(, Pp PAW P <L Q? XTp`PP`lPL` PD V*0` PV p`F0pS:L `^ XN\ U Qu V`0S 0CV*S  `0V 0CS  `0V 0C~S  ``@`w  `PX`P VL7`Py !P28B`?P`P C? PXU ` U PUPU`   P` p`T AP`@PJL\pv `PYQ? LP`F? lP<dh\ Uy*XP 0V* `` V `F 10P:``QP@9lPPLQ Q) P*V `F P:99@ઑ@( P*V `F P:90@U !0CP0 P*V `F P:99@ઓ @P 0Sd,00PQlP``LP`U:P X(p,Pp P`$`0 ` `PP <` >H? 9`0P  Pp8"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PETP$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  H0Tp?? `PHp  \kT\`0pV aHp  \[T\`0Vd V)dHPed `pHTp P00C\ Q  LTp HP)ed d `p'Tp` H` TpL` ꗵ ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P E Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@`Ҳ ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ ð P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:L} (  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1G `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#`J C P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PN{ X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `p|Tp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a ?,Q>? Q  % " Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍX R,2 0S0S@@T:S@?LRl/@ <@010<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPThWQ R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 .*MP  R@ :o=RTp B0pG 0P T0p YBp ( 8 8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 ^ 8^ ^ p^ O-  0@   ,QP @0Y 0  pWpW   0  LQP. IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW  R 0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0vpWpW   0  LQQ0 p $0 00Q ,P Pg,P7   R!4pWpW   0  LQPI0 00 0  00 > 0q pWpW   0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW   0  LQ7$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Zd, 800 00 1pp t l Bt lQ\ 0R8UP @Ch l\ pWpW~  y 0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\n pWpW   0  LQQQ P<V Vd  0p V LD  p`tP\l$ pWpW   0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (Ѝ|'Ѝ  <pp0  000  4pp0 00` pWpW  5 0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\^ pWpW   0  LQPQ(Ѝ($@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T  k 0  LQW 8\ W p O\`F P,\  C0V   0  B0s@ `R' , V&*<l@P 80Al0 !lPP8 0 C, l@V`l l 08C,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l l P,R@ T@T 8  %, l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T  s 0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8  0(/+3/PP p/+p 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ L DD  ! 0 b $ 0 BP`kp@-P@P@T `@ P P 0 0 "0pO-MKP tP tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCzl`\pWpW!   0 PAU PЍlP#Q.\ 0R8UP @CDplP\`V`V  U 0 @ATPPPQ/ \ 0PR8UP @C`l@\pWpW  " 0  LQPPPO- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC`l\ pWpW   0 PAU`@l h Q\ 0R8U@P @Cl`\LpWpW   0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CiplP\`V`V  z 0 @ATPPPQ/ \ 0PR8UP @C6`l@\pWpW  G 0  LQPPvPt`,O- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ / Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B. 8 x    G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" ` G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L ""  H-P! 0  @^   @`AQp#pP` pE   H-P! 0  @^   @`AQp#pP` pE   @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/ U/ Q `2/#(XX X080b$0 ;0,+  HH-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   H- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p Vp  @ O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W` @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@PdpP P L@ppp@-@`P P 8@ppp@-@`P P $@ppp@-@`pP P @ppp@-@`\P P @ppp@-@`HP P @ppp@-@`4P P @ppp@-@` P P @xppp@-@` P P @dppp@-@`P P @Pppp@-@`P P @<ppp@-@`$PPPPpgntsp@-`PP @ `Pppp@-`PP @ MPppH-@`p<PP P PT atadp@-@`[P P !@ ppp@-@`,P P @ ppA-d`c\@PPnP p P pgntsp@-@E`D$PPPPpgntsp@-`PP @ P ppp@-`PaP @ Po ppp@-@!` P$Uoploobp@-`PP @ !PI ppR/0H-@!P< 00H-PP @K"P- 00Q/0H-@>"P 0@-@!@M@-@!@m@-@!@@-@y!@@-@s!@@-@m!@@-@g!@@-@a!@#@-@[!@G@-@U!@h@-@O!@w@-@I!@@-@C!@@-@=!@@-@7!@@-@1!@@-@+!@@-@%!@1@-@!@Q@-@!@lp@-@`P P 2!@ pp0H- @P P!@ 00p@-@`P P !@o pp0H- @P Pz!@\ 00p@-@`P P @H pp0H- @nP PS!@5 00p@-@`[P P @! pp0H- @GP P,!@ 00p@-@`4P P @ pp0H-P!P @!P 00p@-@`P P p @ pp0H- @ P P @ 00p@-@` P P I @ pp0H- @ P P @ 00p@-@` P P " @ pp0H- @ P P @s 00p@-@` P P @_ pp0H- @ P Pj @L 00p@-@`r P P @8 pp0H-P_ P @D P& 00p@-@` P P @ pp0H-@ P P @ 00p@-@` P P @ pp0H-@ P P@ 00p@-@`n P P b@ pp0H-@[ P P@ 00p@-@`H P P <@ pp0H-@5 P P@ 00p@-@`" P P @z pp0H-P P @Ph 00p@-@` P P @T pp0H-@ P P`@B 00p@-@` P P @. pp0H-@ P P:@ 00p@-@` P P @ pp0H-@ P P@ 00p@-@` P P ~@ pp0H-@w P P@ 00p@-@`d P P X@ pp0H-PQ P @P 00p@-@`H $PPPPpgntsp@-`PP @ "P pp0H-PP @Pu 00p@-`PTP @ Pb pp0H-PBP @oPQ 00H-@`p <PP "P PT atadp@-@`P P @% ppp@-@`xP P @ pp0H-PP @P000H-PSP @ P00A-V` \@PPP p P pgntsp@-@7`l $PPPPpgntsp@-`P$P @ FPpp0H-PP @P00p@-`PxP @ "Ppp0H-PfP @Pu00@- )@P $ 踇A-P! @ P Py`` `rpP $ p< 0 0hp @-P @N @U 0m 0 b @-P @8 @? 0m 0 R MK-M$P @$ 0pVTPJ` P  0PHT pЍK Ѝ/ 0E 0 U g H-P`p[" }P @`P!T `C h!@$!:4 TUTT$ p@-P @Q p p P0P `pP#\\! P @@` Ppp$ 49H-@P PQ  pP `pP|#\\! P @@O`j@48 `8Q/ 0 S /dQ/8 0 S //Q/8H H-^ L0 SQ 00S P '#܁ Q  0 S//pp@-@P PTQ p {P ` P"@p48 Q $ 0 S/Q/ K-M@P, P`Q%V# Q  AP ` p0TP S0R@ Pp Ѝpx D K-M@P' P`Q V!   pz P x0x p0 P0`R@ Pp Ѝ(( (0+ 0x w h  + P 0(  SQ 0S /~H- R 00 S Rdo\~ H- R 00 S ROo~, P 0L  SQ 0S  @/  PQ2}Ĝ P ,00R  @/ R X}p H-M$@P vPP  P0PP, 0 P# pXP `0 P  PL  P Ѝ| H-$NBKK{H-P Q H躽88 80 0a$$ $0 0b   H-P H蝽 0 0o @-@lP XH"<P a_JJJJ0H-@ P PT1P P 00H00H~ 6 R H-P 0 S 4  PQ;o"  //p@-@ PP ` P `V:<P P Pp P P>p@p0H- R PP @Q#P  ,  @00XX X0 0HDD D0 0@00 00 08g G ' b 0H- R @PrP  R000H-P<@P /P P PpP P>P  0H0p@-@ PP ` P" `V:<{P P PprP P/jP >eP  p@_pp@-@PQ@ UP> @;Q <Q >Q&H`P, g&Q&=`P! a7P m2P p &*`P l$P tP ;Ppp`p0H-@P<pP| P P P Pp PU:<Pg pPb lP] iPX sPS tPN  PI vPD eP? rP: sP5 iP0 oP+ nP& =P! "P 1P .P 0P "P >P  0H0 @-<@P+ /}P& pxP! lsP inP siP tdP >_P  ZP @T0H- @P  \ P P 0502K-`@Q p0 PCU pP<Sp0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP` p(`>PX` P\ tP/Q PY $>Q; $>Q5 Q PQz  Q&  Q@  =R(  P R0!$PP"Q qR  PR "R  PP>Q  0 0c $ > p@-@P&U U[ <UT `Q TT*P@PaPEUL`QD(((((x((((((((PpU% mU3PpUP;U.&P`PtUP;U&>P`PtUP;UR``<pP >P `P Ѝ` | O-GM  bEF T 1/  0PQ aVk Q 1/P@hP pf T 4/ 2/pT 4/W hW WqWq) @h@pP Q 1/P`hP P  2/P V 6/p V 6/Gߍ 0 0H 0 0? 0  06ll l0; 0-TT T0E 0$TT T0 0Bg 4  ׼  > C b x ־ W G-Mr@PP`P?. pa  Q:?F갻B!1 X 0Gpw4  P%p! )P' p  q@$P @Q/Q q@ k@ۍ/Q @P*T @T P/Q Ap|Pp1  ̯istX/.plXXXXG-M`PxP @,@p pp E0e `V`*D @Ѝ   0p].x  VZ0 : Fp V@-@ ;M@ H-sgP 0 0뫸 I T P/ O-KMp( P@$UQ TFGo  0PE5/P  JI/ 0`P $A(qP P7 1$!( PP qA $A(qQ U JI/0P @J_Io($  2/ 0PKߍ 0 0볶 //@-@@ H-M  Ѝp@-P  V P `Jp(eP @NNtP `,z pplวPXkpHH H0 08<-H--,<],,,,\,t H-M  ЍH-M   ЍH-M  Ѝ@-@T  R[ /Q 0 S / !@ ! Q/ q3/@S"# Qr3/t[P ,0 S0! 0/ZP ,0 S0! 0/xZP ,0 S0! 0/8ZP ,0 S0! 0/Y0H- R x0P0U0A  t 30t00 0 T    t :@0Yp@- R! 0P0UpA 0t'P0``R  0T0   '('R@pY0H- R |0P0U0A ! R 30t000!T   ! R :@0pX0H- R |0P0U0A ! R 30t000!T   ! R :@0W0H- R 40P0U 0A  U0H@08W0H- R |0P0U0A ! R 30t000!T   ! R :@0V0H- R x0P0U0A  t 30t00 0 T    t :@0HVp@- R! 0P0UpA 0t'P0``R  0T0   '('R@pU0H- R |0P0U0A ! R 30t000!T   ! R :@0U0H- R 40P0U 0A  U0H@0lT0H- R l0P0U0A   t  30t000UJ   t :@0T0H- R x0P0U0A $0t%(000R U J  $((%(R@0S0H- R d0P0U0A  U  0t000UJ  U@0R0H- R d0P0U0A  U  0t000UJ  U@0pR0H- R 40P0U 0A U0H@0Q0H- R d0P0U0A  U  0t000UJ  U@0Q0H- R l0P0U0A   t  30t000UJ   t :@0Q0H- R x0P0U0A $0t%(000R U J  $((%(R@0P0H- R d0P0U0A  U  0t000UJ  U@0O0H- R 40P0U 0A U0H@0lOP 0(  SQ 0S /$O0H-Q DP@PT0A  USSZ0$%o0N0H-Q DP@PT0A  USSZ0$%o0tN0H-Q DP@PT0A USSZ0$%o0N0H-Q DP@PT0A USSZ0$%o0M0H-M@ QV$PPR0Q -Q  p/: "P+9xP   p:"P  )p"P , hP Ѝ0H-$!`lK0H- @0  Q@ PRP0 TQ @ R*0T300H- @0Q@ 0PTP0 R Q @$0T*0R30@-@00H-(M@|0P p   (EEPPP YP $dP(Ѝ0N @ PH-P 0 0@TP0T`Q URSZPP!&oPH-1H}$@w0H-@G@P 4P,P0P4P8P|@1 Ѝ!᠚,4< @4<  Y& `^ 0z 0 0 0㄰ 0 0{ 0 0spp p0 0UkAX0?d   B ' ~ Ø ߛ : P 400\Q 00\ /= =O- MP @`<P Ѝ8.4P* ,㩰 PqW& ᶭP IPQ0 S  C!`4<@4<=; ЍOvDD D0z 0,, ,0I 0< + ; P 000RQ/ 00R /<;@;P 0(  SQ 0S /:P/  Q/:P/  Q/:P 0(  SQ 0S /:0H-PP @P  2/P P PP00A-P @@PhP p`$,`0`P4`8`<` pQP 0p Ax9G-Mp@ PP@  # O- M ` 4P D epP P C@P k  Ѝ f   ЍO4P P`P< " *tVj Pg<PC4PQh,@qW: P0U. 㥰PC =P PEPQP@T]  P P  cP  2/Pp P p@ P| @T: Bpr$$!$1z 0V 0c 0M 0 0E 0 0<tt t0 03 0 0*= 3\22 { ݋ ݍ r Ë   + Ǎ O 5 Q ^ K-P: P`VA@V U1} U1x 44P pP' 4 , !$ ,,P  Q,Q 0S ppQG E @@ @0 0}㺬,, ,0  0౬l/߉  ͋  @-@' @$ H-v H X, H-$ D.p@-@P ``QP P Q < `R4 Q ,a pdd d0{ 0OLL L0c 0F44 40 0>-3 ω  f މ 0H-@P P H  Q< 0H 0 0,O ډ @-@DMP* 0 0   0H-P@P `[P P D0H0 0 0٫&[ ͉ @o/K-S" p`P@W  HP   0Kp?