08P \g'&<  ' \gPL8P''`'). ). \g'&P@@<@T 08P \g'&<  ' \gPL8P''`'). ). \g'&P@@<@TU \g`').yA \g \g \gQ$f \g \g \gRA \g \g \g>A \g \g \g?A \g \g \gA \g \g \gA \g \g \gA \g \g \gA \g \g \gA \g \g \gmK% \g \g \gX`hpx$@ \g \g \g (08S$\ \g \g \g@HPX`hpxP$t \g \g \g;Q$ \g \g \g <JA \g \g \gC \g \g \gA \g \g \gA \g \g \gmB \g \g \g(08@HPX`hpx[$ \g \g \g$ \g \g \g$> \g \g \g$ \g \g \g$s \g \g \g$ \g \g \gA \g \g \gm \g \g \g$ \g \g \g $ \g \g \gA \g \g \gA \g \g \gA \g \g \gA \g \g \g$h` \g \g \g ($ \g \g \g$ \g \g \g$ \g \g \g$ \g \g \g$ \g \g \g$ \g \g \g$ \g \g \gA \g \g \gA \g \g \gA \g \g \gA \g \g \gA \g \g \gA \g \g \gLcwhLy'ZV7kg4hG2(l&S}=,mnxnTr4X.'kg#?=IEB > PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4%4 (0"0"ii&$V2V2 TTT,,&$V2V2Ptdș(QtdNetBSDpmAPaXU|SR ffffUSWVP[-t$$u,jPjjjnj|$0F $uH!BtKj/Vۿt@Ƹ0"0M&PVpt&uVhL0"h40"h'3+^_`SWVhL0"hW0"h'3 1۸0"0M&P`CPrFh'3j Vwh4%h'3 uh'3j 'jD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5D/3i u$1^_[Vh2"Vh3"& 5@/3hH3"j謊wVh(3"jlUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%ShP&PtutD$D$$D$% D$t$@N D$l$t$8h2" t$8h3"q 5@/3h3"j;SWV \$ t$~d}g|$$D$ $O D$tO uXD$Phc 5D/3T u$1 ^_[Vh2"Vh3"5@/3h3"j藈wVh(3"jWUSWV|$,1AA AAQhc@5D/3Ҳ @/3D$%#%#l1#\$|$%#l1#l1#VSUWRPQh3" D$ t%#l1#QPh4"q 4$5@/3h4"[ 1^_[]t$(h3"Qh3"j苇P|$ u5Phc@5D/3 @/3u+4$Qh 4" 1Yt$h3"\Qh84"j+PL$ D$~0u3D$Qhc5D/3y u1YPh2"Ph3";5@/3hH4"jUSWVh$1ɍD$THH HHD$$Phc@5D/3  $D$D$1$D$ L$D$;WhP&Rtu.3DHu;D$9D$<$|$ aD$ $GD$9D$r<$t1A $D$|$ L$ D$tr1A $D$D$N2D$$‹|$ND$ $11D$,"r1@D$$|$D$T$9D$T$ʉL$L$XT$$O&L$\ L$`L$do1A|$ t׋$Åtϋ\$ 9klV$V1VP D$D$<\$@|$DD$$D$Hl$Lt$PD$hH/3hk$D$ @l$0tD$Ph$R$j D$  |$\$4t$,s$L$)L >QPh&5" D$  L$s()@L$L bQPhG5"eL$ D$  s D t 4ŨO&hj5"9L$ D dtPhx5"D$(@9XUz\$D$T$T$9tt$N9BD$4ŨO&5@/3h4" 1h^_[]t$|hX4"i%WS$h4"h4"j赁U5@/3h4"jʁt$|h3"5@/3h3"3$hs4"jhc 5D/3 u15@/3h5"jtSWVPD$Hw#t$>P&Wt ubP&$h2"WZt N1AQhc5D/3聫 u 1^_[5@/3h5"j߀USWVP|$t$7h2"WV< fu D<@/3u !3)u @/3uh2" 2"t @/3hjQY D/3u 5@/3h2"Ihu3$(8F ux03/3|03 03 /3/3;/3 03r*jZ/3x03/3 /3 03|03^_[á03 |03 t /3/3hQ&hk$jgzhQ&hk$jVzhQ&hk$jEzhQ&hk$j4zUSWVt$|$6!l1#SjSVW超 u=!3PM03u,03b$0303Q&Ah)8"jy03Q&1QQPqS 03y 503t03 t03 =,2r03uh8"롡03u# 0303 9"03Q&103H03Q& hQPR 03yJ103H 03 hP503Q 03 03y 503/3/303utS1V 030303903r_ t03t= 03 /3E /3t# t03) 03I /3" t03ujl/3 x03/303 03t 03 03t 03h`u;503 /3=03 03503VP5 03W 031Vhh03vhjhj5/35/35/3/3hX-,2e=0303 03 t003(03403,039ss$x03 03tQj QjPs 035035x03503P$ xd503-031‰1 03 03|03 03(03,03|03 0303 03xPhk$_+03u603j503503503P  t503hk$W_03 0303 0303|03 03(03|03 03,03C03s 0303|03 03003|03 03403u@s)tP03T03H x03PQQI 03x0303/3 /3j103|0310303h8"jPhk$jtWV03=t=ȥ=u 703/3 /3t;/39щ503s))Rj5/3 03 /3/3 /3 u\5$03= 03 tJ5/3j5/3譲 03 /3/3 /3/3ʉ/3)Ɖ= 035$03 t jY= 03u03jPu 8u*035 03Pt^_h /#jsh9"USWV/3|$,t/3/3(p‰D$l$|$,u 03 xT$ $03 03 t!03jQP5 03R !ƒ~t$VSh/3 $~ D$ `'18D$ Z $03 03 ʋ-d03`03t>5035/3QPTX03\03803<031$03 03T$<$t$ `03-d03l$13L$ @03D03D$11 03t,/3u#/3503hw8"_T$03L$ AD$)ʋ$tЃ|1@|p9@|5 03$03*/31 03T$1 uK803<03I$T$ /3/3)ѣ/3 /3503-/39@03D03$ t /3)PQ5/3Y /31/3/3 /3/3 t(@038035D035<03QPVRL tjhe%jH$^_[]503h8"503hA8"503he8"jJp503hk$jhpUSWVt$(|$,\$$Uh/3jH C4WVs(P( n8jUjH Z8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h8"joV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu蛱8u F ́Ĵ^v$hk$j2oVPP9v V譛VPQϠ t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV/3 /3t/jh?"jF /3 /3tjh?"jE 1t$PVlFȺMb׋ p03-։+h03D$H l03iى tL$ 1FD$|$ 5D035@035<035803540350035,035(03h9"jdW<,WshPWjE T03P03 t?ƒ ʺRh%te#RQPh@9"jd|$4WW#hPWjD L03H03 t?ƒ ʺRh%te#RQPhY9"jd|$4WWgPWjgD t$ \03X03 t?ƒ ʺRh%te#RQPhl9"jd|$4WHWgPWjD d03D$=`03jPt$ t$V胞ÉiL$it$V)QPMRPVSt$Wh9"jdt$@V$VfPVjC e^_[]EVt$;V-Fj3fUSWV03503=0311C03W5t03503P$ Mtg03u503hk$%T03W5t03503P$ ݅~03t )u=03N{T,2rOH,2d503 03=03 03503jVP503W !ƒt^_[]h9"ji503hk$jjWV03uD503 /3=03 03503jVP5 03W !ƒuuJ03 03ti11035/35/35 03P$ ~J;50303r,f 03H 03Phm5 03Q xw^_xof@ 03Phm5 03Q tD;50303s5/35/3h/3 3/33 03 t503hk$jhfUSWVX $p $l 7qhl1#jbh9"WSt H-$Q&030303@0303030303030303u03i0303S03G03;03030303030303=13-D<E%P)a 03$$=1303D$ D$$L$D$1|$D$ t}tUL_ÃuP6_9$D1t$PL$$XT$$`\$$hd$$lp$$tx$$|$$$$$ O03$tux|$ttL$=13r$1F L$F ;513r0313=03<E03$1ۄ13 L$ $N1 u >=03u =M=03ui $X轘0ʪPh~#h'3s h_>"'蔘0衪Ph~#h'3J hI>"N^_[_0lPh~#h'3 hs&hN 23uá23u tjwGjFUSWVjUƋ|$11K< @u=<13t?jj5H13 5H13Η@13D13<135H13UjWj A)߉n@13 D13N F543q0,4343-@13F D130Ph~#h'3ļ hs&Mrhu>"]1HD13@13̖0٨Ph~#h'3肼 h>"'裖0谨Ph~#h'3Y hI>"LVD1^_[]Vt$543q0F,4343^WVL$ 235L139})=,4379}>,13829~vRO9G9~-82(13~Z(13΋Nu#82)Ou9~82RN982 L13u 23uu82^_É1jDjDVT$(13t=(131(136(13t@9uхt(13uh{%hK1^SWV123D43j?dhּ"eY>"tW1Nt|8/uWh>"Wh>"hP13 P13tLPyt$h>"P4H131ۅu@W,5P13hk$;>"j|;>"PJV d^_[VH13tAP'xGH13P13t!P5P13ڎP131<13D13@13;5P13ޓ0PVhB&h'3蓹h>"I^Vt$H13t3P舎P13t!P&5P13IP13V5jh43h'3b "x (13(13,131T13@=ujuSVL$D$ T$t$T23T135T23T13~A2T13BI^[fV1X23\23d23`23P9PIIp23Fu^SWV5\2395X23t$X23Vjjhp235ut=t23p23p23jjPPDthG?"hk$[Hh230x23@u`23=d23VitVPG~*hv?"5w23r0hR?"hk$G1N1Nyh?"hk$G5\23~X23H X23p231H^_[Ë X23u!T$7\23X231\23xD$QX23p231HSVփuUh230x23@up23jjPP]CthG?"hk$Gp23 t23 d23`23aˍp23)Qhh23Pj w23h230x23@up23jjPPBthG?"hk$FVjjhp23lc^[Vt$ X23u\23X231\23x 1H^USWVh?"40Ɗtx<0uFD uh$?"hk$$EGuȿ|w WjP 1T L ш @ux23hjVފ P/1Fth 23u23utj8?"j&7WV 2352319}'23FىDuw9@u1=23^_USWVD$L$9tV23r=23~=239 t9|1C23Mu9|1C23=23 9u^_[]fUSWVl$}!uEh{"PUT1h{"PÅt*t$Sǀ}!u?S=肇0菙PUhB&h'37h?"=eS:x(=23uWh5"h'3 543+t$00#PUhB&h'3ˬh @"=^_[]USWV |$$Wơ23$D43D$,431-23-D439-23t\$=43t$ gDž~w1123523Y6ts43PPjJ Å 23u23t$ Dž|$$\$9t$utt #@"<$u=23t!5@"9u D43 uh'3P7!9¡D43Ƌ 23Ӏu1A9|$t $ 23 D4323t )) 23u 23ut j4 ^_[]j3USWV1|$=23t WrGHOHt uG `-239}23V239rFU523y-2323 23u 230u D43F8W芀<1ۍF-239~N23 239wUQIyt7-2323 23u23uhtk230 F̃0ٕPh~#h'3肩 hs&9 2323j2G @utL230 F238P0]Ph~#h'3 hG@"Y9-1230=D43=23  )Ɖ^_[]js1USWV|$?!uGhV"Pt$WI,VPÅt2l$t$ US NjD$8!u?S=s0耔PWhB&h'3(h^@"{8mS+}x-=23uWh5"h'3 t D$ )@ʼn30Pt$hB&h'3货hv@"8^_[]USWVPl$Uƃ=23t1ۅtf;l$ `1V$th~;-,43u=D43t =23u8 GWPt$ F x4EEs @6;l$ |=23tt$$$^_[]USWV|$\$l$19t[=233t UPrUP3Fyր0Ph~#h'3茦 h@"61^_[]USWVP\$5(43FEx @u}|~PVq6tj239~l23239SPmugƉ2323 23u.23_tO5(43;^_[]Ë523W5(43VY . ,1xщǃ|$uE43| /5239$~Z239V523tcÉ52323 23u23t 23W543UY ,$+HPS523D( |$tM1BDžh?"4~0ɐPh~#h'3r hs&41 23235239} 23|$N23239͋|$|MVPsst052323 23u 23umua(/ }0 Ph~#h'3賣 hs&4 23t123uj-j/,SWV11'3H '37h'3yu8'3@%f'39u'3H '3ÍF=439~Y239wW543Fr=4343 23u 23t 430u D43F  43C|0赎Ph@"h'3^ h@"2%'31t 43043(43^_[L|0YPh~#h'3 hs&U2 23u23u tj_+j*USWV\$ D$1tt$h@"9D$ l$1uHD5d'3J d'3;t'3у  \'3Q\'3;=D2|h\'3hl=%1GD5 | <\t<d'3H d'3;t'3h\'3j\i\'3H \'3\\5tjj Sh@"U tVG@")Ȋ@"d'3J d'3;t'3Vу J \'3Q\'3\$ !0d'3H d'3;t'3h\'3P貣\'3H \'3D50 d'3Qd'3ɋ\$ ; t'3h\'3Pe \'3Q\'3D50 d'3Qd'3; t'3h\'3P \'3Q\'3Dh\'3Q4 d'3Qd'3; t'3~;ȃ t3 \'3Q\'3D$F9h\'3Q襢h\'3P똡d'3H d'3~\'3H \'3 h\'3j d1^_[]fWVD$L$L$$$0*2| $ |r123h@"t$t$ A ot9EtzS23ǃxtostypfD<33먡!3  $)D$|$ta$8-uW23D$|<!3b23S 23D235$L$jjEZth_ju1FhVtVjthjth33jƅux'23|$t$8t$0|$t[h'3h@"$8u h@"_-jYu$h'3h@"h@"--y =23th43h~#h'3詜 33tPhk$"h\'3%O xt` 43| 43x51g43QPP M=43=23h'3h@"h@":,j`X%'343h?",%'3΃t0h'3h@"jW51543h'3h@"h@"+VWQ=23th435 43hA"h'3jrjksPhTU&h'3Қ jȏ=23jDWunh435 43hA"h'3蓚f$j0yjWt$8!$h0h237/ uh43h~#h'3+ jL$ ɸ!23Phht@jl\ x#$r@2D$ rD2ËL$=23t1@ 23Ql"L$=23t1@ 23Q#WV1F=23t9|$ ?!t!h #Wetj/WEth B")1^_4343 43$43x>43 43 $43 43 (43;t,uQ(439;u43빋 43| 43 43t9t$431Ƀ USWVP.3(43DJ@t t@(43@DJ@t uHH (43~Ã=w$S&=43!hA"  !