< 0 0࡫{ ~ H-Pp@P `W  P  `ơ`|*H-P@s`P oop,WP@P @)H-P@X`P oop,WP@P @p)H-PP@pQ9PP T@ p`)P  @ip)A-@P PQ P`@V pPW P  PCPP (`X@P ('Q/ 0 S /'Q/ 0 S/'H-0S L RQ R0SRP'H-@P  R  `PV U P  p@U DD D0 0,, ,0 0&v R Q/ 0 S/&P 0(  SQ 0S /S%H-^ 40 S 0SQ to%H-M$PjP@P* !0 FP P\   `p "PL  PF"P 00!01 0 0 BP1 `p P+ `0 2P Q OP P{` pPP \N` piЍV bPWe 8 G z#O-Mp(` P@pW=Q@1, A NQg U P V T/* A U UP V P* A3! P V P* A2!0 V T7* AP z-* pGZ@X$ pЍ R U:05p `BV  =R p0`5 p AR<Q Ѝn @-@P G-M Pd P `Pf  PU%:p@`* xPT $  pPL & hPD ? bP> PEUU+  00U@p` `$GP& ' ?P =U ( 4P =/P L ЍGu8 ЍG`@Ѝzvk j utH-0S RR roP P88 80 0c$$ $0 0[| } } | _} m} 0H-@44'((PTPP0<@-@T  R 0Q  0 S/P/Q  0 S/P/P 0(  SQ 0S /0H-P 0$PP @  0 P xPP h 0 P TPPPPP000 00 0ӧZJ hHX{ { { p@-@@@P@P*,``#pd/ 0 S6I R 00 SQ 0 S/Bo/0H-@@P 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@d P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pኒ800 @  0  /UUUU3333  ූ0H-@PQ!1 09   @  Q d8@HHPHXHtH|Hpc? b Aa-lswr  - w-! Q -QxsSr - w-  Q -QxsSr - w-  Q -QxtT    0[ [ A G-P$$!$1 0>㦝 ϊP) pjP6  p,P.*̀@ӊ`qPqP`@pW   JP =PἊUp@qPT>Y 2Z Պ t 0H-M4"424R 0PPHD@P< 80*  Ȟ@po  p ttd PP|PxPp \PXPPTPPP P\ oBK 㚞 㖞?@QP,P-d-0-뿋8 0  Pˋ,U P L@ :sp|P L ^ Zd ]L@Ѝ06mOJ   00T O-MP@PDD"D2 0?㴜 T D "P EpXsЍ`wP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0Ȅ@I" 0 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@QxV V V `00O-MP@PDD"D2 0? T D "P pXsЍ`ԗP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0%@I" 0^ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@QS ST BT `p@-M($`P4@`P 08PpЍp(O- M80`<4P P@*!1 0K_@p[xx!x1 0MTWpVpT D#P:P=ٜ`לD0  ~@ΜP ʜǜ`P Q Y:8

M M ( 9  /mNA/O-MP`Q Z U Y Z + @T@@t llP VP`< xd \+ @@@@P `V 00T QP-P`V p C`P+P -P j  `@v/ x z PJ @ E Q EQ`@cX\ P p0 R ``e 0SAA@ )9_ 0#Z^(8 0UV(8a 0YM(8 0ZE(8 0<h`眨 z Y(8 0J @@ =EQ 7EQ@[cX\ P 0Q R``k 0SqQPq`PfG@' 眇圷B  ``S0q q@-VPPPB =㢌PPz `@{:V p+@oPᎌ P WV;Q :Q& Q PP:PE`?`v````Ѝ耦 z tFY@hh&h6 0:J pE DQ DQEbX^\Y P 0Q R``k 0SAQPAdL`PUz @ppPU  EP1P@ t  0S 0S Q@Z- PU :PQ  K40$ Bp``d`hPN P^@00t RP)S'  @P:POQ -P+P_ZP :P hx?`( @R]SI \0Q:P @T@@@T|t"P :P\`W -<4P:PL `-P+P:`:Q :P?`P!(20 P P  `P`@`P@ `P:P Q 10! A-P+PWI +J 0J I J J I I I wI I I OI I I <4P`TH wI @I HD,,֊ 8d( 0# |# d\OF F F |l& 8$ DD4#  & K-@PQ/ T7 $# P; pp Q1 -R"` `p肟Wp6 -W00-pS:200TT"T2 0RPT88"82 0SF$pW 00"` `p::W /b-``-pFP p@P :Q/Q `:P  P<a! 0QP`P@0?PP:P P h 0v(:P:P ?PP G 00? y? > ? Q? U? ` 0hH= <8,܈l= @-@P,, ,0 0/㔕 @< = _ @-@P(( (0 0/〕@< < < H-MP`Q P3@P <P p 0PP 0PP PP0P ` PP`Pۖ`PԖ`Ѝ\A-@ ` 0Q pS P1Q*P pEѕ Pp pAWp  ( Q! H-Q Q Q+s$ 0 0ɔsAQ~T 0 0㳔Ϡq  0 R1 R010 ^: ; ; y: : : H- X0(x0 X6Xp@-@P`P88 80 04㙔o 0p@M9 :  @-@P00 00 0Aゔ 0@zM|9 9 0H-@PP88 80 06lo ;0HbMr9 9 \ @-M@PDD D0 00T 0fPЍO9 9 9 0 H-P@P`` `0 0/6p{0UaU V`q#9 T9 A-@`pQ PTPPT ӅP  0>3 r3 x3 3 B3 l3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 *4 ̉ s1 H-MЍ@-M@@PЍO-MM`p PV; WC ДZ%5 0k7؄Y%5 0l,%u@p0  ",048<(  0$P @ލ ,@p$4 0iW$4 0jQ D,@@DPA P>}PWR Z[ Yd t@ ;hUP9tP6 0 pUT x0 pLxxpJPPN fT |b f@ 0@@mPЍۍf=ll u@$$#$3z 0~Z#3{ 0sY"2 0_i{@PJpڄ Tp|pPLYfx|!xp P$tfP!P" ᙍPt$AQ@@/k!0P0 @ 023tp l/P/SPPT LL GX X,! (! 1 0   07 51 1 _1 1 s1 E1 2 w2 Y2 1 K2 U ՠWh >0 -/ 1 a/ / 1 E/ . z1 w 3 2 1 1 N1 1 1 0 0 20 / sa 8 0 j R^T^/ / O-tMMF`@pXp W V TY U P @@0 DHLp A $p,$p,{ @@pT! ` ,pPJ   pY0P ,@,ܐ#P`)Ԑ=PQ4 ̐ p h 0h`P  O~뷐4@ 0h  P  7~  !@[ Tj@@p,圤@Z,j , $T@T(J,0$`  e    U` VX@崅PpaP ePUP pq"2 0㮎W"2 0㤎V"2 0㚎 "2 0㑎U"2 0㇎pK $T,@Ẃ @᳂ ᭂ ` P`P `@ P  ` Pf,P ^pA0 @pPtЍۍ;h( xiPP(h 0P`╦l P !,@嚏Jt0  ' ) ) ' \) ' ' 4) ' y' ) ' Q' ( d+ , + r+ + 2+  2D( 0* ' ' ' H@-M@@PЍG-PḾ`PpVL; UC pZ!1 0㳍x@Y!1 0㨍x!w,pp0  + $(  0@傊P @Z r@' 0 0|U 0 0rt@Q p,p|p 0@@2LPPЍ,:x%# # O# " b# 5# $ f$ I$ # :$ s {G Œ@-@P,, ,0 0~9 @" " " K-M⸑@Pp T!1 0 эW W&U```U` 0 pP:JWPW Kp ڲp)ꆎ/$ꁎ@}@ pp po0P @ Pd#PЍ9! ," " K-(M@PP' U/ T8 Dp$p pppp 0 pp吉P3`V-  0@6P# `Vp 0 0がUtt t0] 0vTTT T0^ 0kp<(Ѝ9       z  U.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35)uut %t tp@-<`P@`(00 b@pԵ0H-M@P`` `0 03ɇ0P4@4 P@ PFЍ0  R srp@-(M`P 0 0B㥇 00 0 @PP@~@Q @`$P @N 0`@P(Ѝp , CJ  rO-dMRXP` Y"2 0Yl0p`@" F `@Z  0@@Po ,P` p ؈  0@`PV ॄP. X!1 0"  0 ?P,0@@pP40HP@Dp pp@ 0P]P0wP,p0 0P4 O 4,0,P+[EPPUEWPP PRUߍ2(( (0 0㫅Yd[꼮  o l  L j Ɂc l A K O H/jA-MЀPpU W 0 04~W!QpP `᳕h @"2  0P  PЍ42pꔫ) W [ lG-GMdPU lHH!H1 0ND⍒ ,P7J\+`ֹpP P\@ ᕒ+ɹpPʾ@ݹ뺆W@JY!P \@Rl p"2  0P  lPGލ1꠪A   NkA-pM䀟`pPVl 0 0h@) BW!pP \Ph @"2  0P  lPpЍ1p   Bj< <@-M8@8@ s 0 ЍQg2 0,Q p$/A-MЀPpU W 0 0F}W)PpP `xh V@"2  0d@p (PЍ31pꐧ  W hO-EMMR@P@PjJ<8u` TpZ xp|X 0~qG W+  RUP⠰ W+  RLṸ@P  WpW P¸럅PPT@P(JY)P @ T p"2  0g@p  @( ᜸LP@Pᖸ0PP@PEߍۍ00똦ȤܤhfH-M  0kЍA-xM䀟`pPVt 0 0㬃@F aW)xpP `Ph U@"2  0d@p (tPxЍ[0pD`  < neO-MPQ U ! T 1X  f'9  \PPPppfc >f  @L``bc <pdc gPb!5_|Pb!cQ fQH00gQ%P3?gQ%b!0`1 Pf1#0-5_f1#gq 0=pa1`1#PP0`1#5_fa0=`b1a1#P P0a1#5_`g1b1#$P0b1#5_a f1P(Pg1#05_g1#b! -,0PP`!f!" 3?0f!"g1 -00pa!`!" 3?0f1`!" e1a1#4`0a1#6o`-g1t`8`e1# 06oe1#a b1<@g1#0`4og1#eA0@=@.P`1b1# @$` `$0OgAb1#0pp`=`p)@a1`1#p' p'0xϠ`1#b! - |`pp e1`+a1#`&p&0oa1#` 0c h p p"p'4`da'ea&`pea&a@p't  p'/'.od `dq8` `.`&&hqdq'/eap'p /}@ xaq` cq'`&o&Ph!p' -0Ppp P`n!p'_'opPPl"d!a!"`c1`%o&& " ?-o D`da0(`xl1d1#@&dP0#O$$Oa|l0@bA` nA$o&o&l@$ @tp`p`p!d''i cb 쿠nq ~ p$`'o&&caP(h pmvmzA-MhP@? @p !R/d0H-MP @ouP*JDU ?P :|u?P:vup  P0 D  P0  BuЍ0dXd/ Mp@-M@1u`0T` P P 2P J 0` 0PP  "@@`Q Ѝp@ Ѝ/x'd'Z 'E /d0H-@PP!1 0busI \ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0 O-LMPP @<8400 Ꭷ0`. ㅧD D@t@tPD00@7` ppPaIQ  pppppTpppppppppppp`8 ' p +IP =YP|@ @ ` 0DP`X@ PI[p  @\* p- p @2I GP#GP#|#꒰IPpH H *ssPDH @D  0{D=Y@+Y @V \*p,H  HssPDH@Dp\ %5] 0 @qWXD\E:H H`@{s@ysPDH @D/ @[p=YT=Y@\*pH HpTsQsPDH @D  0DV \*p0H Hw (s&sPQDH @Dp\   # 3] 0 sq WXD07`Y] ,YPr) rH PH@rT "PP : U*D@T* r@ r@LЍr   `r`rPD @@D@TXX!X1 0]q+ - PZ  ! 1 0opX+- 0 p P 0UP0V`0@+TXTP`@@`@+T XT -T@`P@@`P@-T AAT a = @ պ غ H-P`p@P!1 0]pWW/XGQQ <<<<<<<<<<<<<<x<<<<<<<x<<<<<xVp & +W-WVp=U -U +U=W  ,V-  @+pJ 0H-M@PPTT T0 0:8p  0P@?^pЍ0 ?  P/H-0pP//// /  / ,  //// /   0/   $0(,/A-M@PP% T- `pP@ ԁ@P ^Vp" PP P^rP. S. `,HH!H1 0oT,,!,1 0o6qPt^P  LJ'qPЍ$. p: P@Q tЍ \PPP P0 0 `p9㇥ C wd  ?G SKfʒ H-`P@e^cp+ZcP W 0`kPZrgpp WpP   |p PpPӣѣpP`(,&Dp@-`P@`V `VrP帣P 屣+Ppp@v娣P op@蠣pG-M@pP 0# T+ P `P= @ P Zp! PN `rP-X- P+$$!$1 0nT!1 0n;pPP RP-pPЍ*- p@ `@Q `zЍ b  "㕤( ^ ` 6 SC O,H-MPP00!01 0Qna`P LA@T P p@T P P 7oЍp- WR l"P  nD`poP uvЍ贮 M`<H-HMP`P 0 0>m@0 Όp pP" @0 ᱹpp(PpooPP  SPPPT 'PHЍ蚭 έ ֭ O- PU:$ `PY DTxx&x6E 0f 00   Pj%5 0fV%5 0f @0ⱜ괐Y ,QGP# (,0 p eP6"$ 02/Q-8 Q)DT%5/ 0xfP    Q 00+U @#J 1/pP @p :/P H` P, :/DP   d 0R0*  .RK   .R R .R R (@ Y RY$P P3 (, P I@P/31!@  0 P(@d, P I 0 P , .RP"2E 0e0    0 S @0ǛP|$ 02/Pv8 Pr PU#   "  PJ` @GV 1/V/gP7  2 - g5/Q%  ( P0G0 PI(ob$f( /`$QЍۍ(`D`D1h # ڑ @ Ƒ w y G E \  Z X - 0č Z *8 O- MP \ R "2 0 @e P\:U Ѝ]* p `@ 00T@3PAuPT PFV:Ud? T [ T &   DP =P=CWPsl 3P =P =2WPb ^ 10P! T P M J @G D A#PP P P P PVP Ѝ hX<p&(_ TKvT Ew 0 ߃  H-4P U"$0P H-pPP,,!,1 0b@!P0"S S, Q\S `  "P `Q`P@P `CV: S #S P@P00 0CS   T#P jY H-RM@a` %P PRލ P  0 JPppp x PP 0\PD%PQRލH, fJO-MH`@PY U (8 0_aU VcPX  H8p@<8a x( @Zp4` $H ǟT T Pp`,Pp(P2$x, ibY U  /@4pU {|P) ,`0 @  `  GG@`,Pp(PUpw@8< 4,$`Mx ,p pG@GP) P 0 ALHHp0 P$  P(} GRRQ RRQ RRQ RRQ RRQ RRQ RRQZ RRQS RRQ RRQ RRQ RRQ RRQ R RG@Q P G@Q RRQ RRQGY :U V^GP^Y\ I,p PYgP, 4pTpP; PGGP GL 4GPG G G GP QQ G@"   ,p pP @ Y IP  ֔a` ΔY `P  ࿔4p$p(P`pa<aY$4p`pp(P ax G#G@a@V +U aGŔG@a@V ,P@@,` @[  raa4`T@P@PPЍ \ bU0  ! P Q  \ 4P Q  \ *P Q   \ P Q v \ P Q v @+L@0\ P P QP ZP  ZP}  ZPz  ZPw  ZPt  ZPm\ Pe Q #P_ \ P Q \ P- @P @ZPD @ZP\ P Q u\ P Q : H! DDݰP _ZP  '뤐P @@\PPPЍۍ @u@08 Ŀk@ b@ >D3 p^R b,m ߐߎ{@-@P 0 0\P  *|P xP hYPT44Bk qk q |L,< 0H-@P 0 0L\P ܰ |P 7P hPPYP0044@0>j xj m xH(; H- P l@0O-$M`p@P' Z/ V7 F `   p P`pP"X pZQ*Q ?Q<p/Pa PK .P_P\ ZC VW Z/PT=[Q \Q Q @#X p*Q"p *RX  p/R0 R0 @Q X A.Q  R pZ V  Z/R p/PV /O @PV @VX\\ `^ @!@/oo"`0p\]\4R0`pX  @@  r@OoB=r\P /P H P pX  @r R9 -PX ```\\ PUP\`X pppP PR0@S@ X qP+@pt `T[` @[PVXX!X1 0{ZZ<p<P pP5 /NpPp.p@X  q`V 0  P/VP  p/P Pp$Ѝd d }b d d d l@-@P PT TP T 0P [轕0H-@lPWP XWP [0T 0T 0MO-MBp`@ 0 តPP u[`-Pc``PP `  0ᄏpQ  ާPM PPG p p  `  < -   0@lp) XႫPP1   0pXp @  0=P  `Z:p@@ `L@@` P ߍPlO-MBp`@ 0  PP u+[`-Pc``^PP `  0pQ  PPM PPG p p  `  <,   0@ێp) XPP1   0pǎp @  0ᬎP  `Z:p@@ `L@@`ዬቬ P ߍ4O-MBp`@ 0 |PP uZ`-Pc``ЦPP `  0bpQ  ¦PM PPG p p  `  <,   0@Jp) XfPP1   0p6p @  0P  `Z:p@@ `L@@` P ߍgp@-X`@P`R JP` RP pp@-X`@P`R P` RP pp@-X`@P`R 2P` RhP p(  MH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S" QKHЍ/,MH-MPP@ 0 0@  @@@ @0T 00@MР0    R  ! QKHЍ/xMH-M 0 00.MH-M  0 6MH-M  0 HQ R /O-,MZ@TP(| |*|: 0hWh +P8JPjf`UX R :R|R  P :     PJ @TP TP pMxX Xê`: PX@ X8a ,p ,(  X p 0P p ,H p 4|PJ PU(8 0"W_HP@ tVhxPp NP HP BP t<P `6P L0P| 8*Px $$Pt Pp Pl Ph  Pd P` P\ PX PT pPP \PL HPH 4PD P@ d: o7<  P2(& $"  $(,048< @ DHLPTX@@X%  ᭩H T, 00p(p 8pI4 80pp