=43" (43A1Qptntl  Ӊ (43A˃=43FP”^ U (43@߈\$ ̀1ۈL$QuH (43H1KDB@,Aǡ,43 43  Pj  5,43j$1  ˣ(43@̃=43t=23y=436DB@jLǡ(43@1Hptntl   ˣ(43@̃=43DB@8!hA"=431Hptntl  ˣ(43@̋ 431PptntlN  ӣ(43@̡43HQPN"(43@1Hptntl%  ˣ(43@̍H (43 43 p1Pptntl   ӣ(43@̡43PPv (43A1Qptntl  Љ (43Aˡ43PPH-$43 43=43= 43 9=,43 -$43 439 9w hA" 43PP (43A1Qptntl  Љ (43Aˡ43PPl@ (43A1Qptntl  Љ (43ADB@;heA" 1ЍrЃ sOJkj h(435(43" <43wk8"%843 (43:o t!gc ptrP  A (43< b=443Ho143PP9 $43- 43 =43= 43 9=,43$43- 43(43@1Hptntl  ˣ(43@̃=43F1Hptntl  ˣ(43@̃=43hRA" 1@$43 43AQP2 (43<dij h(435(43< @21i8"h'A"N@2 (43x w =43,43t 430h\"> (43x A =43u;.5 43O1@$43 43AQP@ 43jPP>(43x  1q1ۃ=23Ƀ=43 ˃h{% (43x  =43u-5 435$43 543g (43x ? =43uL-5 435$43: 43@;,43?743-(43x =43u , 43IQ T(43x =43u,$43 439QPn(43x QVP (43y F( (43y 1 (43y P5 435$43g (43A1Qptnt lu  Љ (43Aω (43y  43,43=@29|PRQ 1=43u ,43 43 ǡ(43@1Hptntl  ˣ(43@̉(43z !43SPhA(43x  1@+2323uF%(43x D<u<2=33t133(43x =43h43h~#h'3 (43x }*x1Hptntlu  ˣ(43@У(43x '23G1 43$43(43@Hptnt lu  ˣ(43У(43x =2323u6#|$WtV"5 435$43QP';,4343(43x ==43uJ)=2323u5 43Q5;,43)43hA"hA"h'A"<43h{%<431< *5 (43y qt@43@PJ@43@P =23h%+(43x )5,43j 6'(Y$i*tEEp $A8GMi $4391 43)@أ43=43t W6U431 23u 23u u^_[]jjSWV=23uj貽L$ɸ!23,43PjhV"hOB"Hy|h #{tkPL =Yà PE;tGWPj|3/tf/V ed.hDhup5,43jhV"Vj=23ujL$ɸ!23jh33胤USWVPl$5$43'Ƌ= 43$43-439ʼn) u)E1u1$23E@23V}tzP蘹t_43PPj DžtO4323H23u 23u[uE6M43@Pi1,$l& 23u 23ut j1^_[]jUSWV$23 23th B"ckjP~(43L$F$ T439} P43V23P439|BVPD5T43P43 23u 23! (43 u1C1E҃!%=23h23PƉ$ T439V239V5P43AC5T43P43 23" 237 09L$]9239|WPB=T43P43 23]9~[239V5P43B/5T43P43 23u 23yt vP43 (43 (E (43Q(439\u=Q(43I ( P43G (E,$s (43L$A (43 @43y X43)9~_239VPAI5T43P43 23u 23 X43P43| @43A(EA@43X439r (43L$A (437 233/ (43Q(43 ( (43݀ (5\439}@43R23@439|KVP@t]5\43@43 23u 23S5P43P % @43X43D$1!PK0]Ph~#h'3p hs& 23 23u!u#^_[]hA"qh?"gj'jVj4tL$Qq p PIH1eJ0r\Ph~#h'3p hs&n1^V43t.L$19 h43uh43H43t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h43kXWV (43 td< uh?"1 Q(43I t;8t7P1ǡ 63t?=043u6PdJ 6395 63hVB"R5 63j[3 63tV043523WP] 63t.h'h43QP!5 63C 633/H0ZPh~#h'3\n hs&^_USWV=(43 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-639}=63M23639|KUP#=tYlj-6363 23u23uyS5(43W! 5(43=D43tsj jSWmeG0YPh~#h'3:m hs&1 23u*23u(tjh\$hjB"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u(43 u63E#t(43 uE1^_[]8uP(43HЉʀπwR'Fj h(435(43 1wE8"uh'A"1gu@(43ErUSWV(43H (43H%u,8Xu'(4363hA"t18u= 639 63L1}5 639~[239V563b:#5 6363 23u 23\t Y63 (43Q(43 u (\t u^(438uT(43H (43 631< u0=43u't 43| t %'3ى(43823639|NWPs9t8= 6363 23u 23uuuw563063M1IC0VPh~#h'3i hs&1 23u 23uu^_[]H(43,j'jUSWVPL$43$4319 43}%43ȃ EhB"Kl$ 43PUVPt$$KǸ1$43PP$63231S̪á43tP芬EPPjM Ņtl9u 23l$ u23ue$43 43+$439}yF43@43P%Ut$ Pt$$hDž+9 23u123uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=D43tj jvS肮vލD$jPjSuYyt1t$ED$$D$1E $A9T$ 4(639Ɖ $T$~c23t$ 9V5$63A6\5(63$63 23t$ T$u23=D43tjj RS藭T$=$63RSW 4$D$D$ (63 $9~bt$ 23$9V5$6355(63$63 23t$ u23=D43tjj t$(S=$63t$SW Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVubw&D$)D$(639~V23 $639SQ4(63$63 23u23|$~#D$$ D$ ud$thB"$=D43\$tjj SV賫$63SVP $63f |$%C<>0PPh~#h'3Qd hs& 23t e^_[]Ë 23u tjjUSWVPt$ =63T$-63E<\<&I,$D$h)(639~Y239W5$633=(63$63 23T$u23%$9C $631F9uEEπ;D$$,$L$l)(639~Y239W5$63K2>=(63$63 23T$u23ml9}C $631F9u,$y^=(639}$63_239|W5$631=(63$63 23tT$ 23T$M 0E+63;635(639}$63J23$639|KVP21t)5(63$63 23u 23u^u`I;0MPh~#h'3ya hs& 23u 23uu؃^_[]jjfWV463 0639|ld 063j Qh,63= tJPDMPh~#h'3` hs&@5,6351,63063k463L$t$T$ =,63@Q葤 ,63463RDVu,635463@LF5463,63^_SWV463463r9 ,63@<u|L19tWW59u46343H2,43L2^_[USWV=H2=L2=463t 4343$,43D$j荣23463 ,63ÍS4R4nr@44v\1L1 [ ,63\1l1sRt6,lmL)1 ,63t)|?wt)LI1 ,63t~l)}L1 ,63,u44vL1Y ,63l1}w4R4Ӆ HA9~R,634@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=43t׫H243$H2L2,43D$L21 23u) 23u&tj\hB"$^_[]jlUSWVL\$d3ZhB"B"tNjt$`hB"SV fttu=D<߃u !3r|$L$ D$1U&FC"D$PƋO9rPSt$  tu;_Յuͅu t$hB"-|$dD$ Du$$1Fl$?uSt$ hB"j_L$j QP $;Fl$|1ƋD$8u&1zPUy!Uhk$j>D$ thB"jNjC=m@!sHQPW xs{QPW x4$Uh C"qY =muqB dut\$fCShmWN HefD$t$Shmh=m8@u֍D$Phm8@W  y?60Ph"C"ӍL$fqQhmW 3Uh"D$ukD$Phh"hC"X T$"hjD"T$C"hD"d'3H d'3~\'3H \'3 PhC"kh\'3j ^t$8t$8t$8t$8t$4hC" Xt$Ht$Ht$Ht$Ht$8hD"Wt$h7D"Wt$ hPD"Wj/O2PhD"h'3Z jOSWV֋|$t D"?tD"VQP|W JB8d'3H d'3;t'3h\'3j<)]\'3H \'3-\\'3H \'3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hD"thD"PD$u863hD"thD"P$u hD"9hjhD"hD"5* MPu hD"jr0D$ u h E"jt$,)݉\$D$$D$11D$$hE"SU c7~+Hr߃8tlH w&$X&D<$뼃4t6맃dtket/1@D$g=D<umWt$"Xh E"5D<KD$71@D$$+L$ !3 !3T$uA!3$T$uȋ$D$,jj@Rol$L$ $tL$ $L$,1ۋD$PbCEu SR)St$PʼnD$$ Ul$$T$DtIL$ىL$$U$E L$)QPRQ 4$EuED$ush E"h$Bu]hJE"bh$E"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh<63t$ t$,QPR+t$ )yjI=<63y heE"|$$tQt$(jVjhSy h|E"jVjh5<63^y hE"]h E"0Bǽt$(1CUVSwD$PUVSw5<63 t$,-1L$XAAA @D$HPQS =863u'l$hD$h7jUTX&, ul$u Džy h"1O~fVS5<63 VSt$V |$h5<63l$0fE<u10-u@hWj9 u -8,18tƉjjU tD$68Zt,8tEVSt$ x )b,8#ThR%|$l$8fE=863ul$0fE9EjD$LPj |$@f9fGfG<63G$jVUP tQf|$<tٺtf|$4t?<63L$0u+fD$<=863ufD$4 +8t$>Nf|$Dt1BuNfD$Dh|$u%j t$hE"jt$jFhn#y)hE"PhE"h'3PjEPD$L$jQ5<63 XUSWVA1K8uSt<։*hU7 ~WUV ~)u1*1ۃ8#ۉ؁^_[]ÐSWVP|$\$WS>ƅu]jjrtqƉx jPS> ǀ;t$8u<7*8"u(G=w(rfljF^_[ÍG=rhhE"jh E"jfD$0emjDfP=@63tD$L$ $QPj< XWVt$|$ t8PhF"j; 47$ D63A9tL D63^_SWV\t$lt8|$jYPW  GYX&Ӄ(Ӄ,T6F60#4#8#WVd^_[USWV $8 $4 5H63VPV0W5X&1WWPփ (JWWSփ _ƍ Wh PX& WjjWX& TVX&h (<Ƹ jPPV(X& hVU Vh"E=a==hD$\jPSX& 1Nxr$ S}ǃW}0t^SWP tg0$8 h&F"jI90hsF"j29 1N ^_[]þh&F"j 9۾ShMF"j8 ¾hF"VW!=bt =buk $}u+Zt$WSVL$  FYD$t8ShF"#ShF"WVP 1QQt_0( Lt5L63tQP%0,tt|@PƉ4P8tg04@tt| r>1A8Љ4DAtt;L5rShG"j7 10hF"WV|$x$t,WDWLDWDW8Dx uWjtw\wX=29}5PBt852WVhG"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$WF$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP`̀ uCt1t RP L$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP($k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$PhmJ",hQJ"$|$PQt$t$RhJ"j%C$t&8$\T$XT$H|$RQt$t$Vh+K"ji%$L$l$8htK"hdK"hhI"Y USWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h`G"j$NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hvRj,PSwD$HPhX& |$0hvRj,6S9tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhG"j"^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhG" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ X63X63`63`63p635t63D$D$TH Qq T$T$ t$t$QShL"j 11KL$0t.'SPhJI"jV563[S63463t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h=ljP8襾8H H;1D$8<9638D$D$ tD$tD$L63ڋL$4Iʉ9w9vˋt$ 1t$t$81QSPsM"PD$tD$t$t$8WSPsM"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhM"D$8Ph63Vt$,V'~GD$D$8D$HD$L$PD$LPh63VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L h63l63tt94 S.8L63T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$PhM""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhN"D$8Ph63St$,V~D$@s, D$¹tt;<FG;D$ L$?-VhZM" QhL"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP贡;D$DT$@D$(4t$8t$t$t$0|$(WVhL" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1QhL"je1gD$4$DŽ$߬$D$D$D$@$߬$ X&a111CƋD$|$8D$|$H|$LjD$LPh63VL$HL$8t/63ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh6N"b11ҋt$  t<=p63t63$T$p$1߬$$$߬$X63X63`63`63DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP讞31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=63$t1J8D$<D$ۋL$؋63k,L$1T$9|L$$)щL$ Ɖ$D$HPWhfN"W $PhD$(X& yNL$ L$tL$L$8]:u*t$ tD$PhO"j ,uhO"j uhO"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RPC3D$ t(Gdt;<r61@hdt 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW蒂NJ1 t1t$|$ 9|1t$$>]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhQ"jT$$BRt RP]RPVWjt$$VhQ"t$$k,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`PhQ"j D$,|$D$T|$XD$TPhX& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$63 63 29|[563tFNu 63563t5FNHNFy F4VPV63@631@j@PZU1@PKF ~4D$F(^$F0^,n#2^863 63t q463^G FtH 7~ F^_[]É 63=huS"hnS"hhS"hnS"hh!S"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 63H63N^,H 636363H@63P 63 63H63H4I63H89t;tprp634063t4F 63H^hS"hS"h4h!S"*USWV}]uuu W@t 631@631HCSuu WW KN0F,xNF4VPe^_[]vjv \ fUSWVP|$gX&sX&G4$O,52w0VPww D$0^_[]USWVPt$ffX&sX&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j^8p 73HtƒQ 73@ 73^_WVt$ 73F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd@F/hjv v^_USWVPT$|$:%473\$ 73$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4G31ہ=73| t Pt G3731t 98t@^_[]Ã^_[]`V15735G3hVh73m 573^ft$ t$ CjSWVt$frLN4F,=2~0WPvv 1X&t\fv4V1AN4F,=2~0WPvv 1X&1;NuN^_[hO"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRUk׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSj$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h W"hV"h hI"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP}f3T$3D$M u1^_[]USWV(t$FFF ]F F$|$0tfhj蔨ljPLtLXt uB\I\$$|$ C$|$4Nh$X"&<1ɺPt`tLtt l$,\$(|$0uejfttP>ttPA 芇t u_4u_4_HoL_HoLUS6jjW'hޛW>q$ 1=2lj2l$1 UPQSWVhj蛦Ë}Pw S P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhjNjl$hu PS P E1PUtA|$4t hW"z$SW1^_[]u C4CHKL1}Mt|$4t7hW" $t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW":$  $ V 19tQRhZW"_ 1@^USWV |$,\$$t$ tCPPt Ttt4RQhT"ܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthT"Ah\'3DD$(u KHKpStURQPt$DljT$t hZX"!u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhT"^ G3VRh9U"G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhU"D$L$9tQP$$hU"݋t$Ht$nL$tI9ȋt$ tPQ$$hV"衋1t$(\^_[]h~U"hpU"hhT"豮h~U"hpU"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$aV"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttS|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$V"nu0|$ r]@hD$D$D$,$D$ 蜣,[D$ p D$D$D$,$D$ n,LD4@hD$D$D$,$D$ ?,@o M|$@ t"D$D$D$$D$$V"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$aV",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$DG3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW FƋD$0T$UWEƋD$0 u$$$UWEljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPGEERP7E$GW #RP"EERPE$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaV"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaV"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaV" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW@Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPG@t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP?T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP ?|$FV D$t RP>|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPt> t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP<|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPN<$ D$TBL$?ttXLT$BtJ J T$$T$ QP;L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPI;ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV19D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hV" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hV"hW"h h W"hV"h h W"hW"h"hI"hUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p zA L$H SjQQ ^_[]USWVL$T$ BG3ulF1GLZ&UhZ#,$d'3H d'3~\'3H \'3 h\'3j u q1^_[]V'3PPh]"VVjjh^"?q`X"@4Z&Ph#h'3@Z&ujǸUSWV׉΋*h`X"UҏpY&tCt[PU踏jhhG3s 5G36K3t2G3G3WVS5K35^_[]Uh2"jZ5G3hk$j[USWV$:$D$VuPW 9$j uPW 1ɉ\$QSu3 Ƌ8̜8"u11F9Ή$<$茜1ɉQSu J ËD$8Չc8"u !t$$Vhyd5K3a tbVhY"n^_[]jhY"7jh7Y".uhiY"$hY"hY"$p hY"hY"jGY$05G3h"j\YUSWV}E ph%VbFhHZ"VLh~$V6SD$(P5K3}Z#D$0= M$L$A1yyy D$Phwd5K3 D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhjpD$v1111O w+Ow?u$L$A1AAA D$Phwd5K3-  \$tmt$ NL$,D$(G3D$FD$FD$ FD$$~D$(PzPWt$,t$t$t$hZ"ۼ KuD$1D$|$Ynhxd 5K3膁R5G31111VQRP5G3hZ"qhxd 5K3> G3LQhZ"Aww ww5G3hZ"w_G|$9w  jPQ5K3!¡G3tNSVPh["ŻWt$ 5K3m/ $9t"Qh\'3pSVPhZ"'?كT$;r ZƉ[|$?e^_[]jjU5G3hZ"lh}"hqZ"hNZ"h'3z jpQh9Z"WV$u>$jvW2R s'Wh{dЀ5K3 t^_jh["jT65G3h"jTVPPhtd@5K3L $t%t5G3ha["E$y["uJ["5G3Q#G3$$["["sl1#QPh[" G3$$ ["sl1#QPh["Թ G3$$["sl1#QPh["诹 G3$$["sl1#QPh\"芹 G3$$sl1#VPh>\"j^5G3h=["jSWV$u^Vhzd@5K3~ tH$D$PWVh}\"$PwwwwVh\"^_%5G3hl\"j,SUSWV}D$Phd@5K3} tzD$Phd@5K3^} u5G3h\"<G3$|$\$ t$jVSW]VRPSWt$h\"/e^_[]f5G3h\"jmRSWVP|$uX|$_h0#S耆ƅthX"Slu+1Qhwd5K3| t ^_[75G3h"jQUSWV|$0t$,1@<<!3$1ۉ؉D$h\"WV:] qt\$te+$95!31|$7wWh|d5K3{ D$ ;D$t-i9l$sUt$轈ƉD$l$묅hhPVMG3L$ l1#t%#RQPh]]"胶|$ t\ư1P`VvvvvQPhn]"L G;|$ ru5G3hC]"&$t1^_[]W5G3h\"j^P5G3h]"jPjUP|$u1Phd@5K3z G3tQh]"豵XD$ 0Qh"jOSWVP|$t$^h"StDh{"St@hV"Sԃtt$'LK3D<pk3$K3D<j/S]_F@K3 K3Sh\K3hXK3hTK3h^"5D<eD<L$<=TK3xTK3i5D<JR0K3A222#2 D<1Bhk3tT$d3D$dD$ tTj/S]tF1;tٍT$dm3D$dD$,t>\$At$8\$/X`&`&ho^"Ү u1\^_[]h^"TPh^"Lh^"E5!3pk3t4PIIu'h}"hx^"h^" 5D<hS^"jH=,K3u8=4K3t2t$dVtt"1PPD$lPVjW>t52=HK3u4$P52 u#$=uHK38K3 4K3 s1@![Vs ) ȣn3n3n3n3? n3 m3m3n3xp3n3|p35n352=n3=p3?wr$r$m3 Bm3uM `K39w>UUUU)ʹ3333!!сisdK31:m3t!tt6m3vm3cԋ>m3 Ln3Pn31Bm3‰ Tn3Xn3`n31 \n31AhQhHn3d i-Hn3=\n3 / Ln3ًPn3P+==w !r%1H$D$ ʀŸw1D$ $}ȹ>m3yt0m3t  u\n31I $L$9 Hn311O|$ytyt F9u1H$L$$L$ 1D$(1uhru"$D$Nj n31҉19ʃ$\$ڍD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Eu9$r$$p31K1Kޅ`1PPPPPP =28hw"z16m38LFu=(K3uRh|"%tajh0|"蓝1\|"WjWWWP+hm|"t҉vm3u 6m3=8K3u0K3u m3t 0m3t3$ D$ m3 u=\n35Hn3Pn3Ln31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ m3|$E9u KD -dK31ۉl$(-D$D$D$K3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$Pn3 Ln35\n3dK3D$t$m31ҋBm39߃91Ouω‰ӍQ|;-m3m3|7PK3L$ T$t$u.h-"h;"R\$ L$ T$t$=(K3tt$1|$4uʉx"PhPPPV @K3D$ \$1 Xn3Tn3m35m3$L$$L$|$ u4$T$T$4ȍDD$m34m3~t=u0m3t 9r u֋ \n3~:Hn3”>u~t:t  Iu8K3 щ $ )uhl1#Wht"t |$Z)uhl1#Wht"t D$|$s ^_[]ËL$D$1;|1HUSWV2(52ӉӉ؉!!jPQU7!ƒt&\$ 22QSPk :1H5Q5tk3PT ;2uN!5tk3hVS) ^_[]ht"ht"j USWV1H:m3t$u99m38m3  7m3l$M?>>m3:=m3>m3Bm3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$w"tD$x"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4hnw"q Dn3@n3D$HL$LVSQP=D$T$D$PVSUP=D$|$ D$@VSPW=ljӸ1=2ƉT$ L$@PVt$QR=PSW|$LWVUl$lt$,t$,t$(t$@hT$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhw"np3Vƀp3t$Vhw"m 5`K3D$,$t$P։ω,^_[]hw"jUSWV΃ twttuy"^T$(|$$+dK3уD$ ;Ln3Dy"L$ Pn3|.