p .$ 5p  $ ,p 0P0 4" 0P0 4` 0P0 P0@ 0P0 T0 p *  p b f o t &"圣唐a``$P pTh*@ @@@!@%@p  p PP   p R  P`  `PJ [pp"p2 0U\` P `Q, mF  Ǩ`pq_vpPd&0$@% ^` P 1\ % S P 2` % I P 3d % ? P 4h % 5@ P l PP(P,ЍWEV4`X X r T T YW hW sž|| DV V S p <Zp/  cGKZ\ɗhhO P QM >+Sޡ̡p%:.+jp@-P@U( `V% IE`p! Q/R EP@Q Q/RP @@@P PD/R  T@LPLLP/VPP<``U 0 ;'p@(K-MPHP@ <@`t@V` ㈧`P* pPP$@QU"P$T *Ѝb@ Pd88880888h8pUЍ !Ѝ0 وp@-@P% `PV! ]HP @Q/Q /VtP1 R0r/S@@ T@L(P ;P!'p̺H-@M04$ (8  ,p Q@Ѝ@Ѝp@-P`;@p T&p VO@U ppd @^p P@963UcpΉ-M Ѝp@-@ P` !LNQ !@ApA-  /o 0Q?o?#'S @c\" \ 0- (CHSS!& c pb0BPcGp00SgwsQ`SU1EQ1"U S !0#   A-  /o 0Q?o?#'S @c\# \ 0/  (CHSS!& c pb0BPcGp00SgwsQ`SU1EQ1"U S !0#    S&!B3 A 0 0/0S&!B3 A 0 0 Q/0K-   P/!?/o @SOoϠ?d'T @dQ Q  @/2 (DHTS@ & d pb0R`dp0@TWwtQPSV3Q3"V S@$0 #B! ` !   K-   P/!?/o @SOoϠ?d'T @dQ Q @/4  (DHTS@ & d pb0R`dp0@TWwtQPSV3Q3"V S@$0 #B! ` !     3 A   0 0/A0 3 A   0 0 Q/A0@ ZH-@ p A@ ZH-@ p@ ZH-@ p @ ZH-@ pPPH-S`➆0H-@PP00 00 01Q 0H腆A A / ?0/R//R/?0S/R/P/R/H-R@-MP @T   GЍpp :@@ 2<@P@@T0$ 㶇TĵH Q xH-(CSPHPش00O-MϟpW  0  pW PU} @l%Uq@ P%EUPj0aHHHHHHHHHHHHHHHHHHHHHHHHHHHX(0 HHHDHdHHXtHHHHHH H0 H $ 4 H H\ |  H L @@1pG@~@TUw "`B8h@DP ;P @DP x;P @DP n;P @DP d;P @DP Z;P @DP P;P @DP F;P @DP <;P @DP 2;P $@DP (;P{ (@DP ;Ps ,@DP ;Pl Z piB`@vDP :P' @lDP :P! @bDP :P @XDP :P @NDP :P @DDP :P  @:DP :P Y `p  0@ Q0!  /S` `6^  3:S3    ϟ0Bp5Q p "UUp zUpG @  0@ Q!0`/SPP V``3 :S003`00L0Ap S   <pG@3T 0@ P>pO  `  ` 0@ Q !0`/SPP<V``3 :S003`00Lp ;Q t  `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q N  `P:0@ QI 0/RPP6S003`:R  30 0FpA4Q-4 `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   5 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0 `@tBP 8P @jBP 8  P|M  `P80`@ V1p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR Bp ` P8?0 lp/ 0@ P 0/RPPdS003`:R`3  0ApcPp P @0Prdp@+0A/S<@!`0`p`0@ V:T@`  @V0A`8@ T T. 0/RPPdS003`:R`3  0ApcPp(.d! R P.0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p4-0  @p @$ `0 0C P\ pPU \!0C0@0S0 $ 0`0pC W@A HP@p P V   0 Sʁ0A@EQd 8P 0 MR`0 TR RS K@@@@@CR 0 RF Pk`` @? R6 ,;00``@/Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A8  p $(L`AVK*MQM0a a0p$( ,($  pɟ       phɟ B  } xR3 800``@h JQ. e 0B0S 0 B  p\4(R2?d A;Q<.a(Q50\ a $( pBQ JQ, ax:8 +8 `   P pP@ P$(PpzUH0?6 4 !6PP  6PK ( @6PE  6P? ` 6PA  5P<  @5P6  5P0 @V? 5P6 @L? 5P.  @@@A.a p$(@@@A>a 0 $(p  <0 p 0!a(Qr  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3$$40` # pA@q? `/{0Q"d  G 3cc#scb0V03R0!r`PpfAB `r B% I,pb8/!bB(3qRB1/0!B1c C AQA"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W03b4Pp`eA W B R:4 b0 G B 4 iQ Q3> B)0GK/;!`lqp'qqpWQq ""q R3!40p #`F 5p0Q"d  G 0`c#pcb0V03R0!r`PpfAB r B% I,b8/1B qRJ 0Q0 R00 "QߍoQQ )\P ף$I \a(4h' ]' `T ' ' y' E' )' dO-M@<PTHPP% (( P p1 R 0Q1W䀟 Sp |* W 1  \?Ph`at  G `P:@TPJPЍɔ 4  Z  i@-0M@ P0Ѝ@-0M@P0ЍH-vP HO-4My0 [   0 0:H[ 0 0;H P P P H@4 ~LJ0 Q4Ѝt,   o   0H-@PP T PP@P0@0DD D0 07HT(( (0 08}H   i   K-PP( X0 pW! <@`@DU QF -2@DQ F 0S  SQ``DD D0 0H?HX(( (0 0I5H      @-R 0@T@ 0R@B@QHO-M@PP' T/ 65P5 `p6P4  5pM <<D [% X< c5P 0 0 0CGT 0 0DG4jIpЍ -5P |pp P 5  == =6p6  3 |   <@-MQRЍ@;~TP @PЍ)I %I@ЍO-uMM‑p `w W I@F88!81 0DjG |@p7 @P:H/P@$E EUJOsW dE`E\E8~0 C pxp  0E匥EE8@PJW<P@Puߍۍd Q <Գ0 ꤲMH-M  0 ЍHЍ/MH-M 0 009ЍHЍ/O- M@P Z   " 2 0?FZ `Zn[lJ-?<0P @ P >0P` aa`` 1 PZCA >[  P`X ሔP7 `P [[Zpp{p 0 0F {ʠ 0 0Fktp>? Ѝ` [ I`P q  d! T X    TD@-M@>(P >< "( 01/`p) p 0`VP <`V>G`p eP @`>ЍЀ`>p@-M@]>(P ; ( 01/`p, p 0`VP <`V>GeP @`> sGT`ЍЀ>0H-PP<3v(vuvP7uu7wA-qPpW1 @EaV P $QPXHP* V(`01/P- V;  $P_0@`@`PSpWpQ 1/|tV@V X   0$PX@迿uPttt|5ss6uG-@Pa `'5P\ qPpW  U` "= ,@ QU Z=>PC HP U' $ P1= pWpQ 1/U(qPP   /1/P $@Z $81/P />3$srdrr3 rr3p3G-@P_ `4PZ qPpW  U` x @ QU Z=PB DP U& P0fpWpQ 1/U(PP   B/1/P $@Z $81/P 꿿 qphpp1(pp1t1G-R`SPP 0/`p{G`V @@ P /``@@T p P l``` `0`p`@ 0p@``P0nnnnln@nTn////K-R@SPP 0/``V ppGw P ْ``ppW `Fv P Ēl`` `0`p```0p`  P@T/m`mhmPmmll|...t.O-MMP `Q P P/P P @@ tpv V3P PPj ``p/P PZ @@/QQ.P`T T.P  PX P/ 5 tpC  P /Q P J P [ { P/P PB  e ,_sP$J @P2  P2 p 4p'p/P  P [ /. Ѝۍ,@? [/ "@e@>b@?_p@-P Q @tp@p K@TC tpp@9?"P/PP- spp?"P `P spp?"P܏@P spᏑ@pp@-PE `e2\H\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P >00  pj? p0gggDh$hh|A-PpP( U0 @R5 Q `p:Q 0S R p 0SRpGS@R :XR :R\\ \0 0=U@@ @0 0=@P!p@-M`@PP T V   0`'Ѝpll l0 0[=TPP P0 0Q=V44 40 0G=2Q Y O-LMMP`UH  Z ptY )9  0"=tDW )9  0= TT)I@T% Wl l)l9 0= R 0S Q:Q |Q P @Q:Q |Q @ỊP 0PS @@ ,VJ 0]7(H` U 0PP bq`VJ(H` p$0P4``Jp [ :H+PCq@PeH P6W4 @0P@ppP 0#P pTU'7 0<0 R 0S Q:Qc |Qa P@Q:Q |QpW4``9P P P :P \PpVp ``p,Z:0P,@KPa ,J0$pW p(t4@0PP `pt`0SLሏ%5 0<Ztt%t5 0B<4($4`l @ ډP @Pl]`,DP (4Ut @PP `@:PtPp  0pSR@S@Rq =R @R @Ri @:R  RD( 40@@H $0sH@[ {{$:d 0[  F B 0S:S 0A0pQ:W:,0` AV` A 0pP , D@0 A I` I @p;%  7%@Ȏ@F$< ,@\ 4p  T K P ᫎ<  XpHP LЍۍ <@0咎<@`቎W!1 0;@pY/@8P pD 07/p P 8p@T <@p@1/;/P̈P  $1/pDoᠲ 1/@$ @P om<@5i<@$P 4o + 4'$P yo@s8, PO  cI _p = __! L/0H-@PP T)  R 0S  R:R |R Q A R:R |R0HH H0 0i:T(( (0 0_:%\0H-@PP T! P   00000H9HH H0 01:T(( (0 0':EgYXXXXH-LP <000 0 000(XXWWWO-MM┴X p Yy |DP@ l$ hhtR pX P @P 4400Sc @$  P   AQ 40 000@:R#R)P\@o" S`PU P:|#  P dEP TP HQ R  R\R   "2 0y9Y"2 0n9{2 0 ` Q pAQ\Q p@ P\RPU :Q AP   X`P:  PBa 0P`  R :R|R   0@P 4P ` `PЍۍD}e9W|WhWXW\W>9TWWxVtShUPV`S*8DS VVV(} U UTTDzy8TSSK-pPP W Y U W @`P 0P:P R Q 0 RQPCR@Q =Q@@T ddpWP `]T\T P:P 0Q-0@ 00Sd 0@00S_0@Pp@ ^T P:P @PT:T P@pW@FdP `dp@]TB@P2QE @:@Pp@@ @ @ @ @@  ! 1 07WA!1 07Y8 0 07U0 0 07W( 0 07FW V9 VP 9 >os !K-`pP1 V: XC WL VT @PP 0p:P R Q 0 RQpCR@Qm =Q`@Vh dd@CPN Pp@!1" 0]7Vpp!p1# 0R7XPP!P1$ 0G7W00!01 0=7V!1 037`@T @Ed ˈP$ Pd@`V:V EpT 8  ᳈P Wll l0 0F7 fUqE' uM}A(A-PpP4 U= XF WO UW @Qr `p:Q 0S R p 0SRpGS@R[ #R @RU 0R< xP64((!(1q 06U!1r 06X 0s 06W 0 06U 0 06 0/p0`C V:a`CVpV:A`C6pV0S0" ). O-MMp@PW$ "2 0EC6P *( /R*P,D 0t  b4 `I#bKP``$pN4 ($@VQ:QX@`P@F` P0 j j j=K$N ;' K$N/0 ,K,D$N `Y  jz7P @PFLdL:P `  P ؀ `AР Bp+ ^j($:P4 ~ 4P 67 37P/7H$PKbnqIrwkH-  !kMH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 j QKHЍ/(kxjO-$M`xxrp ` TP"  0 `币ILPP U: @ iP  E p  p+AP\ qp X#p &Q!&H@v00 P"3q"  Q$ЍE8 P9$ P2 @P QX" 0# " !  P PHP  #P* H "[ *,pp P $Ѝz@XjD hiH9lCdS H-8J, , 3Bz9E@-M$@;0@03P@ЍA@ /  + A! 0  /= @ /  + A! 0  /=@ /  + A! 0  /= A@ /  + A! 0  /=@-0M@Q 0  !   0 T 5PT ,0 0#0ЍH- M {hP ЍH- M khP ЍH-M [hЍ i i0iG-M8pPW2 U: `@$A Aa孒O֒dA`A\Aqpq'pp 0 0N3   0qtq@P!QލcHH H0 0G3U,, ,0 0Hz3tdK~/0 cp@-P@`+( 0@,pcH-`@Pp+ 0@,O-M࿟P@p UM WU 0 @Q@,$8p`V]  .@P Q AQ P .P%Vp@` p@WzP2!h  ,p,|8DP0`@py@pv@ps lKpkKphJpeJpbpPSPVA%LQ AQ6P .P%`@ @x@u(``-^[ ` @2[ p)0<0<- 4 p-Q*-0][ 4oO `@PJpp W  pp pP<-Q ]Q0  $$    I II 8PP  x- q-P @PPYi \PV`_Pu  0 wP iV`Wt -΍ DQ %  0A D`V P @PPSQ  0 @BD D `VD @Qw ,V`!S @ D@ ,P0A``D ``SD PP DDH,,FPϐl# MD`V +@MQ ldlddLLLLLLLddddddd888888ddddddddddddddddddddddddd888888ddddddddddddddddd8 QGM+8 M8#@; @@8  BR/:M  ,  0$(D Q%L88QL M8 MD D @PjcPi  @@F Tl#ϰ@04  (( T<@D*<@`+Vd -Vb Y} $4< <+VPIF%P:$$4  +P +P0VK0V_ xP<( 4<@( @8Qʔ V VQQ @(@( }P?4P aQMdVEV PV" M 2+ @ P_< < @ UpV eV74 @PV 5( <4 @8 <~ <( 9( @ )V  *P@ _V i  @ nQ b(V( @]4 @  B+P < 4 Lb *PC < `@P`4P2(`T<@:- pFp @ @ (`nP4a  <a(  4  <@Vk`F@P T&-Q/  R} @V0A t QP *@Pb@` *@`PWY0A  QP @<V7 ň[ AH` @ Z/< 0Bp `P p4 ` 4P<4P< `F<,@PP [4 @,@ Z@<4VB |[ AH@`  /<0 0p P py <@ `<@<@ p -P 4 ` 4(`IP@<@P*P [Q4@T` (еP ,< @< )P6 4P<,,l \ ;;(`@K(`V*TSV:@V + z bD  aD |Y@ T AH(` ` .<@ 0fp (`P p <(`< >P4`FP<@<PP q)PV@q ʈ#3 0-@@D | XPDP,,  T@,Q[> 0`@`V@T4T ,,<8Dq XRD,D 8 0(8 0     0 0 0 0,0 0,D H$$ @T @i`Vg@T T * 尀 D Q%    0 0,W 0 0,@x $P, QADQ t , Rߍ-롸Ը(YyQH,OExMdMpMb 2 MXJ\HO-M@Q- y5 P$0PPc  g"P]0PpyW `P EHH!H1 0`d,yB  RQ8@<B,@W P}P) p  ["0pP pR zP   JJ$Ѝ7iH-MPp$lVPdd d0 0*8@0 4/P @+@Ѝ8@T0H-MPp$lVPhh h0 0)8@0 4/P @w+@Ѝ8@T>A-p@PK+l h`YT  >< 0  F'=0.^p@-Md`(P`@ @0$  0  Q CQЍpc;O-KMH`P@pV((8 0v)TU X ``(`8 0h)[@@(@8 0^)XZ:* `zPf p rzzP ^ QozPg P!XpIPpp() `Z! (W pZ* Z # 0ᴂPJ P!PpPpZ:ZP`$ F@X@! A`-zP )T%$0  łp ᝃ`$`p `P P `4F@ ~Fp@$V V`PQ   #[ ?0*``0   @ ^ ~@ | D!)0$ {( 0<('0$\]`}@RB`  0 H"><&`;@RB    "@\d$` ` `X @  6/P X@ P P$Y:)(D`@p { { {{(PKߍ)C`@ ((@Y P W p$0Q+* @\ LpRp( Ɂ`P W Pg* ( PpvN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%* ' 0 05't;P}(U8X6H t 6 5338dզ'@mIڦH- Mlp8`"`, ,7"$ 9Up(" cP0 , @/Q/0 \ K P(0U$PP"$>Y"!$H-M,`0@pPrTPp$ dV`p 8  "! @  "!U`!t!@T!@`ЍO-P PQPOPP (z(o ooB@PPЍۍvnfs4`Ś0H-M PQ@p   P  =Pp  @Ѝ0O-M`$p@ KP Y  PP@@ [:*D 8/P5@ [1*D 8/P,@ [(*D 8/P#@ [*D 8/4 PG@D@WW< PH 2/P@ѧPp:H(@,p4 ,4 $Hp WD8/4 P p@@<YDIH t% 2/PpY(@,p4 H  (@,pD P 08PP  Z:UF@T? Z:@T408PP  U:ZF@T  U:@T`FJQ 0P U:U:P 04 P Z:Z:V `jLЍMuuu3utJX=qs&WsssLsEttp@-@8P! (/v `V PPU 0# "  0S/dP* P!` P 0" `V PPU 0# "  0SpdP P!