|$,T$0 Xn3|$9=Tn3|=(K3u|$4u 1^_[]Ë-\n3~} ʉ$9twHn3|(tk Ln3t( T( (t1+dK39\$ \$$}2;T$}#=(K3u6|$4ttD(OG1nFiy"t(n9Չػ}n9l$\$QAuƉ:m3tt  $tt ^>m3 Ln311 Pn3t$ -\n3t$|$$|$}Hn3] ʀ|(tP Ln3t( ;L$T$|L( (9Ή} =(K3{|$(t ;Hn3KC Pn3Ln3y"1$t=t Ln3 Pn3Sy"=(K3|$(5`n35Hn3A1dn3`n3\n3Xn3Tn3Pn3Ln3Ɔ:m3t$ |$(P:m39`n3u85Hn3A1dn3`n3\n3Xn3Tn3Pn3Ln3Hn31Ƀ|$(T$3\$1 5\n3n Hn3|+D$Nu Hn3[\$j5dK3Ln3)؋ Hn3P|$(t$ hhj9Hn3VfǀU`n3L$ Pn3D$Ln3ƋD$$ȉ5Tn3Xn3\n311\n3uHn3=(K3hz"Kz"ucz"y"=(K31|$(9 `n3u85Hn3?1dn3`n3\n3Xn3Tn3Pn3Ln3Hn3Ju UPQ! \n31|$(tD$Ln3D$Pn35Tn3=Xn3^_[]hnP"jWVHn3t^ tڋt֋|҉tΡHn34 \n3 QPV} \n3ƀ^_USWV T$L$\n3@hPhHn3  \n3Hn3~CPn3Ln3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR Hn3;UjPs? fDŽ;UtZF , M ;M;MU;; Ln3 dK3T$)ʉUL$  dK31 EE=Dn3 @n3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M\n3 ^_[]hz"jWV1=@K3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5.3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$))!1Kl$ 22uhUPuzQ5tk3P ;2u[jVW52(!1Kt?D$H5tk3#$SUP- 52V52 ;2tÉ؃ ^_[]h;"jUSWV$0$,1@D$l$D$D$ $1hQ"WV suM?j U5D<o áD<8=L$90v?8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-!3)1<$L$jhQP4q*ht3hedAP' =u309l$| 0@fu3UjDž\$ t|d'3H d'3~\'3H \'3 h\'3j gjht3h\'3 d'3H d'3~\'3H \'3 h\'3j Wg<$ D$ttl1#t"Ph"0aD$fu3t3Wafu3gdWPV% xnu)D$PhwdV% h"h6"贗V1^_[]PhX"25D<h"j4 h"h"^NjW;Ph΂"h'3b jWUSWV\T$t3< $S'D$9d$ՉjRPt$ V%11 Sl$UV 9 1U\$tL$j@PQ; 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4`&hk"@_T$l$ u31ɺ,u31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$ u3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf u3ŅtMaQ4`&h&")^T$ t tuf f111 u3|$ $u3(u3T$,u3-u3f.u3l$E<$g\$ttXaQ4`&h"] ;B Q4`&hɃ"~] <$\$t4`&h"^]<$l$!F1D4 =$v3L$ه"/0APWt$h/"jd$v3{<|$\$W4$w*Wh"h"S袉4$u h E"j<F j/Pt|4$4$$*jJUSWV\$ l$|$t$1E v3+&$v3(v3h"WVG h~n3itVn$v3Ѓa~.btCd,v3봃otBs4v3띃NuSD< v30v31=(v3(v3mjSh$d&5D<tHPEuA!3)ރu4t$$V41ut$(t^_[]h·"j,PhP"h'3S jH$4"=(v3uD$ D$@J" v3t z#P=4v3u W%=,v3u M"=0v3u uH$@P0;h4"h%jWVPh{"QSt1ƉPjPWc WZt jPV(P^_ÐWVt$|$ VWEt$?/tWhÈ"cVh܈"b^_Wh"jfWVt$ |$7;WVUSWV $$l$WVSU$ $ hU3Wh0"uWVh"jGD$@tF$j$hf&hVyV$$$h"VOjFUSWV$$$$D$1 h"SU $D$D$1G$D$ȃ 1$de&N|w5D<Ft|$`N|Z5D<Fx|$Cj$he&5D<P35D<UFp<$h"SU V!3H9$|U4n$W^.l$\$t <$tu;D$ PWXtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h·"jWh$jG(Ph"h'3O j@DWVPt$jWV 9u9t x^_Vt$h"jEVt$V t@^h"V^Vt$Vt@^h6$V|^WVPt$jWVE 9t9u x^_Vh"jWVt$|$ VWAt$?/tWhÈ"(_Vh܈"_^_Wh"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h&"q-1VWt$ t$P:1@PPVVu4u0u1OËPhhf&P }D@u hhk& hhm&S }D@PE,CEh{0%VN\$th{0%Vh:", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Php"+%t9\$t h"+\$pD$p\$D$D$ 9\$~\$~tSh"+\$9|1} t h"s+hW5dv3h "\}4xME0;E4ru0hH"(+},u,D$D E4t hk"[D$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tSh"(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh"((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"'3PG |$)Wh."'3PG D$ $L$t$}D@tCW&1@9tWh݋"&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$u`hL$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$LԼPttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2Wh?"h'3[A ;$uh'3jjHht"|$$D$tD$|0Wh" $tt$SWh+"h'3@uDt$ vh`"c> ~$r-D$ t$$$0h|")>j ?=}D@uh "th;"tD$ttt$$DŽ$߬$$ڌ$ X&|$D$ \$$"=F T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttP6Fx HIt$41VRtRRP*t$ tPhaV"AQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$S VjW t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjhV"}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8qWFD$(+D$L$,L$ ʃ{1QPWVGth"j01F\$D1VPSh"D$XWVPS%|$$u1Ʌ|$t1ɉAw1@|$PhΒ"]D$tt$5\v35Pv35Lv3t$\t$dt$<5Xv35Tv3Q5Dv35Hv352PWt$L@ƃ|$4tVa USWVӉ $|$j W\$ S! Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph "1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h0"3QPWUt$t$hQ" QPWUt$t$h" t$t$h"j被USWV'31F/WVUh͓"WVjh"WVj!h"WVjh5" WVShP"WVj+h]"WVj;h"WVj$hŔ"WVUh"yWVjh"hWVjh3"WhK"W WVj hf"8WVSh"(VfD$t1B9| 2I 21z3Iu顴2Pz3 2~ t1@z3@9uUSWVD$921A9|G2SƉ<$~ SjV~ 2D$~Q1ɡz3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5z35z3$2^_[]V$z3 z3D$D$ X&T$ t$ 25z3t$T$L$D$\$ $R"$^Vt$FtN H N tNHNfr v V z3^VD$`sH) z3z3 z3HtP4BPQ@@1ҋz3v9tz3z3rh S"j;tp4F@z3^USWVD$T$#25z3tC=z311-z39| n-z39t%9P4uH$3L$X(3\$ t Fu1^_[]h_S"hXS"hh!S"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv oF V>z3 z3 29|[5z3tFNu z35z3t5FNHNFy F4VPVz3@z31@j@PU1@P{F ~4D$F(^$F0^,n#2^8z3 z3t q4z3^G FtH 7~ F^_[]É z3=huS"hnS"hhS"hnS"hh!S"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP z3Hz3N^,H z3z3z3H@z3P z3 z3Hz3H4Iz3H89t;tprpz340z3t4F z3H^hS"hS"h4h!S"ZUSWV}]uuu W@t z31@z31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gp&sp&G4$O,52w0VPww D$0^_[]USWVPt$ffp&sp&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p z3HtƒQ z3@ z3^_WVt$ z3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdpF_hjv vB^_8USWVPT$|$:%4z3\$ z3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=z3| t PtĊ3z31t 98t@^_[]Ã^_[]`V15z35Ȋ3hVhz3 5z3^ft$ t$ sj SWVt$frLN4F,=2~0WPvv 1p&t\fv4V1AN4F,=2~0WPvv 1p&1;NuN^_[hO"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRv׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSu$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h W"hV"h hI"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPq3T$3D$M u1^_[]USWV(t$Fl|F|F -}F F$|$0tfhjijljPLtLXt uB\I\$$|$ C$|$4Nh$X"2<1ɺPt`tLtt l$,\$(|$0uej薲ttPnttPDA 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=2lj2l$1 UPQSWVhj˱Ë}Pw S4 P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhjNjl$hu P胯 P E1PUtA|$4t hW"/S"W 1^_[]u C4CHKL1}Mt|$4t7hW";/t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW":$  $ Vx19tQRhZW" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhT"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthT"qh\'3tD$(u KHKpStURQPt$DljT$t hZX"-u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhT" ̊3VRh9U" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhU"D$L$9tQP$$hU"t$Ht$L$tI9ȋt$ tPQ$$hV"X1t$X\^_[]h~U"hpU"hhT"h~U"hpU"hPD$L$ $QPjĀ2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$aV"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt^|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$V"nu0|$ r]@hD$D$D$,$D$ ̮,[D$ p D$D$D$,$D$ 螮,LD4@hD$D$D$,$D$ o,@o M|$@ t"D$D$D$$D$$V"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$aV",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D̊3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW;QƋD$0T$UWQƋD$0 u$$$UWPljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPwPERPgP$GW #RPRPERPBP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaV"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaV"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaV" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWKNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPwKt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPJT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP9J|$FV D$t RPJ|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPI t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPH|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP~G$ D$TBL$?ttXLT$BtJ J T$$T$ QPGL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPyFي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVaDD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hV" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hV"hW"h h W"hV"h h W"hW"h"hI"蘤USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ聦 ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP 1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QPr1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jDcƉ t,U9Ftf^81FF}L$$7ʋLt$,t$1t$L$ T$D$D$($L$tD$L$$V"|D$(t$,L$ GhD$L$D$$D$ ͎t$<$D$]xuuAQ AQt T$$*3NdQEKHL${LL$Q,q0tt  t1ۋuuJV4KD$,D$$p D$D$ D$D$$D$ LL$|KVH^L\$̊3GhD$L$D$$D$ 跍@V t$$z|$D$X,p0tD$(tM  t1L$$D$(uZZBA4 $Pu\$ tu\1)׋N tut ⹐t 1¸ u1ɉL$ |$$D$-<L$IIlt|t1҉D$M41ˋTt$0t$t$1ɉL$T$ L$D$D$$tD$ t$D$$ڎ"{L$0u%ltUH#D$'ltD$1ҋ}47RA 1҄1t$4 t$ 02ua r u:1GX tX U<T$A4 $Pe^_[]D$ ڕ"D$˕"D$C$"hUSWV(D$@h+h1T$<PD$ AHltl$|$D$@@0|t1ҋl$H1|$<΋t$  3uN 3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPUr$K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ 3{3 3\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(؊3y 33Py`PD$@Њ3 Ԋ3C9݋|$t< u6AWhV űD$ 1GtPhk$q^_V"1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىhw"+C< t< t< uh{"SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@Pd t$$$ىh_"rC< t< t< uSC!=$<rLjSh"Sh"Shܜ"h."՝t$<L$D$D$L$ oPQtXljo 1tX L@uH~vCtTjhh"_ V&b$^_[]V b )UjSAc D$ D$ CD$CD$C D$C$Cl$Uhn1#V; u D$CVa)1$<;obD$D$PSh"蘜 =USWV$0xjW_Zƅ~F$0h$1jU0Z~4$hPEb C9uЋ$4h{"S+Ǎ$ىh"$0St| uƄ$ $0phɞ"QUyD$$0qhӞ"QPWىD$PU}PUS u׋$0EED$1ɍ$D$ $PhSC D$PD$PD$PD$PhH%S'aD$L$ T$ ыD$E L$ T$ D $A9L$D$uPl_hH"h+"u }ShH"hZ" ShH"hz"S  $02t$t$h"$@t$Ph>"5 |$W^}~14^G;}|V^1^_[]USWVD$(}~;$ ~VE pS^ $PjVWjSOD$11D$D$D$D$$D$ D$h"u Vuo, H5$r&D$>j 5D<P Cr3밋D<$PCr CD$+r(C5D<VD$()rz5D<'D$C!31;E1.3M 1Dr@!3+OD0w !3;E|ÍA'rD<$PCrj h0#V ىVvS&1PyuE$ ~S4V~ $PhjSPt$VLuVh" ,Whq"j?ÍD$LPS"Au $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h%"Qhr$PPrr @r ,r .%r0B$PPh%r0BVE =]8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQ. $Ph"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh|"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP- $Phѧ"Phr j"t"PShg"#} .1$P;$hΡ"Shrt$VW"9;$PVh"||$$Vh "|h۠"jhr t$j=3:$hC"Whrt$h"?c.\$jNhC"WhrS$d|1$XAA$Pj2PQI+ $Ph"Phr9rhǬ"ʱ$`>ߋN8&wu&PVh"z `Ouet$$P\$ ZSh"zhF"$P\$;$PPh"Nz V`yh"Sh*rt$  09rh7"hC"$\>$Thv(%y VxhU"躰$X~:$\1j h$V "tQ胰C`;$X|j x~-hz"[$`>VK`Ouj kx$X1~$1:t @`9u9u$\Ph" y1@\D$,\$H|$PS$hjVQ L$,9F Vh"VhrW ha"药F0Ph"xF0Pv,v(v$hA"nxj whn"G$ThN"CxPh?"h/"FhQ$VfD$0L$4$PND$8Fh"Vh(r WO  FtsSh"w$PtPhZ%whգ"w$Tt*Mbi)QRh"zw j v$XqPSh"Pw ]h".$X~n$1Wȃw,"$|s&L$7"!""& ""PRh"v F`;$X|ۋt$~G$`>G8tu #P&w ,u&QWh"}v `Kut$hΡ"VhrP>"t"P5t$1 E$`$d $jj h$QPjV!yjh$VM  V$`t$VhZ"u$XMbi)QR$\Vh"u$|$|$|$|$|$|Vhɢ"bu $\uM%#1wh"1L$!rh"$PPVut$h "!11҉4hӀB9ul1#t%#QPt$h"t=3~S$h1hU"t1PQh"t C uߍ_ j s rt$h8"Vh&r@t$";$Pt" j"t"RPt$hX"tt$ USWV`p׉͋$tph"SyB,$tSÃr t1C1|L$PVQ5* Ou vu hu Z$1hoVWAL owt1$0 j2t W  F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghhx"W  Ƈ$L$hy"Qh+rU9uh۠"jhr U`p^_[]WV1VFF FFFFF h%"VhrQFĘ^SWV։ϋ\$1D$$jh7%Su  tVjh;"Sa  tBjh#SM  t.jh@"S9  jh0#S!  u$D$D$hE"PhrWh^"PhrW=3t?|$2"t."PVhq"p |$u$4u&Vh"p ^_[$oWVKƿ'3Ph$"Ws Vhg"Ws Vh"Wr Vh"Wr Vhש"Wr Vh"Wr Vh"Wr Vh>"Wr Vh_"Wr Vhv"Wr Vh"Wr Vh"Wqr VhӪ"Wbr Vh"WSr Vh"WDr Vh0"W5r VhG"W&r Vhh"Wr Vh"Wr Vh"Wq Vh"Wq Vh֫"Wq Vh"Wq jfVRhQ  t^Vhk$j] WVPΉ1WPhPPj PQ u^_Vh "QjUSWV։ωl$PU\$hjSG E9C Sh"ShrW Vh"nssss h"}nss3h"hn{2"2"t."t$(Ph"An t$4t$4t$4h5"(n$t$Ht$Ht$Hhc"nD$8Ph"m$t."Vh"m$4u&h"m$hӦ"mĘ^_[]t$ t$ t$ j2 tt$h/"jUSWVӉύD$(jP1t$`FFF FFD$hl1#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPD$HD$PD$P X&5X&|$D$ fD$ l$ \$Tl$+D$Ty1s&Phk$j($PjT$D$ +T$(+D$0хyL$XD$\D$\5X&D$XuT$hL$l+D$$D$ $߬$ Y&ݜ$ܼ$D$pt$t$$߬$ Y&ݜ$݄$T$xL$|l$x Y&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$Psi DŽ$ <\$D9r<"t 43~?-|$h"VS@  M~%Hwv$Du& $3$3ǃDt*Mh6#5D<i03u5D<Md33nNRt 3j W5D<? 83L$9&-D<Ԁ23 33Ѐ2j W5D< ؀2L$9]`<33} 3nP,tWP,ujjQPh"jD$كL$l$ umt$<l$ 1  ut$)K$3h"5D<h"p5D<hb"` $L$L$GȍQw[sV?PP+-G A6P[Gu$t L$-AGL$AL$$j= 3uu jj=)hI7j=u jj=4h'3j@3h^_UJu F܀21C$3q:rftxT,$Kj(jF1t$hVD$4 V胂 t?׉ u ,3=Ԁ2D$t PyD$h9WVPK0E9t$u#'&jk5=3.'5D<h("&h@"5D<h" hЭ"Qhs"Ru[$ D$D$Ri#Jj'jEoyJ=H3L33th\'3jjh"h"bEji'H=3th\'3jjh8"uh<jjhe%. I1V'VD|$hWt* W螀 th`9RPW.F9u"VDw).V T$1GW3f%WVth\'3jjhQ"jUDj\&=3th\'3jjhh"mh<jjhe%-h"#j 3$=3t5=3th\'3jjh"hKjjhe%-jh"@jWWVX;ƿ'3Ph"Wb Vh"Wvb VhR"Wgb Vh"WXb Vh"WIb j?WfUSWV1ۍt$t^^F @F XF4F}XT5F$F($hPhW%1 hȏ3ۏ$t$|$lt\$l\$pV3(33L$p~ D$t3'3t63w1ɀ8t 3=3/hUh3:Vh"W8a W53hh3q 3@ u =3 t h3Z3t$tH t Hh3$Ph@%h$ W\hUW Vjj@U蘲U$h"h'3d`h'3jjh%hh.#$P  t$t3$$8t 3ah$PU }h'3jjh"h'3jjh "h'3jjh" D$tt?D$lD$p$)h4UW L$puD$lV落$H$u&$WPh%W  U{ ׉ u ,3=Ԁ2$tP s$h9WUP#?D $WPhR"WX p =3Xh'3jjhX" 3f$WPh &W  Uz ,RP3$ $P$PQ$WDPh.#W  U5 @ h;p pUa($WPhư"W: R j^-=3t%(3I$WPh#W h"hݲ"h"h"h"hk"hE"h"h"hȱ"h"h"h"hd"hD"h("h "h"hΰ"h'3\P$WPh$WJ bU*yŃ=3u#3MIрK=3u }8$V+ƹV])uV+WY $VVY+DžD$u hm"Xul$VhZ#h'3[ Vh9%h$ PWW(yl$`t$Xt$T1ҋ\$މT$̓=3u3MIрs6=3uA}t']he%S 'th #S'uWH(Ņu{D$TƄ ML$XE|&hP$ Ph"h'3ZD$+hP$ S ىV1 D$@W'$WPho$W $'h'3jjh"=$WXPhD"W j)$W"Ph"Ws =3tVh'3jjh!"3$WPhM"W 6WKTh'3jjh3"f33h'3jjhl"E3ꍬ$U$PFGV:)1;$v7$5<P{3$P$$1Ehh'3jjhZ"l$WK(_D$hI9jUPL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$he%St jh{#SW t ;/u f. Gf./WS9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PStH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 5Ѐ2 3H $s-t$$tHfHxt P2)1^USWV=3th\'3jjh")jj9#tvƃ=3th\'3jjh"31GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=3tV$Ph""h\'3K ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h."d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"PhF"h\'3J W_1l$$ttF9u t G9t$@v&Qt$h3h+"h'3IJ<$WbWE&F~X|$<th̵"V_VCbV&vfFt$ t$ t$ h"h'3IEuFufFFV!|$WP`WV&N=31ۈ 33|NIL3h3$3ǀ3|NAMǀ 3EFNDt$h3h"h\'3I1N1@=31ۈ 33|NIL33W1ǀ 3FNDǀ3|INOW$3ǀ3|NAMǀ 3EFNDVdPt$h3hj"h\'3eHC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$hw"h'3G1t$h3hH"]a >W\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@=3$ WbPt$h3hj"h\'3GUt$$t$$|$$WƀH1@=3ىV_bPWh3h" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3hj"h\'3F؃^_[]S1 33|NIL3t!h3Xǀ 3APEǀ3|ONTt!h32ǀ 3FNDǀ3|INOt(h3 ǀ3|NAMǀ 3EFNDƀ$3t(h3ǀ3|MODǀ 3ECHGƀ$3[SWV=3th\'3jjhc"p3=31VWftmxtg 3W sJX tCf{u7=3tSPh}"h\'3D S\S [빃;=33k53tc~ tWuLfth"W Z=3tWRPh}"h\'3.D Wy\W9 륋v$^_[SWV=3th\'3jj h",3tS31{ t$C$Su[SFuՅu53thԶ"VKYv$^_[USWV=$3R3utDh\'3jj"h",th\'3jjh"5(3t$G!jj#^ơX3;3\33,׋-(3WV]Ɖ׋ \3X39sAWV2ÅuWVh%"p\ SPh5"h'3B c렉1‰1 u`WVÅu hm"%\Cuh"SXCt SZcSSPCcQPWVhL"h'3B:K(39tPt$ ZU-(3X3;3\33^_[]USWV=3th\'3jjh"fP3jY9T jj\ʼnT$3 3PQ\D$5\35X3J\Ɖt$U9\ʼn$St$p\Él$9$\$\3 X39ˉs6fP3j8DTk D$;X3\3rM\$ -(39sI\395X3s9-(3tS (3E9u\3 X39\$ \3 X39ΉsZWVÅu h."YSCPh5"h'3@ cWV[Ɖס\3 X3911 uU9t$D$ rIWV<Åu h."|YSPKAc9-(3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5\35X3fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=3th\'3jjh"CFtVPXfvu݃=3th\'3jj h÷"3=31ҹ$RL$QtMƋhtDEt9VP|$ WZ21ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=3th\'3jjhη"93=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h,"VRWh"h'3= 1^_[]fUSWV`=3th\'3jjhW"5353543hv"hhހ28$3 t=ļ3uFFF%)Fu9rV9=3tJh\'3jjh޻"F 3t(t$h\'3jjh"F 31V9vtRPh "h\'3 7 3th\'3j rI$ 9̓>t9߁^_[]á@3tPjt$t$uùބ2WVIAfF=L3|CP3)fX35<3jQhT3u5L3F1T3PVQ̶ =P3FL3^_ùހ2Qhw"08u"hݼ"h"543h"h'35j*WVjhހ2<1t)h t 8@ W^_VX3 \3t7#T3=@u%o>X3 \3tT3!=@t^USWV$$$ $jhWVt,T3tE1M1 tmjWVS$8jWVS$8t$Sh9%hV0V$ H3U Rh5H3DžtGhe%PytShI"h'3B4 5H3DžtGh #P;tShq"h'34 5H3[Nj5H31jPP6l+^^$DOGrhPD$Ph"h'33:hPt$V! $(j7V@ H3u D5H3Nj5H3j1PP6+^^X^_[]SWV׉1jPP1+FF9tX\$)yWh4"h'32 %؉jQP6Q~tF hP6 F^_[USWV|$_ OtGhS7ţ GO9}vDty)9|n4 ȉG.uFhW%PM;-33rv=3tUh"h'31 \GP1=3t:Phй"h'31 %1=3th'3jjh"1^_[]USWVD$$Pg%D$x/@thW%Q:1ƀ81Mbi)T3H1ًP1 t H3P RVZ5H3At\G9uGSVP莸 t5H3Džu*hW%D$P:tƀ8MbE^_[]USWVt$!M1 tFjhRW,T3t(E1M1 tm`ƋU R^_[]ËD$0hUSWVX=3th\'3jj&h"$3 ߉^_[]USWV|$u h>">Wq3u`Ɖˋ-@3U\DžuhH"z>-@3)ً39w؉9vlj<3|$3WSn^_[]USWV։ϋ\$ t;=33rVWh#"= -33QPVW{s LK$\=3t%[$tC1K 1 uh="S9^_[]SWVt$f~th"V9~u(~thԽ"Vg9~ th"VS9FN tkQPDžuh "V)99tt79uNH4~^ SW FtPh"V8.