` P 0pP(upp| H- P@U !P `'p&pWdP !P  0p@-MP@P 0 0i ``VVV  0P#" PP(PP P QЍpg7g6eO- M@P pRR$$1  0  Lp! P J `0`F`V @ 0 T 0S $0 Ѝ0H-@DP (4uP(.u00H A-@Pp``P (u`P  % ( u xP p  `P VVPP p@-MP@P 0 0< Pl` 0 PPPp`P P[P`Ѝpc$dkp@-(M $ 0S, @T0 `      Q`PQP1P`01@V0S A000SA $ Q(Ѝp@  RRA$ Q(ЍpG< # H-p0PP<    'bH-p0\P L@ <r4,, @  t aH-pP`P U W  @0QR pW`TT T0 0? U88 80 0@sqA aZaO`2aOp K-PsHDPD 4 Y ap 0IA| TDXO@ P@0S Y10! @ P@`p U W`1S!0!U  B`PPpPPp1S10! R04Ks_ NH$ O-Mbp@`Q"2Y 0sxQ pl" BB!!HPW}:PF W*,,",2,r,b 0p`f@W P*0 W*0 W?00333qQap@`!$$$A P0 p`AA 0\L? PHT(XH`V0p @aPR` 0`0P0! !P`S ``1P01 !pW p CAp P 0prЍ_ NG___`$LL؂(T\T0T0G-<@P,,!,1 0Pr1!0ES  ```FFaa0 0 `p`pQap @ pQ0@P` 刐q pdd! rȞ?\\\xD,,  0H-grP   0@P@0S   1P1S! <, 90:2!QP4;r0mNA~h~~~~~~~l~40H-@P`` `0 0AFP PP {@00+Z^Z`A-@`P 0 0V#P PpP WP  "PpP*zPtpPYY%`p@-@P P@`P U =Q@p=Q @p @-@PTT T0 0@P @(@fXXX||0H-@n`P P$ @00d|0H-@PPLL L0 0{8mP Q#00W8X%X|O-M⼑@ ZpWpXa ZP fxZh! Q*PM XKP`@q@W   KP=P8 P UZ e   ``P!2  ``P E@@ P pЍ p`ȼ$K-8p ,p R  Q A@PpQ P @P@PV  `P edQ eXX  4  Wػ y\yDyԺ̺K-t@TpWP`q`FW   ᏾P=PVl K-pP PP `=P P@TpApT  aP=PWJpp7 @-$p@P @o(w@-$p@P @ov@-$}p@P @ovQ3/ BR3/  /K-`V p@  PF4/P  `VPG-@T `p  PD9/P  p@PW PGG-@T `p  PD9/P  pA@PW PGO-MpX @ `H 4/P  PU  `E4/P  0P0 J  00`pp` 0X0  0  X[ 0 PpWpGAorT`OaY!`PW````児Q` ``QP1`%@`$`PaP%PPVP  0Q0    1` 0`Q`   Q   ` &P % 0!0#0Q0R0 W Ѝ\ 0S  P pWAT`pGor K- 0 DR# V#  pQ@`$1 Q<  Q BGP@U@ apWW pTpKV o"p`P@VpH  ppWQ  P@PU `T  U   A`@ "QPPQUp@oobQ QQQ`p ppU  " `Q` @@ qqPP PPP@P`PPPpP``` `pWppp Xp{@-Q 0"!R !R @Q @ R @S R AH-@1S0" 1PUPPUP P PPR   qA S* , ;@Pp0PA%P P A@$0RS @\@00 P P AT'AP@P aPa` 1&` ``A&\T 0R00 A`RP`0aP`%` ``&000P  \ H-00 ,B DO-M䁟PQԑaP @pAAV"mOJmZ_X`TAXA\A|xhpm`哐 p PPQ) @XPP[ [P5 `7N P`Xqq0@l0O m0PEZOX`UTqXq\q0 A D<#mЍPP(  l 8 A-@儀xP@p`qqFlOlZOXPTqXq\q,( ( , K-`p`FV+PfU[P PXP$``PX'0@al0Ol0`FZOXPVTX\ O-}MR(Pp`z^Pn @t^Po |?ltpP ddd"d2dR 0PP0 <'l4P  00B<`0D `.0`@p0P] 1/`'^P8 ` H`.0BP H=P LH1/~@&~-`@`PPLQ H1/~`P ` `tP@PP}ߍy  AA  4 ` AAd AA-A;A p@-M@P 0 0Z $` P.0CP  P  1/88O`Q 1/Ѝp@@@a@?@P/ iH-MppLKǹp KfB@B`PBp@0K `S0L!Qލ-  h/0H-@PP T $! 00H/DD D0 0 T(( (0 0 >+?>>??p@-MP@P U P4 0$` PP K_ @P  0 0 Ull l0 0  "00 /Ѝp=i>>==>G>H-@M$pPP3  `0@<@,@k(IP @A `@ (2/(7P `@ (*Q 1/@@Ѝ0H-@P\\ \0M 0f $P^P ^$^P ^0H^ <<\<0H-MP@P) U1 pP  uP *pP %pP  0"QЍ0Ѝ0DD D0 0G U(( (0 0H ;;p;;;W O-Mp@-p`P8 @( TQ P.W T" ,P 9/`U* pPV`P PT  \pP@@|``P*^Ѝ9:K-R P`p@9/P p`VG-M@Q `PV V4)p P i@pA 0`Vp `Q  E@`P6 v'U/ B@p)& .`#0 +@p 0 @PJ ` ` 0 @p PЍ H-$$    @ܨ 0 S: 0C00  3?0/0 S : 0C01   /0H-@ PR08B   00H-@ PR08  B   0 A/ 0 0SC ///0Q//0 S: 0C00  3?0/0 S: 0C01  /0 S/1 0C0 /0H-P@P U qP  >0HdrLL L0 0W U00 00 0X} 055 555)0H-@PP T  0HqDD D0 0g` T(( (0 0hV #5f544>5I5H-P@P# U+ T3 U; q`PG  >rP@ pvqP: P. `P4 H/ 0 0w U 0 0x T 0 0W Ull l0 0X oP H o4z4|33R4S33,333'0H-P@P U !qP P PnP 0Hn0TT T0 0U88 80 00Hp2&32223p@-MP@P$ U 0 0nP `pP P p00 4rЍpЍp$$ $0 0|U1%20222x H-P@P U p`P 0 0XU 0 0NanP pP WnP RnP HLn11d0011p@-@PP! T) P0 P:`V< T!1 0FPF(DP\p@@!@1 0IT$$!$1% 0 `T V Vppp 0  0Vp`p  p p p p/j0Z0w/>0D0/00.// @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q W T 0 0:cW 0 0;YT@T!  0S  Q@Q  0PU 0UR  @(.]..5.;.O-MM(Z`pPQ00PߍڍKP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0  W@TJ P T*0S; (I HPRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8/||`2 0|P p P0"'00p @p P P20 }t&w00p Η PVpP Q:`&6 0 Თ P`J P^*P&P6@pI 0ᢗ PPOJWM & 6@pG 0ᑗ PP>JW<%5@pG 0ဗ PP-JW+%5@pG 0o PPJWl%l5@pG 0^ PP JW 0%05@pG 0M PPJW$4 0@G< PPJpTpp[ `@` H4Z@$00  pPJYI`p [f0pSa #? Ip s0P|J P PO:x0 o 0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @$[P' @TpP P 9PpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @TPJp P:p0 <`"eP 0P Qp pP0 P  0 ePP p| c*,D+& 5$L *Ȫ p$3$DC)t)]<['l)X]()](\(\\(H\$(\G-1MpP@ `W % V- T6 C/4-P PQ4 @  b P < @0P* PTV `P T8< @0/ < @0P# P0 `Z0`V ,,P$ `V PpW +;u 0>,P P P P  P ,B SPP P |TGP @`[PG8P 6,(帪<0 P px P `< P9Q QQ   QP0 S p SRQPSR   @0@FP 0O 8)9B 0v0@P" ||||A< @00P2@T PPP<AT < S@U PP S <0V `V`h`f X,R 4Q 46P R[ `mQP @B? >PJP MP \B? ,p0@@`P H *pp@W3 HP U0PMpPP( Q @@USQ@JS R R RAQPQ;P 73SB( 48 4[% @80偢 @<y4@P P?B    ,  +!AܐY& S Y @<`,Pp00P@pU*P  RP pqʀ0P<  @PdP_ 0vQ @0 .5PxJ P3PpJ   5pf $PP PE B<<x      +!A R) y T R <`,Pp@@PpU*Q 00 SQ q0sʁ@Q< R Rp 0x p 0 BaP@P40pRP PP$PPBOc >4 4P03810@`0 ( P`V Q,P Q @@QQ9QQ,Q UQ QNPL@QIi h , <  h  bx ( û @-@ sOPt  @ H-P P R  R' R R.Q*/0S  PPQ R#p R QR RQQ Rp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^0 S D0DPU S K-M`p@P W RTT!T1 0bWH PPD PP9*P  OP P PYJY'yP 0SS 0 P X QQ P P(PЍ%K U 9(O-\MM||0lX0p0 pp0000 0$0(0,0埏@Xp P W T#3A 0W"2  0Tx@P} *0PPw *0PPi #P T sP 8 kP p``W PP P P P V`UP pp ɋP8 8 40lP4PU4 pPU-  ᬩP4PU!1r 0YOPV `P Op@Z  ZQ4pT λ ,QdX Q\ЍڍnSt EP$RDT::2- O-Mp W  PP @@@ N`PP PVZP: 8tplhd`\XX@P3 XH 0\X@P' 00  PJ !  0fP t@P@T^X@ OP$ H 0(P 0l  PJ !  03P Nd1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@TLPF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@7h@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@Tg@Q507Ѝ T K-XM,PcxP @p8pP0V\5 $R2 R1 dV.z@(V%h lP QPo PPph   R P&P# pp Wpp Q  p WY P 0 \ppDpp Pߍ0c E` a ` ` @-@PPP P0 0$ 0#EgܺvT2bK-@`PP( V0 !>?p㠑@piW   *)P*#@pP: D DD D0 0`V(( (0 0VBfmO-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b P4 P% ``Ԑ pp P P P @X   M>P q fP ``.P*PGdD0H- @      ?0PPP?(0P?(P,P00H-P@ U 0A-M@ P( -`F PCp`0? 0 @   0pOP0, 6P& P "p  $ $ 0 `P $ 0$```ЍO-MP p`@ ,(Q*=P (,p (`W:qqW  Q:0 0 0S s@Lo@@Ѝ `Q V:pP, pV `9 ` `pW* W:@V ᅗ75P   r$"P !O-,M@P%5 0]s(0 |PQJ(<9PM P\(0 kPkJ( @$PPh  0Q^*0S0S S0  0p `C``S`p0∀R 0S 0 p@ `@F@@V@@`   `PFPPVPp 0pCppSp@`D``T` @PDPPT`Pp  Q $8P b@(@P$P0`(`V*PP. P   ἐ@  pᝰ @PpD 0 ሰ pZ Pz   p   A  Q   @P  @@P   w   p 0   @@P@  _ 0p P  @@P@  pG0 0Z$ 0$P@= DQ* y= ,Ѝ g | { @-@P(( (0/ 0@\=ꇾӾMH-M@p/ ` p PUy 0@@ @`pw <00 @P@ЍO-M(Q:px P`P E@Ѝ<(z7 @$Z  $ (*PR,"P(P-Q(  KQXᐋ ` pP:P P!* <PY& Y P1 3P1A2P1A2P1A2PP` US @ 0U08`PEU8PPE9P R R P1 3P1A2P1A2P1A2PP` US@0vU4:`PEU:PPE;Pk0u  /@- @T ,@T  T  Q*! @ Q*  Q:@Q A G-MP$PU (@0 y 4@: dI`J0;p62A@A4"0$372'- A@J0IR@ 0 R 0 "00008 090`@61@R ,0S SQ*#Q*Q: Q Ѝ0 0AЍ@-0@S 3/@;H-Lß) QN: @p`P p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T( QO: @ p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T,@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T :@! !0$  'T:! !@   DR@!(    T  ! N  L$"pA!p@! p B("pA!p@ p B%"pA!y7f f 8f @-@P,, ,0 0/s @YĴO-lM0@< )pIXTP8@Pd)XP`TPdhPH  0kwH`q n8| 5W`ll2  0+@岰Y*[[ [ [ <[ [  Wa1` 0+TPL7H`P 1pP 0QP-8PQVP!4P 0a `P 0dЍۍO>  vpPPW 6`PdЍۍB> ) D UX ) l) ) G<# # ~,1z4( )!n(b!)}V)w ծ# H-AMp@`Pp 0  TOPJ` P .^ $QAލ(" H-AMp@P p 0   ,OPJ` P o.6 $QAލ! A-MP0 @ 0 O`PJpP Q.Q Q.`ЍK-AMⰐ@  0   N`PJ PpP Q.Q  P.T ` PAލm` p@-`P@Q qP  @QUpH-@`p(PU Q PU R( \ UTb#p@-@P`(Q  R  R<l UTpTp"0H-M@(TPP   PU RX hU$P @PP8P80P0 @)Ѝ0 V">.0H-M@|(TT T TPP$T T PPPPPPdPPt   +U$P TPP4P40P0 @)Ѝ0`GJ[uqf!Y0H-@=( TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01\ T000000000p0P0H0H0薤(ߤߣݣɣ@/0H-@z'Y\ x'p0 ;T0ϔMp@-8M`HP`@I4@PH .0JAd00. (@U PE A04P8Ѝp@Ѝ/ O-MP`PP@p0 RQS QS 0@-T@0+T@0@ P.T )P@pQ10p0PC00A.T@pp @ p!p5 p @ !.Bd0X#"0 p0@` Q *PP@00@`UP:A) Q 3V Q*``@V 0 30@ V`:AR 0P @0P1`0`00C@d`.UP`` Q ``e   @ Q  P* P „ `V  30@PV:IU V * Y 0 30@ Y:@R  0@.T P+ @0@1``00Ad.TP`` P ``x ` !.B!.AP` Q  P*~ P P@T  30@`T:EV T *PU 0 30@ UP:@R  0p.W p% @60p1``00Ad.Wp`` p `` !.ApP@ Q  P*p P B )T)P)\` $ 8 |`+ ++d PP@  `  0pЍ t pN O- (40`00pppPq@p`0pG`rg``p@@@ @PAp@`0@D``R PP@ BEPF2U<`q prgqoq' 2U c prg|`qbFaq& G2UX`QpTTTTTTTTXTTTTXTTTTTTTTTTTTTTTTTTTTTTTTXTTTTXTTTp PR q`p0F` `.UPu``( `dPpp`e PPBpp@  @ iPaT`p pP0EP E`PP@ 4 `PP@.@`  O-lMD Q@@R l   Ͱh   c!51 B(4r 0! c51Aq(Rd `Ad`\ X TP LHD  @<%$p 0P a@\p) b%!AqbdP@Ԋ$p 0P a@p* bd%!AqRd`@᱊#p 0Pᤊp`W4Z Y ,<0@ D!HϠ0R0PQb$ 0C(01L001P T 0Xp1 0cEPW@#o  C @!bU`F(VFWobUaFaQA: \h0`0d0q!aN0PS00@7SR?2c1@P@SRR/"bQ@ RABj/P(PY C0Z ?0W ;0lЍQigMbsEYJ E D 'lD 0H-@P  0 .SP Q0* B/o"0 PAP P.PPu00$$ $0 00-cmK- MP#Pl]0 ?;@@04 P_ `nP% ЍH-M@PkPK kxaP`F tkPB `kP> LkP: 8kP6 $kP2   `pP,$ pp .`PV3opP $0<H`pTpvЍP o ȏ ӈZH-M@`P0kP( Q PpP qpp f.PiP U3opPpTpuЍ  p@-P@Pu`Pu` V Pn`_p 0R0p0Rp \ 0 /n0H-M@tP 0Q P+Ѝ00H-!Q  Q  P@@PP PF0@@yP!0    l @-@@p $,X0@, 0 0H-P<@p ,00H0 p@-`@@Pp  0p@pt H H-M`p@P|p 0@<8 40 p< 0ЍGЍ H-M`lp@PRp p8 03ЍGЍl  4 / /  H-M`Tp@P p p( 0ЍЍ t L H-M`lp@Pp p8 0ЍiGЍ$ H-M`tp@Pp ,(p< 0ЍDGЍ @ X H-M0  0Ѝ H-<p H!G  0 ;P G- MPD`tP@@, P    H0 Pp@ ЍO-M M` PK⨫⤻ {Pd k!PT  D p$` $``P `[  O!PrP `\P P .PP`FP Va V*  p  @DK[P=P.P T p T.@DK`⨛VB*TP(:fa P P嬻[ ` pDD?07/K `FV P*K 㨛T Dp TuD  㨛 {K  PbJP[` W *?0 06/ @pG W . P*K 㨻T   P =0 p7/ @  圻t}k pFP@T<4<4"<4 ll l'<4TL $<4L3&<4<41<4,(l(<48<4,,4T L T T <4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4.<   /$; P Z.P P PP`V`F[ : EDd 0 p7/ @   [ : D@ p D`  `?0+ d `@ P$+   P*?0 p7/ @  @ Pj : C \?+ 0d e@ P+   P*?0 p7/ @   Cx?+ 0d .@ P+  s P*((?