>W胶333F$53^_[ËAP 9ttЋR9uIHËIH hL"Qt8Vt$V33^SWV|$t$Åuh-"V,8;^ty^C Fs j/WGS贵3 3W W菵FV86P(1ɅF fN^_[USWVd=3th\'3jjhc"= 3td|$xhV"W"ƅu00 Ph}"h'3|! Wh~";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6Pvuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(Wp[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSG39|͋ 3 $53T$|L$<q$Q AiH3L3QA 33QA83A$t$ Vjj(QF @t3m0z Ph"h'3# t$xh"8V)h^_[]USWV$=3th\'3jjh"e1PPUO Džy00 Ph~"h'3 Uh"88D$,PW[y00 Ph<"h'3U UhF"7$jSmƅu hh"7SVWd xD$j(PWP y0$01 PhԻ"h'3 Uh"{7W3$3RrD$l$L3=H3,$1Չ1 9$h'3jjh"jj5353?3jPz3u h"6PjPhe%HĨ^_[]fP3D$L$ L3H3D$L$ 33=3u t$(6t$pPh"S6D$ L$$ 33L$T$ 3<)3؅~ڋ\$ $L$E3 3 ‹T$t61 t@53h2":"+h$3|6u) 333! 3^_[]USWV}u13 393u.=3!h"!1ۃ=(3D$$(3T83@3L$L$ (39$$531֋=31 u"$35L3$3=H3 iL$QQc'3Ph"V? h3BPh"V# U=3t53hZ"h\'3 h'3jjhi"*3D$QPh"h'3(3=3'3$$3 1A $t=3tPWh"h\'3 =Լ3 33hQV 33^_[]t83 PUh"k s- 3hh3UN 0Ph"h'3z jpUSWVE3fP3t3 p3D$ Z$ $(މ4$9{CKQPh "hl$U=3t CU342h#"h\'3tUCKQB+{))σ8"WRL$ QP$(%CKQB3{))σ4$X"WRL$ QP$,远BCKQB;k))΃G"Vt$RL$ QP$,[t%=3$(tqUhi"h\'3 \{$(u0jhy"D$ PP tFjh"D$ P8 tk=3th\'3jjh"蕜9(jtzwC@"P$6C@"P$C@"Pj$$!C@"Pj$$ u_{C@"Pj$$)!C@"Pj$$ =3J=3t&l1#;$ t"Ph "h\'3 =3th\'3j D^_[]qSWV|$t$=3td3WVhh3P = 3uWV5`3] t^_[Ë5X3=\330PSWVh"h'34j*SWVt$=3td3Vt$hh3P = 3ujjV5`3|!ƒt^_[Ë5X3=\330PSWVh"h'3jVϚ3tufP3VVVC ^PD$L$ $QPh'3 XL]>V=ļ3t114Bu11Bu=Iu1@'535\35X3Ph"h'31^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th"WWNƃ= 3uhVEx=3t"WM vhN"W< Vh3ha"^_WVt$ v vf1t9t1G@t9uuh"Vv vWh"h"hh33^_WV|$t$ = 3uWVh\x=3t:WVh"h\'3w$0PWVh"h'3Q^_Vt$~th6"V~ thM"VFσfFVƃ= 3u V薓x=3t8Vhm"h\'3 #0 PVh"h'3^Vt$~th}"VMFσfFV萿ƃ= 3u V;x=3t8Vh"h\'3K #q0~PVh"h'3&^USWVl$|$\$u0= 3uCWSLZy5 0-PSWh"uuI= 3uWS[xB1F=3t\2"t;"SWPh"h\'36Uh"2$0PSWh"h'3]1^_[]PD$L$ $QPh'3 =3uh2"=tXh")u¼jWV|$ = 3u1VVhWݑx!1F=3t8Whc"h\'3 #0PWh;"h'3^_Vt$~thw"V.FσfFVqƃ= 3u V|Xx=3t8Vh"h\'3, #R0_PVh"h'3^WVt$ ;53|$3s(WV=t xt@u;53Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$133|NIL3Ft,h3wǀ3|REMǀ3OVEDƀ3F t,h3}wǀ3|TMPǀ3NAMEƀ3Ft,h3Mwǀ3|EXTǀ3RACTƀ3Ft"h3wǀ3|NEWƀ3Ft$h3vǀ3|KEEfǀ3PF@t(h3vǀ3|EXIǀ3STEDƀ33^WVt$ V蜱1t%t 3P 9щrVh"h'3 1^_SWV|$'3Wh"S Se3HQP~ Q1 P t3HQP~ Q Pڸ t 3@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#h#W9t9hC,%W't'\$j SW[ $ 9uy6hG"U$~h#Wt@hC,%WҤt.\$j SWZ D$ 9uyvhZ"j=pD$PhU53Қ u ^_[2hj"j3pSWV |$t$ >h#WAt9hC,%W/t'\$j SWZ $ 9uy6hG"U$~h#Wt@hC,%Wڣt.\$j SWY D$ 9uyvhZ"jEoD$PhU53ڙ u ^_[:hv"j;oUSWVh赛$(1hWD$ P胭 |$ |$ D$~P1ۈD$$,,jUhW"^ tjUh"^ tG99ufD$u\$ tR$,4jVhRh%P^ EjVh"8^ 4jVh" ^ 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@h"P ߉tD$PAiDaryDpriml$t?tD$PiD andfD D$PhDgrowfDnt$VhD defDectsDuVhjh"PT V535 35353h"Et2tR}jh"V H}j1h{"Vψ #}jIh2"V誈 t6Wh]"Shk$UփOut$K h"^_[]1h`"jkUSWV}\$j S53O D$t"NuD$Hj@PjSPh"jmk$j$Vjj53rF=tPh"D$D$ D$$fD$t$j VE 0[ 9 1L$81qAQQ a A j QV53-D$t$ *jh"E pZ  D$ @L$jhtjPjQ53h"&h\'3)D$t$H1D$`D$L'Ƅ$0VhQ`53蹔 $j D$tPS? |$'y9D$(ȋL$;`x&|"@D$Ph"|h\'3j e'D$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53h6" 53hQ"h'3a P53hd"h'3Fh"h)"jiE 0h"`USWV $ ~($ 1j4h"X ?C9u1CCJt$LUPV+ CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P535 35353h" vL$D$$jh'hVjS53Ffȁw$VhU VhU ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWh"Wh}#vL$D$jh'h$PjS53$f1Ɂwh"Gt$ t$ 1؃;D$ D$4ƜF>|$Ń x&hO&h{5% ~y)L$ L$9u8ȉDG9uډjh0ut$VjP53 V^_[]ËD$,4h"jdhj"|$ u(1AAPh'PPjQ53q $g|$ u(1AAPh'PPjQ53: $0|$ujhQ 53褎 u h"j dP|$~,D$ 0hQhQ53` uXh"jc|$ u,1AAAPh'PPjQ53 $~|$ u*1AAAPh'PPjQ53O $E|$ u,1AAAPh0uPPjQ53 $ |$ u*1AAAPh0uPPjQ53 $|$ u&1fAPh'PPjQ53 $V |$(jVjj53t Nʃ3uPh"C["l1#t["RPh" 3D$tl1#VPh" 3|$ ["yl1#QPh",^USWV t$4}ty|$8h"St:h{"St,hV"Sؕth]"Sƕt '1̓uh" $w蝕tR1ۉjVjj537 f ?F$ȈFfFF PVQ53Y 0^_[]Ã|$ u(1AA5Ph'PPjQ53$V(|$0D$40,iб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P53D^SV|$$jVjj53^3tB["["@tl1#QPh\"j 3yl1#VPh"M Ph5"=3|$ ["yl1#QPh"$^[`USWVt$,}ty|$0h"Sxt:h{"Sft,hV"STth]"SBt '1@̓uh" $wt1ۉjVjj53f ?F$?ȈFF PVQ53(^_[]USWVh ƋD$(1|$|$ |$ D$D$~{ŋD$,Sh"mtMSh"[t?ShC,%It1jD$PS5 L$9=r1D$G9uD$@@ jh0uhVj P53ȉ$=r%ht$53h*""$<$r],$1D L Tl| D  PW53hH"C9$uV^_[]ËD$,4h"j\h"D$Ph"xVD$P H PpRQh"E tVh"2^h!"^VD$P H PpRQh" tVh"^h!"^USWV$Gh4y&VX Vh8" r[hJ"{O yj hZ"cO,@tPho"HO, tPh"-GȅtPh"GȅtPPh" O W hVbVh"GtPh"$hVjWƅtVh"j 褿t)$1@9}$݀" Ȩt&B7&=(3uJ&Ph]"psD$P{=hi"S1T3P3D$L$X3 \3D*h#Pڇ|E3D3D3)h'3PW G?t C3rx9uC3 D3\$)<+.3T$JDHUBR}k<P3D$ T3L$D$1ɸE3T$ωD$ \$SANƋD$)D$tGD$ D$H 1ۋL$|$E3VQP8; 33E3ۉu\$ .3DQu+<:wSMeKC CCCCuhm";D$PdtD$\$S]M $&D$KL$  S J#GBD$ @hE3MH3P3 T3uh"hX3uPh}"?5`3ubPk|$t `31jPPc = 3u'1tu/h"pjicj jhI"W MPh"Xj辭KAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQv\3X3!уu+D$T$P3T3hp"jeO`Ph"h'3萷 j膬USWVP=T35P31,9|1C=T35P39}`s&H-&E9ƉMm|)t6jju uL$誁L$9ȃ}  $Qr 1F,MUۉu1;}E|u8 E EmubWV"VXWj؍Wj͍WjWj跍hhV' x`j"h"P>& hX31 jPV"& jh$V& E3WdIPWV% VP(^_SWV։ϡd3H d3uhhh3?h3h"h"hS軱hV"StZÉ A"tl1#hh35`3Ph"SMY|@hX3C PhH"S! y׍h"Ph"j艡<|.i< l1#t%#QPhe"SǴ t Sjj!h" Sjjh"aH3tSPjhE3ahl3u;hVȋjnZS1WZZWV蠋^_[WVP"=83u%,3<u"(3u"uI"hE35`3Wh"jgji h"L=03uh "6=$3u6hhh'"!% xjh1"P# V%3WhI"jQV茯3h/"j]Vu6jhQ" 83u,3ujj$"u""u"$=<3u D$@"D$=@3u "=D3u "=3u M"=43u z#=(3u [#H$ 3uH18h"WPVc$ [8Vh"j蠞 D8Vh"G3j=03u h"jjhl3h"fUSWVD$4$D$J">% sBD$t$34$>D$4$D$T">% sBD$t$34$Q>D$4$D$9"8>%sBD$t$34$ >D$4$D$X"=%fyBD$t$34$=D$4$D$b"=%sBD$t$34$z=D$4$D$s%a=%}tQL$ D$h$D$yG#D$ 轣|$t$34$=|$D$hD$}4$<D$0D$D$3$"ФGHtD$$"蹤G(D$$"覤$ 躣|$,u=32t|3uteXu<$L$$T$ 3u t GX@r9=,3uD$L3$" GXHw $_#$.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$d3$L3ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$4D$(u;3 <3Y=(3LD$L3$"3D$(M I"$T&|$D$ D$D$$$p&_83ZG4D$hL$$T$ JL$0$~iLưD$81D$D$D$hD$ t$D$0D$D$$$3"4$yD$8~8 D$h$i1uG0D$$Y"D$,-1D$D$D$(D$ t$ht$D$ D$D$$$314$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$2D$(D$4$D$L3D$(1ɉL$L$D$ t$ht$D$ D$D$$$a2{4$D$D$$g`1D$D$D$(D$ t$D$ D$D$$$2D$($D$L3S1D$D$D$(D$ t$ht$D$ D$D$$$14$D$D$L3c[iF D$|$D$ D$D$$D$ D$D$D$d3$L3Vy|8 D$($ft31D$D$\$ t$D$ D$D$$$0&A1Ah2$D$L3D$"ӡD$ @D$0t$h1AtD$h9k4$v^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$eT$<1Ht |$t$ $TT$a΀-% plj\$ Cut$BT$ҋ $)|$4't1ɉQD$PS D$ D$ 938*s8\$ L$ D$D$W|$hH"SeDhhE&Sxe;hs&Sbe7h8#SLe3hk"S6e'hp"S eD$t$ |$@s1ɉQD$PS D$D$ 9؋t$8r8|$r1ɉQD$PS L$ 99։D$~rL$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShL34t2hn#v 1<==$3 ڍt$81 D$ \$phjShL3PVT$R$1BD$L4JD4`L$p$QRSRPV%03 ,3u1$P$w &QhL3h#9 @31<=4 j=VB9=$3 j=VBT$81 D$ t$ hjVhL3PRW\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$$hL3hU#D$49t 8Vh#S1JD$ $$QhB#,=03D$t$=3$D$D$,D$\$(V(GC@D$p9Vh#o0$Pt$h#|$oQh^#=03D$WSt$hJ"VD$ 81ҸD$ |$\$ Cj"$PXÍD$pWVPSt$ $P"\$ E $L3jt$tS7 $L3jWV# -n0PhL3h8# B03 ,3$PhL3hB&D$ $u1@t$2|$ Qh"(11G|$1\$ tpupth{#Q&D$ t$D$t1@L$ ɉ%t0"PQ^Q|$t l8t1j t$ g4$`St$h"FQt$h"7.l2m2L$ L$ ف$K{8P|$W]D$ t@j QS' D$ ;$|$8tQtUL$4 T$hjRhL3QWt$N l2T$ gL$4D$ L31ɍAD$4tT8`T$ Q$QRQPW\ c03 ,3T$J$w&Pt$h#t$L$ $d$ r $3 $tu¸8#tp"PQh!#|$D$u |$u |$TF1@]%t0"Pt$h"$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qhw#8j0E|Pt$h#|$L$lj% L$St$h"{D$$&i1ɉQD$PS  L$ 9t 9St$h?",D$ D$ D$D$0L$0RPQt$,t$$PtBD$tUtsD$ |$L3jVPM D$h|$t i811FD$&|$L3VVP  D$'$D$8|$L3jVP D$pL3jVP UD$1=03D$44$Vt$h" Ph7"= 3he^_[]4$h"ًt$D$t$$t$SM!@9s Vt$h~" S%!