(0 p7/ @   RCd >0+ @ P{+  = P*``>`0 p7/ @    /$;PMJ> :P J P P<:  Pdd?d0 p7/ 0o@  `  / ?PJ~py +R    P>0 P5/ @V   P< / ? PJ@? A@ [7 : B + p+?0+ d -@ P+  r P*00?00 p7/ @>   :P JM@P JP  P}:  P?0 p7/ o@  ` \ > U̅ yуH M d ?0+ @ P;+   P*>0 p7/ @d   h>0+ @ P+   P*?0 p7/ @    Ad ?0+ K@ P+   P*?0 p7/ @p  p Xz ʰ +l @X  p  d  0@ P  A P*pP?  05/   P* ʰO _p  @   P*  00PJJ7  P * P   Px  `dd?06/ 돎 _ /$@pk0 kPJ P   P?0 + 0d @@ P+  E P* =0 p7/ @ V  ʀ 儭+\ |@`V    d  0p P:   P*  @ <04/ [!}}l >, J1R/0 SP PyJP  P:  P?0 p7/ o@  ` 1||| 6=U{{ z}zz $` [c  d ?0+ ?P P+   P*>0 p7/ @   pW- wP J P# *P@  j\XTPN+;2[h@ P*LL?L0 P5/[ @W  A yy xx+yxy   /$;PDJ P=   PPP>P0 p7/ @`  `  > > K > D [ @ P *\ \=\0`p  / ?PJM  ;vQww [A: >d <0+ =@ P+   P*x x@  0+ d @ P=+   P*PP>P0 p7/ @`  `  P *+\ :t$u [u;+1[@ P*HH?H0p 7/[ @  @ ts@t X  =@  = +`?0(( @9@ P(  ~ P*  ? 0 p7/ @"   J1R/0 S[U:xK L Errwr   /$;PmJ Q*`+\  Q$L  qqq$ Y? P  - T=d 0p P6   P * @?04/ @  Z   pPq$ $Q:c po@p nno < emmVUUU 럎 _ /$@pk0 9PJ P   P>0 + 0d @ P +  b P*?0 p7/ @   F9l?+ 0d @ Pi +  + P*?0 p7/ @   9@  9P  8?00 Qaa``\ [: 8@  8P  82 ?0P0~@ P P   P*?0 p7/ @    /$;& P1Z M__ P@ ~᱿@ P P   P*>0 p7/ @    @ %^^p [s*~p>+[J0+ d P P{ ` +L ; P* =0 p7/ @   P'*ܿ  Y]] [,\@    P *t?d 0+lPJZ Z  >Y@ @PY p   >pPTPE P   ` P *P `p88?07/ @Z  `x P )  P  `p>07/ @.U  `K⬋/*X:.eQ   P  `p?07/ @PE U `( P*nYiZZ X   P  `p?07/ @  `?+Ld 0ZY0` 0  PP .pp0S PupWZ.pYZ `P@QC    P* p?07/   @+ i嬋 K" $P Q L[|: @✻yX$Y P PJP P :  P?0 p7/ o@  ` P*W04/ @0U   @0@PP  ~ P*  pxx?07/ YdXo`ʰ PSS\ 5RR @0 0PE Y  qp P  B P *  @>04/ @0U   @0@PZP   P*  p>07/  AP P8:)  P =0 p7/ @  wp[~:PP Q OP ?OOuNN [m:?0+ d p@ P+  ᵽ P*dd?d0 p7/ @d   >0+ <@ P+  ၽ P*?0 p7/ @d   l?0+ @ P+  M P*?0 p7/ @   PP @ L PT:.  P?0 p7/ @  D@p L$M LL P$-  P>0 p7/ @   3P`  P  Q?0 p7/A+ϟ++ @K0=+,p`==Sx*@K0SrP!h Hܿ !  ! qKK P!  !%#       " t, J8K P!  !%#      P "%"      UL\ P!  !%#      P "%"   P  #   "!    ! - II P!  !%#      P "%"   P  #   "!   P !"      *[U*Р+JPEK[ZS+H:*@K0CSHYhn`ʰ PHH̼ xG @0 0PE Y g׹p P  ᨻ P *  @ =04/ @0U   @0@PP  ၻ P*  p?07/ P F\G@ Q2* P:  @ Ptt?t0 p7/ @    /;~pElF@ Y% P`:  P>0 p7/ @  <>00~ @p ~@p"@YJ n`ʰ Pet DD@0 0PE Y p P   κ P *  @?04/ @0U   @0@PP  ᧺ P*4  p  ?07/ ط mCCݜ }BBL AXBuAA U   P>0 p7/ @   PD. @8>  @0 @T1+R= B0 00+@ PtJ@ P* =0 p7/ P@T[⨫*U@:8ʰdA `  ` P p <  07/ @@D T  P*@T*+\   R$ K @ @]@@ ?$ @T< P  - i?d 0m p P  Ჹ P * `?06/ @  Z   $@KT: ?@س ?;+#[᝷@ P*?0 p7/[ @  +>4? ;+#[p@ P*  ? 0 p7/[ @   =\>0 =%==p   /;POJ P*J`-1R/0 SP @PJPU P4:  P =0 p7/ m@  `0<<̰ Yk P:  P <0 p7/ @  D====YAl`ʰ P |;@0 0PE Y Dᴶp P  ᅸ P *  @ <04/ @0U   @0@PP  ^ P*  pt t;07/ Y P: Q :0 p7/A  m 88UZ   P 90 p7/ @   P6  @)  /+@ @.+R8 B0 00+@0PJ@ P*80 p7/ `@Tkp{C*V*:ʰdA   P   P705/ @@D T < P*k { y777x7L 666\ 555V   P70 p7/ @  Q\6+A @0@+?.+Rk5 B0 00+@P_J@ P*50 p7/ P@T[⨫?*U+:ʰdA `  ` P p\\5  07/ @@D T 8 P* 4$5| 443 4 ; serial e22 D 1$2U   Pxx4x0 p7/ @   P# @3  @0 @-+R83 B0 00+@PJ@ P*``3`0 p7/  @R+  P20 p7/ @T  娛[2*U*:ʠdA `  ` P p<<2  07/ @@D T + P*[U5   P10 p7/ @   P: 0 @ m ,0 aڀA 4dPߍ ۍql뤤 900VUUU ; refrestry ; expiry; minimu*x*L (D) 5'' ((&&\ $%Ԙ ]%%Y## "P#$ m!! "", - *+؞ e// .(/ a-- X,х +,X *d+ O-M(`,@ P0u+P:J@ pQ pU `Pj Q p\Q Q .QQ pG0`,@Q W UQDQ.Q  R.p Q*p+@p  R *00 P5/ Bwhh h0 0ؾЍ.Q Q Q pWpGd8 O-M`P@V:"pP TT2T0 >Zdd!d1 0?4LQ*0pP@`qP  Q8q\JPqP    0PK` U "V PPP`|`PP |PP 0`F V``3 `Q `  X:Ѝy  Q   ~ } } ~ A-P`JpU 0 0gʹX Vx@0VP`. Q p`07@V0@3&b``7@` V0@3```@V@ õ   /| o/笯| ///~O-TM`2 |#$0plu ` P Z:8 P<32 ! W0)PPH P $k  A$`Q` 2D`p02 @ Pe  Ip  %GX <2Hp02 @ PG Pr I P P@QAU 1M`02 P@ P( pS I p p@JP 4Z[XU 0 P$1S`02 @ P % P&Ԑ P @RP  00P ppWJppp pAEP QTЍseE.‰%I$ųMn: { mMmx lUlx k`x y y H-p@`ǬPP( U E  APEq 0 .S R:0pS\WR: S\R   .A-MM`P `+@P J +PJ}GoBPЍۍ ev @-Mr @ 0IPJP*Ѝ Q+Ѝ$ep@-RPPp@`PP  p@p@-RPPp@d`PP ^ p@0H-@PP  0Hp@-Q P@=`P WprP 2 p@0H-P @PP :Q DP [0+0H-PQ" RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0賸00H-P @PP  D`P @00  r O-M-MP@`t@ +p@`P P P P p p p |@x@:&Bo` T`P@4  ! +W4 v< f@ / !  W@,T <  vo+,Rj@/` <  X`P   ! W4/5vGfb |p! P  +W/ `V/4V: x &" B@OPpL`N\^NlpW DP9 6 P4 4,DP. 4,DP),& #x|4jP:PPnP KoPTʛPP8P_ Y <4P |jP*RBk@x= ( 1 x|#Y' Q8`k !:BjfQ`c1<0x S `R'620CPr x|4T 4DPk fp"x qx 4|<Q jP*7P9Q 1Y/xP|<Q jP4Dk x xYH <P\ |4 jPV@j @ Nj j 4 `l^l \l ZlXl<P o 0 !  Q"04,DPLHj K f`"|  @  |x8@pPxSi <P |4 jP@j @ @x|4 0 4i 4@ 1@  |xY$4 ?8mP =n$P4h P9||0df A-P@pW )`P P ]PA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0CsDD D0 0Dk00 00 0EcL,e E0 0 |0H-P@P P Q080QQ R:0088 80 0e,$$ $0 0f$0@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Qd 0P*r-w--xO  0vS-S rS  wS xS S //H-\:+  P/P/ Q Q/@-@P ᶣAQ @ R RP///o@o"/ /o@o"/H-/RR 0 0p*4H-4 /RR 0 0pP/P PQ/Q /H- AR*Q *QQ 0 0pծ(H-PQ0H- P @ ZPtPrP nP6jP@0p@-MP@P 0 0Z㿮 AP Z`K`IP ЍpQЍp^P/0H-@P QQ P:PPU:0HH-@PP\\ \0 0o`V pPޫP p`VeVO-M[# Pp@aëP @[X  P*K! !@PK ЍH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0[ P+ Q$ (xL`( 0 3vq:& 3&!%   0Ѝ Q A a Q1 A/3` Q3 A/H-`pP V P 0P@T PT S00DD D0 0L|V(( (0 0Mr~ڱ00K O-Mp@P!1 0?W PT D P"PX]`P+V -V `0V p0VpTp xP0@ Qa@"Q#;*Pp`@PE" ꯮ `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍЍA@QcZy00I O-M`PpP"2 0?ͬU E"P ^ XЍ@ᐨP+T -T @0T `0T`U` xP0@ Qa@"Q#o*`@P?U  p 0在UK[ [ @pI"  !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" S֭! @T "Q/@X QppЍA@Q{N2? rQJQ H-Y MH-M  lЍH Ѝ/G-`P+ Y3 E0@FQ`V kP>`pPVPt.  ᏢPF  @T' 0 0BͫY 0 0CëP@F ס O @Z lTp@-@P@ <`'>U  ? p@E p@-P@ɣPu`Pu` V P>`,p@-@PPP P0 06Z㠣 `@MSH-M?  t ЍG-MP`0P& @V 0 0+   0 P p۬ 0 PѬЍpЍO-MMCp`P@WX0xx#x3B 0`Z Z PPPP\U zu/q. PP 0 <Ppఀ Y .YQ  .Q P.PF :Y  :㷞P:Y Y  :Y.Y Y Ⰰ  P.P%`Q `,P\($ ὞!1q 0 p e lAQ@0!QMߍ7W A\`@ Ps:\pQ\ Xj ` AXXab:  . P! H`X `XaxPXN:  L`X   H VdA  1 / h1 ? K-M@`p4尫P P0 0@@ḫЍЍK- Mp`PPhh!h1 0HWV W /@W 1P 0S, R*PP( p@P 0D@@ 0 @Q  Ѝ=@ Ѝp P`pP P tl. L. 3 O-$MM쒟`[ "2 0s PN Pkp0" p:1P_ pPY ` 0p@ҶpZ--  0`cXU P p@GP:p  GPW T QC۪#`q`@Pp 0D:P `V *PEu +P \  $Q$ЍۍUO᧪ @ᡪ QQ ኪ `; ;(G-HMDPX D((!(1 0୨`PPM&P!  .0 P `p`U@`p Ϝ0 S&Q   @T D QHЍBUH8 ]?? >O-,MP@Px P(p .`P}  0p `Pi p  0 pPY  P  @P4 PɩP ` @!QXCXX3M@ 0 83N 0  @0 0 0 Ჩ`PP PPP P PPz` ?P` p6 4h,Ѝ4P% ` ` P P P Z:  LP8 J `e`P  R @*P@`  B `JR:BT  ᜝  @HᷛT@*P@` @Fᄝ@ V Y @@ a᚛PX:  nH@Z` P rX bL\K-MP@P@@!@1 0(Q `Q6 P( pỨP" P  0p`Mp   0P ^ᶨX  `P`P`P `ЍG៨`O-KMM`Lp`@Y(< <,<< 0ǦTUV ,< 0㼦\WWP(P H`Xe X`zDppP@P \P p  0LPJ@P @1/P L RDP4 DHp0P pẚLPT 0p`0*p@TPT$P R*<@@D ppP0@JD`4AooP8PLPHP<@4 P$ L@1/LP 8` P<@,HP5p2@/P RLT,GoTe<@P( &,P8   '0/P|J@ 0p@'1/Pl (LPZP `V*L#0pHP<@D PWA DWmWW5P 0 %7 P @jP F`L@ `P4@'@pGP0`P-' P۔TL0pHP<@( ,P8   '0`PJ@ 0p'P (P'ÙP@ GT'⨔PL( @LHPGP09X@D#` ` 0% @( L0p P/W ,P,P,p 4@0pP@y@$ Q*RX*,@$  B LHP@wL0pHP( J WTHPR400pP \ %oL( 88, G ,@PEJ` =P= ,(LPW4P7  Q : `  ~P A`L ",L HP<@ZDTB8R?*0`G p @@`@DP|Z3, L T``P@L( 44L0pHP( WSPL lC@L4 PLL04P `$dPV:4QSDQP4 b 0Pp0pS QhAlQPT  V Q S PRQ& 4Q#P @4Q Q0` pPP @2`@pG0CPW P0 `TUP `ZPO@ JTJ? `   @h F J@Q* @@   ` N$ 00@PB@ JQ*?s`(P KߍۍPP0.Ť0 CI,X0 & ' pc,% f$ O-MPp@P88%85^ 0Wp W (i`P ` `CP ` cP P P ` P P`<$P @ @oᠢ@P ȠP Q : P  A  ` `ZMTY ` P%H`Q*  P  @``଒P ` `!P#XO#`P  R:0 BpC0R*$ U ߍB@Xp` pP` R?Ῐ JAP@XPpՖ`Z*PP EᤘU@ X@JPq἖`Z: ᐘJAP@[ PP ` l6LDK-MPP 0  0C`PppWP( pp@U@@ m0   Q  f@ xT ЍЍhl%\%H%W`p@-M@P`,0,)0 ЍpT$p$@-M@   9Ѝ$$$H-M@PpဣP P0`L0 @ᆣЍЍ##0H-MPP@T5@T \PP <  9?Ѝ0Ѝ0 4# #O-M@P`P U T P P Ѝ!1 06}Udd!d1a 0rTDD!D1b 0g  R 帐 P  D `QK``pW [ 0M 03[`` `0N 0(Ѝ ҭa1άO-$MS@PQ  Z T Tn P $ЍOTT#T3 0IZ88#83 0JTYT Z\ @``T``` :T:P rPp` sP jP VI@ `@T5:TZV P `Pe +` `P  T,`/Q!1 0㇠Z!1 0}V `@T4 +`Q`P- @P T- DP  A0ppB0P.T  @TP`P `T0` 0 PP P$Ѝ MP`PpP`P `PLP`P Oa0'o.GRR    0 X A-MPP: XB @ `Ѝ  00T @ xP `9T pP 0D P p@q`p` 0D P:.TQ*p@p`Ѝ 0 0mƟX 0 0n㼟T @ A Q  ` V3VX  0Ѝk+C|@ O-|MV@`PQx V$ T, T[ V 0p& :1PrPp*: ᝎ~&6 0HdV%5 0IZT[%5 0NV`%5 0B 0t 0PD  0 P 0 PąW 0 0Pp,044 or0T5 @s7 P_oPR0pY/t=ꛠ/꘠` hh$h4 0hVqLL$L4 0ihW pTs@@0Y t P_o PR  @pZq00@Z 0q P_o PR  pXsPPX Ps @Oo PB  0p^u0^ u @Oo PB  PpP `\ q 0?o P2  p q/o"0P0q pWqJP. X:[C x [ [[ @ TX*[:XW W W ,P4PP 1!@J /P8P6P 0pD! :/P% JP"*:FVPx Y P*: Q* JAP ` J)PPꎟ募xP`PxP|ЍJ <p)*Ho{xe(Pyʦ:) {8n @ O-MpP@P%5 0G㿝P(Y$ `V$ V, VUᐓ + 09/p ! 0XP <X%6w2P`PpPpPPTPaPpwPp`PPd Y  P dP   PL U PLP  Z   09/ p 0 0P@%0p,pRP <X8 0 BS0< @X0 pP ) U& 0 U  EPA0u0 "2 0МPP @P ) ^La? pp9/p 0p P @ P U ? \PP'*}P UPЍ 0`9/p 0P @ P 0P! 5@p XX X0 0b@ P ? Q˚O-MP@pP#3 0h?U` |p@Z xX]p@Z[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ bPZ  ؑ@pppZs@> @V[; ὏P6 p@  W)  0WPpp_oRWWUPU U@@ U@U @ U UQpP PpW ᱏ@@P@ Ѝ&Ѝ~@p@-`@PP T 0 0GFp 0ap|| |0 06<T`` `0 072``@ ĜTPp贖ŖH-M  2/Ѝ/p@-M@PP T 0 0`P" P P 2/`\\ \0 0T 2/P `Ѝp趕z]bp@-M@PP T 0 0š`P" P P 2/`\\ \0 0㩚T 2/P `Ѝp趔 yqx0H-@PP T 0 0ペP P P LL L0 0qT0 0H/0֓Cx0H-@PP T 0 0OP P P LL L0 0=T0 0H/0}wNœ͓p@-M@PP T 0 0`P# P P 2/``` `0 0T 2/P `Ѝpvvp@-M@PP T 0& 0י`P# P P 2/``` `0% 0ཙT 2/P `Ѝpun p@-M@PP T 0F 0`P# P P 2/``` `0E 0{T 2/P `Ѝptf#4p@-M@PP T 0e 0S`P" P P 2/`\\ \0 0Y:T 2/P `Ѝps^&+p@-M@PP T 0 0`P" P P 2/`\\ \0 0aT 2/P `Ѝp׎rZ;Qp@-M@PP T 0 0iҘ`P# P P 2/``` `0 0ธT 2/P `ЍpqZHSp@-M@PP$ T 0 0q㑘`U 0 0㆘P P P  2/P `dd d0 0mT` 2/P `ЍpЍpƋՌpVe_*mqp@-M@PP% T!1 0A`U 0 06P P P  2/P `dd d0 0T` 2/P `ЍpЍp膊to/^Aop@-M@PP T 0 0`P' P P"Q 2/`hh h0 0՗T 2/P P`ЍpfTn։cp@-M@PP T 0  0૗`P" P P 2/`\\ \0 0㒗T 2/P `ЍpZLmA-`p@P!1* 0lV4 W 0 0#_PPeP P# P  03/P U 0p  03/P U  08 A/‡lLj$[9,K-M`@PP T" V+ U1 V9 P? PF P 2/Py :!1^ 0T!1_ 0V!1 0&!1 0Vpp!p1 0ז 2/P; p` WP5"P P P.W$ X`P  3V Q`P ```X  ``XX`ЍSj'*jnŅ̅h0H-@PP T  ;0HDLL L0 0fT,, ,0 0[ꪃh~gH-M`@pPP# W, T5 V= UF W"2  09PC PJ P_ 2/PX >\\!\1 0W<Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ k(`W @(pݐpPP Q* H P(P}  ( u@p XY(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P +pPP Pލ;p H-BMhp`@Pp 0'p  0!QBߍ; Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S0(00S00H- Q 0S AQ:Q B(G-@pTWo᠂P` P0 P1*T`P #yP@pTW(H-@QSP`p R yPpGP`W@A-PA@T  QQ*(Ap`PJPQ`@蜏?@-Q 0S  AQ:Q @(@』@ MH-M  ЍH Ѝ/@-M@ p TЍЍH-R 0Sb 00S0 0s 00 O-M`PP(("(2 0?㞍 @U E @"P/XЍpcP+W -W p0W `0W`U` xP0@ Qa@"Q#M*@`pQZQWZPEUP@@D"p00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRǎ@pX QЍA@Q\bvgG-MpPW# U+ `@$A AaO!  |x 0dA`A\Aqpq p@!Qލ9LL L0 0FތU00 00 0GԌ _`c__a80 X MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/ O-MS !1 0@㙌Z@Y-@@`ЍpP0Q  ᘂApU/W qLP%p@ P@Up`T@*VJV:@V@3D    @P @`@V P^3_H-`p@Pz 0P0H-|@P@ ppdPP P P< @0D 0 Xk t   ] t 0H-@Pኍ 0HH-`p@fh dPtW  Y8 0* H`Fa8 yH-CMs@PTp,d Um @ UPR  `0!P0G 20" 00m@P8($ 8@P- PLPH @" ,0  P>,9P7 `6P- 0  3/$P Q]P@,PCލ/8XX!X1~ 0OU88!81 0D,a`(QP P aP` tU 0 0P{@|P ( R $2/xP ʌQ D0 0{d !ZUZZZY)Z8 4 P [[h   x T `g 8 )O-M@Pxx!x1 0ڊ`q`1 Xp0R0PD 4Q4a4q444P`p X0*P    | u n g ЍO(MXXX]uXj\zXeXQXWH-@Ptt!t1 0i\P P`PqpP* 0` PV:  ` P  !0p`P0PP`p PP Q `ApP V p  V7WV\ HO-TM`R  #3 0&xX+ Y4 pPX xP5 p`,pTQ4 @T PQ$$$$$  (T("2a 0Y"2b 0൉p Q t"t$0 0$( d\ 0LH" cPM ZR P@p@ [J VAQ@@0! EPQ  04005P  P QHH0S  | 3/@x Q@Z@tpP /$Q(( &AWpTЍT}UUSTTSqTTh b Pda pb a \(_ _ _ D@O-Md\ p D@D  420S$9Pq QPP! ``V*AT pW W P P U  \\pppHDQPP `4p`W*V P  R  2/P AU  @@ 咡HQ 0 0gxtl_Ѝ_ l`^ @*u TL8(<]  pX\ \ 0H-P@寅P00HsK-MpP`ĉ@ @`0 0pp2P `@F氉@ꬉ"Ѝȶ G-MpP`0垉4  0@p @p P `@F拉@ꇉ"ЍO-|MP堰x $P Y| P%P,0 P%pAUW@qTTTTT\TTTTTTTTTTTTTTTTTTThXXdpTTTHTlTT  TTTTTX x TTD  T T< H 8 p $ 0 0,0o@mW `#/p~ P0(Cmp|@JpJ.PSG m̌)PG?[;5#msPQ%Q7pP%RnPpP\̌ s01S ( `쿟P 8L[Rs00 Ba /@!B BpNp T.T.nJR3/>@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:D P@! P堰gQ VQ, Hp!0  U Y *P p [PE5P Y: P Y: )@P"d 0Aspg@G'v Cr r 0 Y*P p [ P$ Y*Q  [$h Y*Q  [p|GQ0R0d Br Y* - Q 0 YQ0|F` 炁  R @ ` PQ 0SQ( 0S%⚏ Qp a W`` aP Pe PP UWQ 0SQX "HЍ-00(  D P 0H-P @P  P P @@P0A-@Q `P' P P:P  P~PP `嚏pPFWtpPTPt PPP PP PQPVp0@_@E wPp`VUTC/0 O-MРP& @P aZ Q%  P R aZ_R  0;| h %,a p P 8(}pP  PZP ``aP``Z```V RBa P  PQ /+m FX /+ ( C @1Q0!>,!a 8!0{P1@ %, 0 P P  P !!RFp 0PUP .0"@0pZp SpЍ 1p pY``` \ 0H-PP@P@Rl4040 %@0( W0 0H-P\@PPD3l8 0@0踓  W l 0H-PX@LQ8 04 P(08  @-@ $ P  T  ( |@-@XpPQ<g400  P(| `X 0H-Pl@P`QLGD00 P (( T  ( 0 ؑ |p@-`lP@*\QH! 0 P $$ T  ( pd H@ 0H-@k/ R 0phQTL 0v@4P0ܐ @T H |t H @-@P X H@Q,$ 0@I ď @-@Q  R TH@Q,$ 0@%X <4 HP 0H-PP H@<Q(|  00HЎ  O-MXPU8W Pp  0 07 @7P `0P@ 0 @7`P 0P1 R0JY) QN@~ PXB㚯, $P(p>N/8Pp@0S0`Va`` `V 0pP@`JP8Pߍ*\`,@$m F,7`  PU Tp pp  0oBC,m 7`8PF, @Q 倁T /+o, 0 B(P p  0`! @7P 7  0 @7P 4`0PTPTP@`-00 \ O- P-,3(,< 8H܇08}pW4uxty`h$to@~x0\vw0tzm0u{ nPĂ~ ($qp q0D ($r0Ap s0TQX1WRH YOJYM\KJ}\IQGJ1QEUCJUAT?JT=`06#D` 0:&00`,0R10J?o2 <X0@ 80H 1XJ Z:FTU U4@;4PP P6\ f,(pP @ !P @ p\= 0WZ s 0W(`W$@W ~ȿ0W(@W$`W 8W4@W0hD`WS($@0$~!P TP 00  @1@0`T `XP00\PWYpL  R ?; Pp WPY<GY$0 `@H$P p$p!W   WpPp CY0 pP0`0 0S /+ppP@W p`  PD @ `pRB   pZ P(@$0 pɏ0(@$P 84@0XDPS($@0$p 0P@X40r [ DV ^P  NP :@pTpP&H `4@P0pq0P U pWWpPp00pP T 0SS0H a{PߍFۍ&댓 P T H QX PAX QQ0X01 T P  Y5HLT  [-Q p`Z p0vP pZ pm@1TT HT LpLLL Pu P>@P0p0p0W0@P 0[0ET0͠X p pȌTX@@ @!`00OKP0p W' T XA0P@"`S@U0C B @" P?/&@& RJPT !  R }PTL`T VXp@`V1pp@PP \\ P| x O-|MpPQ <Q ` R` >R `0 A R+A"Q#:Q`@PF@QxDPH AW !P Dh@ 0"0np  pPppD@PX@H㰡<@gNI0Q <Q0HH  R >R5 @ x a H{  jn@Z HP `n H0 A R+A"Q#:QH8pp4@8pp4HJ@Q00Q ,Q;Q{xAt, (8p WRPT ;P,Pn` pPh ,QeLP` P], xa0t@0d d@@L0p ~" Ao R % l% /O..pWpJD00S@00p0|S@@0cPm{ F0  @T  0St 700 P}|Ѝx@/ax@PD'@@p@$@pP 偱 000S @0DЀC0Ο$m F RaD00 @@00 ,pt    d` ( F͠Ɍ@p ```# `QT#`3PD /$0$PJjD00Q@00 aW p `8p8 L8 tt"t2!!a"Rh2a  3Q\"P F-) p  0pREWC 0p|Sh0 0$p$pW0JDp0S@0  08P0{8 0 p 01$0$0SJD0pP@00 ?  ; 00  00p4R< a $ $QJ@\l P 00,  (,p0LP (ȡ!Q)\P ף(\Xsа|@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s wwT@^ l @- MR JRR@@00 C Rln ̌! 0 B Rk00@C T:Rb@S 00 C RZ ! 0 B RW00@C T:RN @.RU00 C R@ ! 0 BRA00@C T:R8  P@.R?00 C R* ! 0 BR,00@C T:0 B@ R, 00 C Rn ̌! 0 B R00@C T:r  /R@/3w.w+wT.@* O- 1qaQs#@crc1Wpp3S@pW WWF=9\ Qa\@d@UVrls@_rᦿp@pF pPSP`?01G`pg`fl0@cAACi?SCA?1CB@X؀@B^ 1n`0pCPNPPU@@F}y\02PL`PU  pFmHi;W%Z)\P ף(\Qz*$IO-$MR"X *0QЀ@A BpT pQ T  P0< 0 0@< Fmi 0pƟWDG8?WG(/ 0CpJ00=90<5ĥS 0CCx? (( BSw? `B 0pp%P0 G`p."D㐲(97 @AP{p { oc 0p`.0p [/@! `@#4$t!$T! `p"2' >t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0\'@Q.0\@Pzp z Oc 02p@.0,p@P[p{}d 0_\%`Q.0W\ & (J/0 !# F[ BQA! A@ `p{ d 0.\(PA.0&\guT$Ѝ{p(_d 0\PE.0\p @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$IųO-M($0 0, 0$0 ppQ 0 PqR?"c@qGw@T0g003`Vg pp p3`ꌷ\ @g87&s'47v'P07 `%  p"1'?w&BnpVw^gppp30V6/  3 " X  0 Ypp H&   J  "!pP<W:*pATƟ 1/Q0X0eQYࠡ0eEuإ6T%@uV%$ `0 P#q%U&n`VeNU```3pUu?00030  FQ; ;0W FQ0 0 ph``/00b  P P地Wp,$ (@04/P | Px PtPpPlP hP 1 q೘ 0! @"0 + m   P 0! @"0 *^ W p 0W 0PpPњ PpP* uFUQ"hUEPʘ0@ ?" " RJ0,$ (p8@4007/P XQ\P pWJP   !!PxJ,$ 0(p7/P 0 0lrTf,Pa ,@T],(pf UU,mP@DF R,`VeF ㆡ`FJP, R , PP 0 Q<,$ 88h07/ P | Px PtPpPlPhPP8<|r ЍL PjH PDPe@Pa<P]8PY04Pꉈ*(\)\°Q(\\ףp= ף-00ܚ0H-@PP T   0 0SP@Q0rsA0DD D0 0ApT(( (0 0Bp1 Y @-@8P P 0/៦(@X p@-|`V h@dP`V   0 3/P rpU U U H-`p@pP PWp r( `tP@U <K-@pPP 0 0Fp U W 0 0GpY W T&9/P pG§PP`Vp@@ @0 0HoWU!Ue p@-@`PR,, ,0 0o p@p@-@P`R,, ,0 0o p@`p@-@P`P 0 0oT }P   @@PD\  A#q B0S0S@(pTf|U ĜT O-MPtzll\qpW9 PP @ `U P P#Q P  1/1/Y p `PPW:#W*`@@pW@xt@h,`PT P@UЍT |TxS ؚ0H-@P 0 0o  A#q B0S0SżP HH P P4P(0\R 4ܙPR O-sM0p `Q W!1 0Pn[" v*@P$Q QAOVp|  0`FdQ`Q\Qqpqaxa0pP \\ \0 0Qnv(pT!Qsߍ]P DYH-M0 0 ЍP MH- M 0  0 ЍHЍ/O H-MЍH-|pPpX@f`P`u`pPu` V XXPr`fP P  `0Q`0pp0Qp \ X0X /XUO MH-M   XЍH Ѝ/O MH-M00 0 XЍHЍ/N O-M@`S!1 0=mp!W!VP Yi Z!1 0QmfP pU$.Q `oT @J -P[p IjpC0 lf0W  cpG-PP  c@q ʀ 0 0m@Cfp>fIijpЍ\[X]{[=?YlMH-M  0 ЍHЍ/MH-M 0 00]ЍHЍ/H-M@PP 0 0>Em,pP/ `^P+  @,ۡPJPnppp  h00`\Xpp@$0 p(,   0AgpЍTK I K e`e&pYp@-@`P(a RUP TPbp@-R@Vp@-@PQ!1 0<l0QQ jcP Fn p @QBbQp 00 B Pu`Q  V*bQpp%Xp@-P@`d( 0@3ep H O-MM诟P` @X0 V" 0QpPcP m  /?3 0;lV/? 01l PpJPE ↀV/? 0lQp,v(v娖 O3lvhvdvlpv΍, D0p&6H 0ƍxƍˠƍƍpPJaPX@B p@= Qtc(dH <,p垟0pd4@l$`hp@@DPZU%UT+ `[ J dBQ :X P )`P  /? 0kP➟0pU JPۀ``@v P *@`0@@0F P:$Vtv @ZPVP P P P P P P hP lP P P P P P P P P P P P P P P P P P $,<T\P P P P P P P P P P 0P P tP P P P P P P P P 0<T\0P P P 4P P P  `*V 0FP@ QP`P0F Q:xl@Prxt$ ` pl@g# P a_4@ `qlQPKdKP0@ @ Q"p!P0@ Q:+975 @@@/ʌ- ' %ˌ#ˌ!p$PQ xt$ ` p8 Q  PQ l  ddP ̆l  P l `xh@0 A R1@0 A R: $QR xt$ Pg p R PR l0l0 0l0P  php   P l phpP l llY  @  P lPl  l =P ll尰l/ aVX0Pp ppx0Q0Pp l PPPCppUPpFUPC P l  0Ppp'PW h@P Ph D<@U     P  [@F  P1 l1 P  r   n Q l@1 hP \@P l =  [  W Q lp @TP&P lP l @P l`p   5  1 P liPy lyV( TPPep`P@QXFP l  _ 0=P& pU@PAq<hP ;Ph /0P-lslhTPNP@@/`V  X LGP@0< (psU=P `VX@(pP0) @ +0RBb- PT cPQA110@000 B0 PIB`@@  ^@< @F A_Q dTPP QPB QP D@P`pd0PE R0 `pPd07 U4%ZV2.EQ 00 @U A TP0 Pp`y@9  P l@3  P l@-  P lQ lQ lP lP lP l@Tf upUh`40P.`sQ:`P$xpʌ PXqS40Q.Bp Pll@Qp`sP lDP l =P lE\@X8P lP lP lP l qp -~pPPp`p`@P @PhPXRp^@g4 0`Pp= ˴P8 @N`g4 0p' 'Pl llPl llPm l `\@PVh`X`C U JX Y]P X@[ XZpʜ/?& 0flTPlP@p`PO IR.7 1: p? p6# p-`p# p  R  `P ` 00>u:\TP 0 U `L Q" R R R0."0.!b!0@V+  0yyHR!HS `L 0dHp P \HRH0Q l pd` H \HX @e[nlp`lP@TP @ U QR` XLJD``H\@`V^ V?0P0 ;:p\@P< QE pZP?  D T@/  P :pPxx/x? 0de➟Q pYP f\@v$v/? 0EeQ➟P*    Q  :pQ P pYP 2/? 0eP➟P.     0 Q  :pQ P pYP llLL/L? 0dP➟X8pOphpV` V?0P0 ?:\@X? QH KYPB  D T@/  P :X/? 0d➟Q !YP gfffphp\@/? 0}dQ➟ ERHTPR?0P0 L:\@X Q XP c D T@/  P :XXX/X? 0 D T@ /  P :pP.> 0a➟Q pjVP \@5\@200➟ X@`,X@ S :X -= 0aQC 5V P = K= ➟XXdP DPPPXP p A8;\@D0Hd0CD0SX0PPX0DX0Pd@p @DR :pP ,< 0]aQ pUP M:➟ d@X0P@@DT@TR:pP ,< 0,aQ pUP \@  : E<9➟ d@PP&; 0R0 u:p\@PP P+P; 0`Q6 pxU P 0 # D T@  R :pP *: 0`➟Q pNU P  ➟+d XPPX) 8dTPphpPX@-7, X@ 0%Q.Q0 :X )9 0`P UP m➟hP )6 ➟0sYcs$X80R0B:X@XHH(H8 0I`P: TP4 D T@ R :X'7 0#`➟Q T P  X@ |5➟P< @@T@TQ:XHH'H7 0_P oTP v@94➟ ERR*60P0 :\@X&6 0_Q= _➟Q SP EQ+ X $4 0_P SP {A1$4 0_Q SPr垟L:\@\@꘢ `>ꄢ p`(ꔣ 6 eݼ0pP X tt#t3 0^P YSP,  phpphp` ) 0ppM` 儡 W @PxP P ߍۍq $ LX    ء /p@ᬠ `꜡ ꄡ p `p@p ( P 8 P 蠟 P hp\ U_   D   $   x  qh, ű=4&x ]ղ& h ոMD-( q-%+aX* eݴ( }t)=' YP%  Ⱥ eݯ# $ $   4 l ظ 0 Yѭ! 1" -$"  x H-`@Pp;V 0@VO-4M`Pp000@0 $(, `VP$ %P@p Q * 0 @ R0A :$Pnp AZQn   l , , ,   ` H L , ,,,  d0  8L L @*P2 0@ ` Q0@ Q:p}p0A P3@!p0A P:$QDW+:i @@@ca [ YWUpp0A P?!p0A` P:$QOW6:f$Q@ W : `00p 0W` p)YJ* pY : p p00p 0Wp$Q W :  00p 0W`ppW* W : `00pg 0Wp `@W* W : p p00pI 0W@W* W : p p00p3 0W  /  s@W* W : pt p00p 0WoW* W : @_00p W0Y > P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX:qPI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@㮭4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0ZgfffK-M@`V`PT po[pm[Q Ѝ p`[p^[P Z[@"V[@Ѝ OFhZ`ЍG--@ VP@P(0 &,B0`L ' "( Q!UP UppP `UG"Z X G`GWP!"