@D$t$|g1ɉQD$PSX T$tD$pD$ 9t8ug8 St$h"Qh"sg1ɉQD$PS賙 ƋD$ 9t8t}St$h`"St$hw"D$t$։D$gL$8`OGL$0d$ rxL$D$nT$fL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h" j言j-wPhL3h" h"h#h#hL3h"SWVPD$t$|$L$ $QP67>9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS1Ht$L$ltT$d;WuT$h;W(u QO ŃtD$ppPU> D$DGXHr PZ_oXd^_[]USWV$l238L3t 3/3ShL3S6tWL3މ)ˉESQ|$ W> DW3V< VCfǀ3/SU6uL3Uh3 ,^_[]USWVhT$D$"&1Ch3D$ CL$;rjt$VTx ufD$jD$Pjh3V2t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVP;Wt$hi"|$$j@WVP;Wt$hy"jg WVPt$=h2UaPh"W艈 3t5D3Ph"5h2fD$$PV5h2迌 H3^_V΅tOdbHw;s13 <3te>b0KtPhL3h"M Atʡ3 <3t"b0tPhL3hB& u = 3t^j|USWV=03ˋ},3 43 t u tth\'3jVu4}ti=83|}t j ݃MO؃thD$VuP; t$UtuRh"X{5p2Rh{5%? bD$VuP: tMD$PVh("  D$VuP: t+t$ t$ Vh/"ڃ]D$ s*P? D$L$ r!QPh5$ rD$rIPhn1#QPhY$xt$h? ${}u h8"hj e^_[]Ph&USWVP=03u(ˋl$ D$$|$5,3 43 t u^_[]Åtth\'3jt$W2܅83| t j $^_[]uCuWt$h "褂 K4$~DN1ۅtPh"肂t#=83uPhO"c9t83C뿃u,h8"E't+ORh"+rt51t ttt ttth"'q 9uЋkT ;$tl  1L$D$Sjh"p {t+1:LtPh"p G,;{r܃TD$@TL$9uj oVG1A ^_[]hL3h"+USWV }= 3t D$ toh"W>tcL1ɉt$QVWF T$$9t8uL8,Wuh" = 3j.g11CL$ t$PSQVuutWt =031=43u?=83u6L$1J1ыT$1 u#MUPj h"1ɅRaMUPjV tK=43u-=83u$1H3$3|$ uMUjj h"MUjjP e^_[]ÉSWVt.3q~FDx@uAFX@ut9v.30Dr@tH^_[USWVPω11s6tUVh"SUht#SϤ t9VE4$Euuhl1#Ɖ$t^_[]h"h"j-h"h"USWV\։ύD$ jPj PF 1u0D$F|fD$Y|Uh="j D$ Pl$L$D$ L$/Ph"j D$ Pk[ $fL .3/LA .sD$ L<u\$ SjPj SE E9[|$ t D$ PգVhB"ld^_[]WVth΋u\~8tU~4~`N4F8 I9rPC1F0F4F8FXHr PCFX^_fUSWV\$33hp#sP\su 3JGh0"P:u 3j*3Jmx &蹶'?c.53芓h0"P9:u d4=d4{#t,#l$PKrt Pu|Qߋ<-t<+u{uNh%S9tGSM16kh#q 3t8u)h#q 3Pqt  3β#h#}q3Pqt 3#1=3tjh#~FP7֛j觛N=3u0j_`ujjB=83t!=4u=3ujh# C1FVV7=4uh#502F8u\~jh#B jM54f:0BuK@33!Ѓt44 3Bzu=4t0譚|4jS=4u T$3=4~jh #u j j 6GWVt$ y5(35(3,3ut[<|=44t=@3t|2'V1Wu=WSBV_WV|$ W@jP8tWP^^_t$t$8tjh%#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9D3<H3U584&=x3u L3x3UF=v====,=XAf2 L3i|333F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fj<D$|3D$L$d$ 3 3D$D$fD$ D$584Pj5846 D3,^_[]VPhht@j) t1hA#ktP螴$t$uչE%~3h<#rkt(P`# 3 32 3 3u.hL#!kt P#Tƅ~53hG#jtP۳# 3 3 3 3P^V[tP蘳=3t1H V"z^PL$$31Qw$Є&T#M(uMf3 xW#4Z#+]#"`#c#f#i#=YÉl#/uf3o#uf33WV׉vu1=3u WVgz^_SWVPhr#iPi1Ʌ 2hU%ui&t3Qh3 wt3#t3Vy q"3#3#3%3N"3#|351"y33333333~ T43,%3tj<e#l1#l1#t 3##gtlj=3#O<3#>#t 3#!#t 3=4t8=3u/#3 & 3=3u  313l1#u  3l1#cW$3t8u833l1#⹚ &q3=3tt8u833l1#+2#:3t8u833$# 3t 8t1@ 3l1#1 3l1##y$VWWh(3h$3q,"R6&V5(35$3h03h,3H# %V5(35$3h83h43% %V5(35$3h@3h<3p#;tlj=D3#mH3%2#l1#l1#tơ38t,<$1QQPw PW.U<$W@$h#L3Vc%=2l1#ul1#ul1#38t2<$ 3IQjP|w PWT<$W&@$ "S>P3繿# tÉT3#l1#tƹOC"=3ul1#t‰hl1#Ɖ5X3>u  3^_[É^$H3z8{lV t<0 1=3u Vr^USWV׋t$$\$l$;Et*+u( %l1#t D$ L$M^_[]USWVր9tMτtC1h3H2U53Wp h31h3U53Vp ;h3|ut$83^_[]Ë 33USWVL $։ύl$ D$?h#WZ)?SWU D h VU$p $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$E xt$4h VWo L^_[]Ë 33V=4t =$3=4uF 3338t! 38t=3u P31B@3=4u 33b=4t 33H\3=t4t!=3|1Fj 2F;53|^Ë T31B^ P31B T31B=\3ug=4t =$3uN=4t 33=4u 33=4u 33\3Ã=3"\3Ë L31BY X33Ht$j53r 1B)=l4tË D39t3 =h4jË 33 31BV=4T3tP31B5`3t-F=33t31BV^Ã=33t31B^_$`3t (31B>`3t @31B'`3t 831B`3t 031B`3WVD$ #=$2 lj Ƌ ,3j" 43j <3j=4ttV$ $3j5`3^_WV|$ 1Ʌ<+u OL$ GWj-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$D&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th$V8$trL$PQV t4uRL$x# $x2P #T$x #$x #w^1J#^aD$# $2  `39uVD$ T$5$2! щ щ! ‰ 19^Ã=2th#Ë H31BSWV@΃=2ttd3tVs"tx1Cj S*VGVSP_GVhC%PD d3=d3!Vh#j@WRWZ@^_[ËD$h3WV9ĉ2t#֍|$RQjW@R1B$5ĉ2^_Ãwt&ÉfUSWVPt$ P!уtRPtt jh#jh%#l$$\$|$Q t^tY9uE}I4u )<Ճt(ˉ $19u tC ;$u~2KՃujhm#t jh<#jhS#D ^_[]1ۅs IQRP踒fVt$t=ȉ2tjh#5ȉ2^á2xy=l3uE p30@#4@u.l3jh#?t (4t2P253F)3V1N=p3t9t/ p3,@wB$@(@1҉,@Ɖ^USWV=2p3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh#1@$qQ52Y 9D$}p3럃^_[]USWV-p31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5(4(p3@9@S p31JЅt8=t3u/@u1u0@4@ &[WVp31t[@t @4v p34@0@{!уt RPF1G)t (4t^_USWVp3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHp39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë p3t$@(@ ,@1HUSWV5p31H(@$@9t#H1ًP1 u,@;Hs D4%D$z9tG1؋O1 D$ ~9 $tG#G=4t @t̉2x9 @}lh jtH @1HGG7FGF8~FNOG Fx ~,@;GsN+4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@!ƒ5p3@@ȉ2tODȉ2Q@u;G  )RQ@w u&p30@4@ &OD1@l$1tʼn$yjh#1=3u 2x~OUQP蹽 5p3@@o<$t0@D$4@=t3tU=4u#L$ Qhk$ 4j2=t3t=4u q=(45p39>tOOHOp35p3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh# 831H^_[]USWVp3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H̉2áp3@u1I4@0@Ë9t1JQQ 9u@o p34@0@1@@(@$@,@PPP@ !ƒtjh#81PPjt$} !1WVp30@4@!΃t@@9} 0@4@^_SV\$t$ 53({p3h8@jp3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV !ƒtp3 p3@P53vzp3@u@^[SV5p3@  ˀuH9tPQP Pvdž @vv Hu5p3@uE u@裻5p3dž@tV1p3P53y^[áp3t@1fWV|$t$ t=x3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hl1#j3h #lLh3h3h3h3\$ -uF :tjh #]jNbt'.t53bt0:wtptcu+3F&jSh3 3jSQ ,uF33333333333333 33h #J1tPh #J1F$2Vh #Wh|3P(h #dJVh #Wh3P ^_[h #>JPJj311B th #Jƅu&h #Iƅuh #Iƅt]h #VAu6h#VAu$h#VAuh#VmAt1B#w1 .3TA ruƀ3ƀ3ƀ3@=u=x3D$3SVt$ 3M1ۅuD3;1Cu1񺐗2(u!=|4u2 1ۅÉ^[D$3ËL$=r!=x3tP5|3j h3=@'3u 33u3ESC3Ãw@3uQh #VPt$ u 3ESCuw 3u;Vt V53B$3xPV@,@3uPh #V5|3j h3g?3^WVD$L$ =x3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=x3t'~3P19wKS>~-19s2C,9r9v)CK$SUuF8AUN VE o ɋl$u9tSv Ft1|$jjSOF ~.EFE0uE^_[]V,3t";T2t1FVh3P/ ,3p^USWV\$,=x3tV$3tgفuH<3J <34319*Qh43~-$35431E4$3J<3431E$3= 3u  3 ,31҅; <2t҉օt1PS;H*$ȅ&=@3+"H3Шu*%=tS $31$3]^_[]Ét$@35,3 2y33)É 2n1|$ l9} SWh3訽 uԉnl1#t33VW)=3=35* 38u!e0@3D3tPV D3%MD$P-3E˨ -3E@3 @3? ǃ43^_[]@3] v@3e@33=3v!x ux ;|3=3w%@33< t 38 t@3@3 @33B53a@338r @33=3wx u 3=3\x tQ 3=3.uD$ L$PjQ课 $T$e^_]Ë <31; $3|3á,3t @@@ 11y[1PPUSWV=3׉΋$$L$ D$1AyōD$PUӈ#D$=xh{"U.UW$ShU> 0jh #U- ShU> D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU= S?1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=82u=h2u =4P1TAP@PjVPk W|8QZtQL8hV"W,É4$pu1ND$PV x#D$ =uhVYh| #a0tPOyƅdո(2Ex uָX2Fx uh #h~#S+ T$Z]VUh #S:S4$VW?WgV^Ā^_[]SWVh #/P/tt;^_[&h#V51ۅt+h-#%V!tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u% #+ #Qh~#P* tWh #vj* Y=82t"h #h~#vJ* V(2=h2t%h #h~#v* VX2^_[^_[USWVPӋl$D$ $uSPPSS1tD$ t}t8^_[]StV믉h3jPN SPuSqWV38L$ Ƌ3 39}I9u3xtWD$3$3V38t,t$<$PD$38uڃ^_SWV 33$ 3+ (3|51ۉ|$8tZO\$3+(3$9|Ӏ8t-t$|$D$|$D$$8u$3)ȣ353^V^_[V533tR3)Ɗ 0@u 253A=33"03=3 1@^À=3t833 253031@á38t AUSWVPQ诺$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh #O+h #@+Vh #P@ Åt^_[]jh #Wz@ t Vh #Pe@ U uh #*Vh #P:@ ÅuVh #W%@ WV9G t'փtPh #V6& G?G uG^_Ð`3i ËD$u5Ã<2Ph #USWVD-<3ÅE\$9uz$1ۀ|tisljDDs9u>rjjx d3d3$t,tV#hj:} =(4TeuYÃ=(4e4΃e`3~o6/=x3u #=3 t t =^=x3;3Ct}.CЃ jS&ed~h3 t3p3=`3t `35=`3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=`3i`3ihd?%jjS\Fc`$d&=3 %tđ#-l25`3=ES[jUY  xS`3H݃t =4-h3>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5`3 h #9|39H393=x3Sx3C1Ƀ 33ῃ5x35x3`3/U]VsWWr!2@*=3%i3`3784`3hձ#jj33n=3 5T2`3 }h #`3 _ghZ%y1PPv841; p3h3 t3Ht3p3/=3 `3%h #1PP9|39H393؉ك u. u.S莍i35l2`3%aih%{jVy33 PZw h3 *3уBЃ@*? !1҃ ƒ!D$Z=x3,9|3t 9H3h 93W jhg #j#t$(V8OVrlp1BsRtM&=3=`373h3Щuh3Mj5<2ùe=(4Iv_*-t%+q1҃¹) 33S\B D$t1< 3D$ D$ PD$PD$ P萪 x3tjD$D$-<{|Q<`ʃ=3tR D$HL$@븃@3|$ ^s 8eB`3emh #1PPL!ùe9|3e9H3e93e e 1?PS1FP@/3Phl1#535x3虤 1;5p3t3|t3p3n蔰VVA 1;p3t3  t3p3|43'M1PP543 =4 3 t|7ػT 1;p3t3|t3p3蛻=4p3u' t3|5353Pp31QQm1;p3t3 t3p3|43|C=4u5353P1PP543A t3p31҉3P541;p3 t3|t3p34聺觮5t35p3DT54J`3NVh #h1PP5 ùe9|3e9H3e93e e /йSE*re|褹ʭ3313 |4 3|4 H4 3H4h#Cjjhs #t3݋5p31ɸd9 jh #=3t>t5333|43H4j)eD$t Pj{@eJr蘬 L$Qhk$1;p3t3|t3p3)O=4p3u' t3|5353zMp3jjP1;p3t3|t3p3跷ݫjj蟷ūD$<2D$Ph #=3jh #VR t3p34 t3p34p31ɉ t3|t3p31@Pe(ejh #e1;p3t3|Yp3t3 諶Ѫ=4u5353Ljj- t3p3ʃEݣ4c t3p343  31; p3h3 t3|t3p3q j5<2?p3153"531;p3 h3t3|t3p3 j5<2RCip31D53=4t5353J1=W t3ip3me53V?P/V$p31ɉ t3|t3p31@PuGjh #p31ɉ t3|t3p31@Pk 2V_e!ֹe54RPyJ1A诳է t3p31҉AQPcM3Nn3`3>X`h #r1PP?ùe9|3e9H3e93e e S賁+̲1PP54n豲צ1PP54jP#'p3t3ؽy蟦=4t5353Gjj5p3d:0ؔp3t3艽*Pjj5p39; eS贔D$D$PhQ #{豱ӡp31ɉ t3|t3p31@P"etbt3tFu j11A; p3t3 #|l1#L$Qh #11%p31ɉ t3|t3p31@P'"e11A; p3t3 #|l1#L$Qh #je53<h#P531=tjhH #o5l2`3nvh%1SVUh蠻Ag53rSPx]4 3݉p3 t339‰}p35t3)‰383e4 3p3 t3383i1t3p3154QPHFjh #H3D$Ph9 #d ։u=3tp3 t33e,535p3tI~V8Jjh- #bUSWVP趮ܢGVD$1Ƀɉlj щ 33t3=(4uH9ljD$u21xUUjn6 9-(4u;=33D$tt3 (42t8teue^_[]USWVPӉơh3uh31 r4$0utV4$#h3h31ESWPO áh3 h3 3tu1Fx` sKu j]j%u0SW5h3 áh3 h3 3ujh #t 4$4$^_[]WV=2u=4t =$3u袬׮t 33!ʃt]5 3QY83u =2uP5t4=t3t4t3u _BLE5t4=t31jPPB ^_SWV3߾"&t#`3/ V+=3u V@t h #t u%Z%P143PP^_[V蛫ơ`3"~S.#V$^%=33VPujh #  tY>!t 3t P V!3=3M3.h{ #qF<+t< t 3t Q[ V菛3/7E=3V蜭h #Pt% =3V^Xp3^(N5p3jF5p3jQP軯^53V535x3x373h3h3PV3h{ #hl1#r^SV h3t s7`3Zbh3sh #ih3 sh #Qh3 sh #9h3th ##h3 sh # h3fyh #h31Ct$‰sSh #jVVh3CuϹ"tW% s #Q43^[fD$=x3t@WV|$ Wjeƅ~WhV@ ^_USWVt$0l$(|$$t U,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD x3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f 3 3 3 3USWVi $AD$)< u?FP貛^tP,9~ #ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2h #htjPV jh #h #hatjh. #h #hNjhE #h; #hatjhV #hN #hN^Vt$ t:j j tL$HΉp 33jh\ #荞^Vt$ t:j jy tL$HΉp 33jh| #H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]h # t8tMjQP[ ƅuh #t98t4jh #P/ ǍEjPW WI iUUUSWVP1F=3jt$pP#19jV n1PPPSW!ƒJVWSp <$Sq11 ?$:81xM'x+xG1O|E(|n|dȃ|$3t3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTWj So1N^_[]4$I |t|uVP11xtɉSWVh3t$b<ƅui\$h3e53PSh3I53P|3t3h353p^_[ËT$ 3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=4ÃB1ۃ=4ÃCɍH9 3~Pj#|k83SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=4ÃB61ۃ=4ÃC%|$mu93~HPj#j83؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPD$X9vpG$11Ʌu2~>9sWt$V t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWHV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ?t1=D4ƃtEuG%t|Qh"#hh`%AVhk$6 Eu ?=u Qhj#$ u 覣!ƒtVHQhH#^Ã=D4t$3tPP&t53ËD$t53PF$1PUSWVu1953O3t_jP%=3tJtWg%W"=3u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =4uID$xAP躰t4D$8\$Ph<#FًT$WVt$j 1@t=3jWd$53t$V$t$53g$53$h353#03t$ t$ ۨX4=@4111(4D$4PD$,$jUuWPW Usڃ,$C^_[]SVt$ h#V1Ct'h#Vth #Vګ1ۅÉ^[WV$ VtVWVtWt^_USWV 1=4]=3Pj\hj #1Ƌ|$ 11@L|uM@-u)Fh#W)1%tuQ%t s@AAۃ\$WVrWr؃D$jPtWVt$PWk "SY 1tXt^~u1O\$$D$jPW{O uQD$P4D$(0#^jh#4|1 ^_[]ÉOVn';t;V\'1|$rɅuŋD$( #1O;PrS薲 USWV=3t^_[]j荈h2#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh<#U{PljD$UVhpW]pS\$Np,8jUHrS\$SVUP4$讱 S襱 \W蓱 V& V|V$6#N@ |^WV|$=4taPWE61=4#D$=Wao*jP`qWPhP2LPW5x#D$=@{WojPqWPyh@2VZ WoƉ|^_V|$PV/x D$XT$\1jPPV|^UWV蒊lj53# QP5t1GL$ T$3 33 31@ u,L$3 3$33 u!tL$\9|$X}e^_]øo#Vt$Vn9vHx/uAΉ^fVn ,31ы5(31 u^ã(3,3=h4t^6~^P~SWV1ۃ=t3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=03t03USWV-$4~ON}=$4~Q111SWuljӉ:}qF;5$4|؃=(4' =(41=(4|=3111;5$4| V|ljՉ!<$=(4FD$1;$4á3D$ 3D$3D$$3133PPSUt$ ljՋD$ 3D$3D$39pt$j pF1M3H91Z{1@^_[]Vh 2F;5$4uj{ t j2^USWV\$,=03t03&|$$t$ l$3t  $9~ 4$x 9} H9$!tT=T4t 4tCX31҃=t3TRQPWV脘WV Ɖ1ND$(D$<$=t4t73H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=t4tzmz1@D$/1@D$=|2uu=2t h#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 3t)!u =t4u=4u03= 4t Xm439l$"3HPj-|1Ot1E1=$4~1VV|{~ VVVD5 -t3t <$tw y|2j@ ^_[]USWV=03t0341= 3u!4y=t4t 3'|$t$;D$||$$t D$93~ =$4É!tF=T4t 4t0X3,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1= 3tá4y=t4t 3ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åt3HPjytm=t3tPay1u11FUvUVRPVjv!уu (4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 3~&111RP!уtF 39| 1 319^fVt$tsVGF953u#1=2tu1Ɂ2tщ 3AF=2tH <3v 腦 vz ^q ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá<3USWV\$S@Nj522tv W6W軥 |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@<3VEEScËnUc9Ë\$sU SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P# w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=3jjPWV^_USWV,T$Dl$@ظBӃ=T4t  4t0X3 @1)ʉ|ЉjSUQP虊كQP4v=4tK uu|| t u+| t u(4tt(4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t(4ǃ݃ tkwRPW v=4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N 3 CfN =3=4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$14l$t$1E1!1M,^_[]Ã=4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjh#c^_[uƉס3HPLi11 u^_[8iWV!Ӌ 3It*QRP4 3HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhY#bKy1V[hVjRPUo=4jusj'hD$ jhD$T$l$ !Ѓtd9}\3H94$SW!уRPvlj9Љ $A3H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$31VVjt$t$PY954^_[]1K16-03-833H $)QUjSWP(1K[6=t4tf"g1583SW=g3HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9L3#>$4,$tt=t|<9L3|wC^w \$D$Sh#jW$4,$r#f9L3u+9L3}9L3t9L3hu_G t t1"~#ut|\tt t tL@?3~|$j=WHi9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu#l1#6$4t$ t t_G#l1#$40tUPGtu)#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVvD3^_[]SWV׉Ή5H35@3h#hSH=w )WVRQ+D3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^P3P3Q3JtGtO GO P3Q3l2 tP3uP3^_[]ÍZ w6$&tEGЃTZ$&btPeu>fP3랄tGOm>?"놃> "w>O&h>%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]P3Q3d   >P3 P3 Q3R3V3Rh#jhP3#P3_t>l1#vVh>#\3P+t \30R"hO#蹻`3Pt `3`#jVLd3jVLh35X3h3h313PҎ $u 3^1|$á(3,3Sl313p3 d3h3 p3p3@p3;l3|1ۉ034383<3@3D3H3L3P3T3X3\3`31H,3(3h3#h33P $u 3[USWV\$0l$,1=4uSUƉס4  4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| `3=4tU t`33Z3t334 39}Q3Ɓt3 3ك=4WV^! tt$j VRP)NV"H1 4)~$3r53Ƃt3 3Iu܅~+1ɊT 53~=3t33A9uס3H 3ƀt3 3303^_[]Ë 4t 4=4t1 4@V5l3p39}9 h3<u"d30Ph3 h3p3F9|Ӌ5l35p3303^SWVt$\$u$D$0j?oPF/=x3t&v!Ss1҅ SVqt1҃Pn1҅t$Stp3~- h3Vt[uh3 p3LV3Zt p3t> h3VtV[t'i=x3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3áp3d303h3ád3p3h303ËL$1wQ5\3]1SVt$ 1ۃw)V5\3]uV5`3]1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJy#9u!B1@uDA;1A+u%uVt1@^ÃwV5\3\u߸ع#L$1uj jE1ɉHHS SWV=P3 u|$t$\$t-1 |15t35p3tm1@Z ugP4t |4uU=H3~+|3 x3\@3H3P35p3=t31P3=x3 H3%=ua3P3319Rh3bmh3m35|35x3|3 x3H 3H3u"33x,1WV=x3t 31At^_[ÉШu-%=tS0lH3=|35x3뢋|3 x33H3USWVӋl$,|$(@3=43uBu>%j jzC1҉PP3X3@3@3twQPl'UWS 3xt\3Ph3蔅13@3u+H4t|4A\$l$͉=x31؋5p3d3@3Rk5p3UWS% 653证 33PV軄 3@3VP诅V荄 3AVUUUЍ@@ 3<3 39}oh3藅ơ<3 3Y$gQVlu&d3p3PjVPmD3$#5d339|p3l$ EVjUek L$ )v %uh3蚃53n 3 p3; l3 5d3|tq=h30jf jh39u"_l$\$u4Шx$_l$\$u$5d3 _ ‰$ u*L4t =|4uKuG ڃ^_[]x3m_uiud1UWj03+3 t2X391J$;\3} qɉы4`3)t _d3\$ PjSi 1EL$d3) p3PjS`i ǡh3 p3tW4V)03~ZD3t\ [5x2)Й)֋$F UWhd?% N1@3E1-@3$_PdtUW ]x3t6=4t-QdtQd UWl $UWS t1@1^_[]SWV=3~4։13Pd VW u C;3|13)^_[Ã=H3~|3 x3H31WV=H3~|3 x3mH3|$t$ =P3uu 15t35p3itb=4tY<33903|830343p3A3 <3H903}4 j 44jf= 403tL`3tBx <3 39}; j,03P <3 39}`3ы <3 39|L=3tC3„u0=4t't4|$t- 1j1j 1j5p395X3 ud30h3^_V=4uajm5\3VRtMȺj9#Fu=\3u"Ⱥj#Fu^SWV։ˋ=p3Gp39=X3 ud38h34D$ 03; 83~~ 83p343 03^_[SWVl3 p39}1T$5h3ׁtu Ӊ p3@9|^_[ËD$L$ t33VD$ L$=L3u=4ttNI1҉ tK1G39~3t3+5l3)΋ h3 d30 ~^L3<3USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8(4u/X3H9| Qu@d38GO1H^_[]cS d39t d3Mtۉ>?SUSWV-X3\-jSq jSq DžtVtRU5d3VW h3UPWW Ubx 5d3Tx 5d3=h3X31t W1x 1Gt V!x ^_[]USWVL$D$ʃQPO1H…t$=X3d3D8OlV tn(4uc~d3>-X3u@d3 (I=X39rHŠIJd39s=X3)\8OVà uQL$ t d3t=X391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vv 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$1531K3|EtESSP t行3@ԋ=p39=X3 uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q2@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=4u1@$503+5<3~1; 3^USWV։L$|$0\$,ЃtD3!t6tC؃T$RjQPWSQ= 4=X31ۀ=T3tw4