+G@Q '"00@0r pPu @Q P USPO 9P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  Y`(ӗ"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍO@`@@V@H HLXP (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQkgP (@ W,p{J @v @1`t8a (@TZ T  J@DK Q(@R P 88P @8>8@8w@P P QiP 8p<0pSD0`'4p  S4@0PWP o  pPQ ` `  `PP:@ (@@` @Pj VV b(@P  @Q+P8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y P! $(P*< 8P <p_ 8P ( P#P6 Tno(`Ph@8| T@0W@ PЍЍ[[ 0PJ @8 ,pP` @P`@8p0PPDPPV   8(@`FP  8 (P @P   u( P`W`P @! =K(P 8@Pz@CVP pD4$PQ D @ @ 8P $@0P< Y BoD [JR $P PPRm4P f YXPD6  P: P  8PV Z.  PZ(! 8P @ (pH@ `P˓`40 (P ,pP@ 8VP 8(P4/0(,pi,p@T@D0P f`,p0(`4P: Y8 1P 8(P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1D ,p0(PD d ` H-MP`@UpVUqPPP Q:RࡥP PUpЍUPTPR ":S S/$/ /0H-@PP:P QPgPP@0H-P`@pR:pPpPP p@Q   R@U0 12 O- MP QepB`  @ vP T@-P 0@` `0V00@RP @ `PA ` P @PQ@JP@PP J0 `P` 0`PU00PW Q @ PQ@J P ЍH-S~A-RM(P@SD@,  (  `㕇H  0ᒮ $` `````~TqT |H-}H- RC/A 0\R#R! R/p@-`@Ptt t0 0?RPV P PVP⠠`P  Hpl}}c{p@-@PPP P0 0:RFPၠ`P  Hp}H}zH-M&ЍP H-MD" -=)@/  ,ЍH/C0H-MP@P\\ \0 0;pR  0 Pu@pЍ0X||]0H-@ 00: P:P P P! \H& @0000 0S P/!C/H-P@Qb  @P `Q PQpAG RGV f1O-M-MP@`0`Ⴋp'F` t p l d@Y JR:*Z Z Z +Z -Z  xZd0x!I x0Z\ 0 0xSM$` xl0 Pd\00x  0 XH 0 C RPP ! 0PB 0x000 C R *XX! 0BP `` TDS R p`@@T  `R0Lp@d x 00S S B0 x 0X p@@p@LJ0S @0pxp0@0S @1 Cp R@L:20 C R*0S  \` ph@1AV VPpGࠡ`Wh@ ` `@pVPVЁx0 @@L `pEQ[T  x0p+S -Spx00C Q0Sdp0x0 0R C d70Z d`xpx, 1BpQxh@@0pB@`0D Q `x`0 0C0pB@ Q:`F0 `0O@ F`NLRNlpQdph@Qpg@`T[ \0h0T PS 0P0aPTPX0Z @LP IC%Px2 P x@xx) Px@`xT`P-0ZhP@@X@ T B+ ! 0 PX Gp5Qd0L hhpQdR$ R4R;ʸ[ &p  L 5 [  (A6Pdp pT3`  p  0 `,Pp/`PXHpr(@ hp%`Rh|`!L !B pp  p0` 0P PX\0 `h@0S*   ! p#Wg ϟ#SG@0Ltp A ``t`'jP +W `@00psEc /    p!W8 lϟp0!|@P`0U% II0P R `APUG8TP@@l)|@P|IIsl Pls |@DP@|0, 0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\rC` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!< U!0@PP4U28<Q0  P p_ P$t U @Q l0q0pS*`v 4pl8|PhUXPQ lUPlj l eA|@|P@`P|L   T |Q2 `\XP0 0P. PQ- lT0"Q Rl U pfL  `1\0 @`\0X 0Q @0 !R8<Q=l! RH@PPH~$ 4p  0p"4pr X0Q@Pm l @PdU Pl PeP!aX X |lPA|4pQ b.PPh X`Q pQAH KHV f1lP.l`X<  BQ| R`P XhPQ pQAH KHU e1l`P@P4p!8X@|00SP@P4pR lG p0pP* R B|` O-M P @8  @P 5Y`R pW`QR p9><Q Q` ` P~  !  `2`Z V @` `f( P Z  `-@PX @p QA [ P PP PPڣ K"  `'PK[Z)8`  `f6 @`R `s`ЍlZPH-mK-P RPPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \EP P! ?P O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝ 8 O-MD@ :T `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QlLP  P U0b`p\ uRP U V ` U  `PEcp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[  I"b@{`;pE 8@ Pq  Bp8P![9Pr`bV: Q@ U`:Wp GX h 2 @=@ ` v @ R H"@)@Y!@IU4VD` `T `p P PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `jY"@@U !@0"@PP" j eP Z!@p@ @Q @Q z)H"P@!@p ! /K-`p@ R  P0Q P(  YppA PI`V0 A P PUpGpH p Y @D` 0 @P `@Tp980H--M@P @ ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁNF0S " R10\  R/ R /0H-P0 9PP8PP7PP6PP5PP4PP3PP2PP@1PPfed0cb a@0PFED0CB A@0H H-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ {@ЍH- a@`P ] TQU  t!PU P C xxPtPEQLUPP $#8 P P lP h 0H-P @!P:0HpdPPQ TH0!S A ,0H ! A0 ȩ lH-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! :!P : 7!P: Q& 焣0!S  xPPQ o0`!S `bd! P$! 耦 4d Ԧ  P13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@DZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP ⷢqpWHPa pqpP ❢똡 猁PP$ fPG pT !P:Q {1 0RA p  A@[ p`WP ^pW3P pPP HPQP LAPЍ@ 4T  8 , h@ K-` rW WPF  V:RUPC 1` fP@VPPR5Q:UPR:LY! !P: TlPPQ \P0!S 4ݡ$! h P  0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/H-M@Pp U B@H((!(1 0ELAP3 ` @uP3JpQ Q& Mwp%   P2P @`  lhP`  \00@$ 0( ,@BBOЍ8@8D 0 v0H-@Pll l0 0=@99@PPP906Kx@-@PLL L0 0I@@P@X66p@-`PP00!01 0>@aP rP wP9,/ < 0e@CT0APx5 S +S4 ; p Bp&6W6\6p@-@P!1 08]@P3 8 0P QQ 56P Q 1/pPӼ 奓0P @ P 0嘓0`aa8 ``pA p5O5 @-@P`` `0 0;@0Q QA .4^40H-@P!1 0J?P12P HyA @H0P @ P 70<PPP 80 5P%P6 PP D!$P  5/PP0 @ P034p ؔ @-@P<< <0 0;}? P@]52R2H-M0 AЍ0\ \ \P LЍ4 bЍ Ѝ6@  //O-OM`P@<Pwp\P3 @VQ   uP @P@P@V 0 * p x|Z zҰ pDp4,  0P8P0  ?V tP P k X P c Q P4P PQ *Q Q4@;P3C  P0!! P$00llP0 p|@P73(, 0<0 $  R5PX QL V0 XA/Q s12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0?P-?P3Q&@P"l ! 2/@P(SP !D 0@0!N~ur??P@Y?P Oߍ4$$P  p`0 P  p`0P @i?P9e?Pax t ,T0A-@PP UQ `pގP U  &1!!U4?P0?PH-4!@d P $?PPP @P  @!ڐP U?PQ NoppWP Őp rὐU >PP/0H-@P᫐0@-@R * 0 0@\>>,H-Q p>@-@S >,  0@4@-@ >,  S 0@>O- M@Sp0 $PJW $(RbP`YPs Z WW)(Q9$ ($($[  0PR  P([([$d(p2 (Y1 0<Z1 0<(Q 0VP  (Q P$ $  R(Z>, Ѝ(p`pQ   PPmQ  !R 0 VPPP:pW $ Ѝ `p|VppGp C P(Q Ѝ'(d0H-Q =0@P P4P  P 00ZP@0A0O-M@(0!P5R(P%p5Xaꇑ ̉P.  pؑ ` % < KpaP !( !h PD  , U , 0 ЍOgdЍ@- 1@3/, (P0G-M4P @@ 1  3/ 0  `@   ``! 00'  (P0)` 0* `+#  ,"PP-!` `. 00/'0&  1%02$`P3+`4*P05)$ 6(E 7/"`#8.%0&P9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/p APP`P@U 8Q 0,`hP ލ}<Oz<,ލa"O-MP@ ! `2/,( 0<V`Q0 0 P{  尀@X_:@ `YVZ :FW P,Z 0 prjP!y@jP3   0PP  `@㲀V `Y ) Q] QA0 j P;@ @P d R  Ѝ b P d P  ob P(@Y TP ( B  ($ @$;O-Mp@S [:p P`W  $80p` " (12/ Q, P   A P,  [:O@T p rm@Ѝ$p( 2q"a+@:=:P`8: ` *P ` *P pP 79 @, {b1} ~ } |} P} p| H{ { <{ z { tLy Ly 0H-@Q P!,P 090A-M@`pQ P ,PW 9PЍ P ` P r 0 P!@ +P +G- Q  D Ƞ " @!D!Ƞ! #@#h#L0"8 "$ ! @ @BT 0 `:"2 0b7 rQ~ QP P Q"40A Q0Pp` @p`P @  0@ p`@Ppp``P`p `0p P0p` P 0  0 0 @0 0   00  0 0 @  0P. P) Q"4 0A0Q `@P``0p@P`p0 0 P p ` 0 0@ p ` P 0@G- Q_ @@T:#3 0b7 rQ~ QP  QP"4 0A QP "x"4pp00`@"`@ @P p`Ppp```p `0p @0p` @ 0  0 0 P0 0   00  0 @0 P @  0P.  QP"4 0A% 0Q 0`00P@pP@`p 0 P p ` 0 0@ p ` P 0@ t h \" p!t`!h! P#Tp#x`#l0"8 "$  0P p `Qp@-P@Q `)`'`p" )p P { P tP magej`P`pp@-MP@Q `)`T 7Ѝp "    )P @ !pb1   ` ))P Ѝp  Ѝpb1R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/@-Rq0 @.6@-@ / ?!BCb2 @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW+ Pp(!;@a @V``#`3 05p0oW  q pYpo@`W@@T 00 0  `pW; p`W:BpP- P$ TDY ā o2   6aPppYpЍ` 0ppaP0S  @!4@qW!1 0{40 Q  ![( @p@ v Q0S0`S 0paP@ @  R `z   YH- 0A1Π\1>-1!!K-M`qWWЍ@P xppW R T T  0.aP U P 4WЍЍ 00 !     /p@-`}h@p PV ip pb5`h^5`pA-CMLaP@`,iQ$ !1,P00 P3 P:=5?-$  #h,Pp ,ip  =hp T ip  h 5@ h0h 5@P,PCލBTd Y ]:O-DMp` @@Q P'P XXw P0S@PP%4@ QDЍX(P 4 p ,00 ( 040 P(p0S ~p $0 8 8 <0 P `PX  A&P 1 03pC 0oPQ  ,&P< 0! ⰱ BRᴰ2:Q+Q,@P :#3 0b2p P PJ   p&i䱄 P[   c&   PT 0XP  O&HP    !   BR *0  0 ` @P +g@P0 : "2 0b]2 0pS*@ "0! A 0 q! P  ( PQP"!@P P PR P@U: 0 0b2 pQ!  % X    PI $o Mb )]c\ _ _ ^ YO-M`PQ @%@ U U  P P hp0  P  P@@T:44'47b 01pU*  cP ᴐ @@ Z:&6b 01qIoR@P  BP 0  p @PP@@T:<<&<6b 0Y1   %U  Pt  P Pa2(2 Ѝ n$P `p@W:PP%P5 0b1DP @ $ @pP `QW $ A$D`P 1  2p@W:$4 0b0. QP  $Y  `@V:#3 0b0   $ (Po"u$, Pk$Uc YM 2! #P` `pY@@T:#3b 00pP  E$뼑Y Y Z㴀  pJx !01   %$ #P# `W pG $ #P `Q;i P `@QY+  #qW  2! f#P `WP  #qW @Z㴀  #  E#`P奀Zⴀp x p# -#P `P@U:tt t0b 0/!U[%U[y9ioO-M(p Q R QZ @P  Kp   Ap  p Ed`P@L @Q01`@X:#3 0bu/   @R 0 A(@ Q R QAˁЍ ( UWd Z J  Pk @@T:"2 0b7/p P  Py ZS @@T:00"02 0b/p PQ PR"P2 @ QPX  "W㰡  갡    0MP((7   0ᰡ :P Ѝ((1Q "P @ @P@U: 0 0b. P  u"(( ( ( f" %+ =C#O- MPp,AT~  2! !P T`@ p? @Y:!1b 0a. P P% oPc,P ] p@[  AR 0 1  # !6@Z: 0 0b.  0@S000B @ !P !p pPpPp Ѝ}p@-P@Q !!P    !Q `!P    !ppp@-M@PLL L0 05- 0PЍO-MM`p@PV"2 0?-TUP WJ@ PJ P/? F @Y:@/!P /@P Ѝۍ3 @XP>+IY*F  @;qYFG    U -ap JT$ )cpD.P P p尀? #P P0PpP cP! P. /P HXb/P   P ~.{yx.@oᠲsK MrJ @-R@QPTP"H-XMppT&P `LHD@@  "@ @ < U TPXЍp癋TH H H H-M rpB@DQ )PPD Uj @'TjPЍLvDP.PpP `|`x`t`p`l`h`d```\`X`T`P`LU PQ0F?v`QE   ! P<ોP6DAP#')P0 : p  P#bpbPᴋU P 0-G H ׄ$ L X P dG O-|Ms@ Qpx eP(`tplhh  "   "@  U܊DP(h  tplh  !  @  U| J` F[ D*S? $Utplh!1w 0+Y!1 0^+? P !1y 0+[*[ p@Z*&PP!P1z 0w+(@h  php!@Z:@Peph Tph@lpP@@`:Y (@h v k!p p (@ 8  4 xP|Ѝ<~TE E E XE PC <I>r .B O-TMȠ@ Pd(`p @  LpHpDp@p2  '! @ P U:H V y(P PTЍA lB 0B @-X @  T @A A O-M tQ u@ P 찍谍  p\\\\@  L 0 p'  P$@  < Z @ 6 P@`| h ~   v  PЍQ+@ d? p@-@PqTT T0 0i* `( Vpp@^*8? ? @- MA@  p0 P-   |th 0* Rq Ѝ Ѝ`Гē @-@@ $ @ l> D> 4> H-@=P:`7p$ #&H_O-dM(0@Ÿ, Pp0 HL "$@X@ @0,THbP\PP`` 0 pPp "`X %Ha`h!T fP"e< `z8e' PXD %a8 #i aX @`\e<P@,d(i#nʌ k a("i `a 4`dH,`i *d,n "|fl'f8T#afx.g@P@@D ?T @T :0@P@@D ?TT ( 6H- K-@P6 `P? q<W (7W (7g)7( ?W (?'  8@D((P ( 2/ PhP @-0 @(@| $@/KH-\H- P @-8@ @P`@DHL@/KO-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @PЍ $$4/p@-@p$ `P+P V $ A !0Q00  0pp 0%otd H-M@t W *^P PG`V  `VP;P' ) 4S  $3/$0P P!P( lP4S  $3/  B !  PP  Ѝ0H-@p! PP  A !040Q00  000 0%1 r$ H-00S     B ! 00 S   0"`G-M@PA‡ p`P  R Q<PP] $6P* 4T0PO Q    Q 0 pS   0 00 P-P(RkP`P O Q  p 4 S  $3/PЍPP Q A/@-@P  Q   _P_p@-MP@U% `PU  4S  $3/$0PHjP4S  $3/@PЍp Ѝp  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//  0S RP/0?c0 3??oP/A-MP p"W`"VQT  @ P DxPFpR  T @ЍO-MP Y p PE Q  P #3 0GS Y#3 0HI Ѝp`@+V`pV ,0v !# 3/P`FQЍVP1  5AP`FP V`pV PBB QU*PA PU:\P 0    EPPP PVV*  P   nP _Q D Fr!# ,0 3/PPN`FPH V Q `pV   N @P!VPP1P@U   +P U  @A,P  5/@PX P @ Ѝllrlllp@-P$ @* P`U) P`AV ,0 3/PP`VDQ 1/`h@@i\TPip `p`@` p@-@P 0 0V PUpP`@V ,0 3/PP`VDQ p@/@ppgg@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0R/q Q/ R0/@-@P 0 0<9 Py 0 P @0P \0 $0 P    add O-Mlc@T`TT#T3 0|P >PJ p @oᡒW  PLp(P{TPQxPMژ"p0 @IPJPhPy FA/Q^ ppppp\pppppppphppppppppppppppppppppp\pppppppph'PIVPA XuP!  <p*A/o"P . L  Q(   Q Ѝp  0 0Udd d0 0VHH H0 0  Ѝp__c___;_y__@ p@-M@P1 0Pf0Ta}gV `g0TP Ofwgkg0UTXa 0UXX \\\P`g0fЍp| 0H-@P 0rf0TQBg0U TPP :g0 TX!0XXPZf0茲 @-@PP 0Mf0XQXTOf0@@f 0H-@|P 0P3fU 0\Q\`g0XQXTObf00Hf0蔱 @-0M4@@,  P, Q0Ѝݳ백 0H-@PQ00 00 09  0H=t,@{\\5p@-M($`P4@`P 08PpЍpܱ O- M80`<4P P@!1 0K@p[xx!x1 0MWpVpT D#P:P=F`DD0  @;P 74`P Q Y8

:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /W@- 0@ Q  / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-pP@Q`T`` `0 0 W   QM2NENs R US  R/ /p@-P`@Rhh h0 0vQ U T  QpMM- S#%U#/!R  Q0///-R/p@-Md`@ Px`X6X6R6T6PЍpT 0H-MMdd@ddPRP  @P#  @@p 4 8pL8LqLH-0 G-M pPdpKXBX`@`PA`` AB+Q8 `````R000!01U0P0 PP0  0  0 Pp$ 3 @- 40 0ZTPލ3aD h> P> tKDJ$JyJ< ;L< u,< 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   x3`QP  Q 1/W  b3N4 @-0M@ $(,D?P:\ H   1, 6PC0Ѝ @-0M@, $(D?P:5  0 PC0Ѝ@-@4@4/ᴐ H-M00 004ЍԎ MH-M 0 00ЍHЍ/P /H H-@-D@@4@@p Yk@ԍ //////x7 //O-4M@`QPPY`@xP!1 0x뤑失qAaހ p@`P x @lPP: 0@PQ  0S0 0@ 0R:/`+,($ p dX (4/4ЍDDD{DDxC|LD<///O-M⴪@pP `Q T *: 0U v(PUPp %P T4` 0pxZP8l@H$$P t(0*X? 0H Q 0H Q: P Q 0A0@ Q:~ 0z`xyui`r@`p`n `lljlh0fkd0lQ 0`0PX/UX p(`$`n  c l < C pc( p(t  i 0`0x`|QRpAJ`p#P p@WpY  N 0`m\  P `Z<  0 p 7@p4p?o#0Q -0C$AzppDD%D5V 0, @zp0`#  @zp` @zp`0000rpRP P P- PW 0  * &2&b @S 09$ . 10a@S `9 0Q00 $ Z:p 0 $  0! J0  Gc z `:$ 00ap@`R $ p0 $p `s 0$  Y+ I 0 00P` T4`FVZ `  T04 T4  00Zء T `5`4` YP T04 BR  BR T04 BR0W T 4 4pW p$ P T4@Pʩ @ pppyp0p TK \\ \0 0vsʎTP Ѝ§븋 BBB88Jd]חU==]\-; A-@P 0 0:lPX P`ppGX`WڼP 4/PN888 K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P P pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0dfQJ`PUIgFg XP  AP $QЍۍ~ } O-MMTa@ PU`p Q RЍۍѦ ' 2 ' 2- qpqpQ'`0HX'  0fPJ`PUff   0 `oP`` ``} T| D| O-MM⤏`Pxt  U PP7 P0d `a || Xp0  0 U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG ̌P? p. J./̌P2JP P  Q%Q Q QQ  QX `̌P  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  dp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A `FU  TJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ;P4 X0ⱊ\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0XP P``s 6S0 / i\ 0pPk,PHX`a8P Y`J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|,P PuJh&0,P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 nhX0Y Le! ,p`  +PJ`  X0H P 0o+@P ~ vPt``儍h R0 dd- _b`\T\`'LFRPP``8 Q0 - .` X3 \L($!  X0L "P `` Q0 PP, ` \hYJ \\PP  P t$P``刋h Q0 hh+ ݈`\h x " XPh 0 0Y  9 \LhP% hZPP4  `  XP 0Z0ZY P  `P \`L  L v\L X0 / L\`P 4PY| @P8PcxtX$HTPPP@o3| @p $|X66PPgP5J. |J| +PJPP PPP P(@ 㷿P { PJ p  J+Pu> *WpPQT@ptnbJ^ : X2d  )PPp@DhP`q )PmPA h1b Y`@ y Ty  @X0VhPq R:q )PPA  ,T hI q  R,#Jx)PڴA Xh1 `a   XP0h0Y F I$FPDp` O0 xx$ 2UPw x $@\`p`!! QX0 `a  p X0 R ` "\ R   z qW )P6t xl0p00 07/PU qPEP P ` $@SPw $Pp` O0 # ˆp C RP笂h`-$Pp` iO0 PP" +@Pd ` Pp` PO0 ! p$$  0 -j`QP Xu ($D@Y$@|htQP=H  RH Z \$@PLP Z<'P#p$ <@U M@J=FEPC`` NXX 0  14`< &QߍۍeCc k e}pg f 5  m j !Df di d e p I)s)n A'k'r &*' o p (((8q (s + s +o 'm m o n &n Xs s+m&i Pp g G-8MMp`P4@, X0  ;3 P 3+T3 /gNPH30 ⧅@4P8Ѝۍb c / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@ (P P(p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ o(P P{(p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp   T 02  0  X`PK L ;`P8   ; *`P(L  0f`p%  !P4 ,' _ P$ЍۍОPȐ А 0!(/<  | e 0t#x s0/?r s0wpp嫃PPP`2`_ n0] -t] ] ] xO-4MMp0F`` ^ R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ ]P0P4ЍۍpPPP ] ]<P0$ R (\ X `X TX hY O- MMAp`@ &P P Ѝۍl4hP $9P `d+0bDPQ1 P@Q$ `E8P  @Q ER @ R``PK  4Q` `ޯX X W K-AM(@0P `p  V  0 V ` ` 0᫁ P\ P+]P 0@.Pl  ` p呁`84 0 $QAލ˜PV !ByO-TM`刀xp A P  0᳁@X YPPPPp W@/P WB WmYk `PP I0 P[P`JPxp\z`\W|PPL A QI A0[PBJ@ \\p\\ P @"` I Q'x p pp\z\\v\@PLV | hPpL   @ETЍT .A-P`@p Np@ Q)``K\ XpD\``Pi9\P5\ qE 1 T A- Pp@` ` A0Rp RQ$\\` P`EV:44 40= 0Gv[EG # [ d O-MMPP  [ dU  z<  R `@@ lVA@lF5 p@@@\<P P6pBA@̟@`< … `,(@ [d d  7PQ `` @O\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 尀P `v+0AP , \8H` @0($$+0AP #P;P  P&  PO   Px  P  P P P,p)   P PX,p P0  P PX,p P (@@@@@@@@(@@@@@@@@@@@@@@@@@@@@@ P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@P( 0@ P h0 P  Y;Y yQJ@ @P @ ᠥ 08Px  1P,qH l0 P0hP P v @H54  0F4 @ <0fPI X PA PM_%P& 4 y PA >M _jP `D Q 0 Q Q0S 0Q 8PP:4T Q Q QB4E< ,R >P (06< R(P2-(P<P(P%(0P x|8dd  P |ძ@|"p 0rapφA""x!|3x#%5v 0UUUP " P`P v=Pv.P M4P1 `pHpPP a .PpRW :P@.PPV*GWp DQ PH@Pb}QPP   &Qߍۍ?arpaip6.int

P w>0H-MA  4PTPP!Ѝ0|p@-pM|``lQ  `@@U@ P- Fl QpЍp0A G-`PJ pQ v_@@T*p pX" r3P@ 0@ PQP# R!R 0sP@ 0s 0@P O- M`@ܡ X Y|P  ,t,Pp  P P  vPr   pPu  iP  bP  [P  TP  MP x FP ` ?P H 8P 0 1P{  *Pw  #Ps  P  P P P  P0nPdePj {fdd` {[ MPQ {MId {H:    Z& P ?P? ! uJZ P ?P? ! aJ(PP P P  ЍI@'mJ5 SP=HA-M\aP`@l3h##<10 "=p Q9xq, sXW qtxO|0x#T0%0P00L0H\X`H 0axp 0 xVP T T000Ѝ>T  pppЍ耒dȃt<H-@PJPQ vO`p`V*p q Q/ Q/K- \R 0pP P U0pUa@V@@TÁV C `@ `@ `@ `@-0@@P @"=0{`7  @-@P @={ @-@@P 6 @-@P / O-QMP@P$4 0|HpWll$l4 0P BPዦЍp Ѝpဦ ЍpA O- M␘x p倈x @T @@P@(0)|@p Ta TqTDPThDDDDD  D4, ;TpU |U d`VPQH TQ Q8' !R2 P u PPu pA@FP; t&2 /oAo"V\`F`A@Df\| V* [*,D<P0[pH  XPE& 0A;6, % !{%Q l \L@@;P DR P pʰt@Pp缄$o0< !P34010StpaVp!d! [*Ptp*H P 'PqQက1Ȁ@a#7P PK@A 7P ! B sPp @ @ 夲倃Q  ',Qq R၀1P/ 'Pq.*Qက1%Ȁ 6Py DAPa `6Pp ! B $rȱpP@ @` XȀ@q6PR PK@A 6PH ! B `qpT!0P AD!@P 0@0 0 ذ( ЍP 'PqnjQ`1`Q2P @@o6P A` PppL Ѝ Ѝ\{4#$0 1 $0 0`( ) yẑX) v) D* hy{[) $+ * z@D0 / - L@- <. Ѕ$- - , / , , 8, l- ||v@y|+ + + , H-MPPLL!L1 0r80a0`@ P@DQ sP% sP P psP pW:P{XpЍ  !dd d 0?Ѝ@@ @ m( \& R6p~~&O-M< 4Q :( R  M@P  QXQ , P, 0|p0|p0, pp|pppp X\PP  H  :R 0`B6V  `0`P``R ` ;R`٧0r0vP@v0@PK@ +Q 00 D;0 h+ @`k` XQ HQ 8+ 0 S000Q @P-$;0[P,P +   ,j`VjVPp P(P 0  0 R0,P  PpFP  EPPP; R@ 4P1 F` ` P  UZ#P% ة@ `p P ) @U@pG P  | @`>a`\)   Di`0 t@( T@(uPw DP@  0 t@T@ \upP\@8 T0tXP@P  @, H<<8 00XP(H@ `V@ 3  P  D 0ا 帧 R`P @P"PP @,Pb@\T\dpx(R RO& @UP@t* @ R Pa 0AS006P| tPQ `;Q`٧q@vPv0T @0  R0/褟  R& 0`AS006V ``P``Q `;Q`٧0q0vP@v0@PP$ A6P$0Q p 0 P :RSEC@P$  @4P00^ ( `V ``B6P @R P ;RP٧r0u@u`S PmPg0 0$pQ@>AЍ975IP* @P P p倁 p`/V *P8ЍЍ@BЍ0;< ЍLP~~}}L% & h% x& }}X}T}D}% 8}v q PV㲀 UU 8@8詘%O-Mp (R B@pP U `" `ተP LP$ 0͚P p 0 P<@@`FpP UV *P ЍЍЍp@- @P0P`㜚 P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0Po`PbQ 0P`PV 张`Ა# 0S 0p[0G ) R-$p q(9 ᲀ᱐R 0㼠9P/  Hp 0,pp% P $pQ 0pP  (P$p q$pЍO-M`p @ Q P@Q'PP@P }"H P> [+ (P  P0֙P . P$ $ 0P™P   0PP@P P  ᪸o Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P " @P. 0  0P% 0P^@P 0 0P P  F @ @ ЍO-M@P 0 `p  @<唒p P0pP  RQ 0S R Q Q  0P{pP !1f 0Y 0@00``V ||!|1 00s0 `08v@ 0NY` :!1} 0@岐P :฀ ᴐ@?R : 0 0pᴐᲠ`P pḀ<`QpЍ%ŏNgIҏ[ŎN׌A-MP`pQ @[@!P VY,\\,\\\/H!R*PD >0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍBP " @@W 0"P ! s G 0P Ѝ V Vp$p   0cЍO-$MXBP@p wQ Gp  p  U U  P 3 `P_ @pU Up `T P  pR   PA w`Q*  0p蓣A`P@6`1p@W: 0 0bpV*@ T1 C 0q @D "   .`D@@ P$Ѝ6y  }ggH-4QP0p H-<Q $Po 4o H-xPh P PL  R 4  fzHRHH/0H-Ml  P\\00 @  0PP噯,, 0P呯Ѝ00*Ğ*A-0S  ppp2  P@`p@`p@ R *PU U\LP@-M @***Ѝ@-MpP Ѝ T D@ 0@ p P Ѝ/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/Z */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*/*/6*/*///*//7 */>*/ 4T*/@-@\@*/*/*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-p] directory ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20250218092744Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfsflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Reading `%s'Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %s%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES ntpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.0--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.0 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.0 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timeread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist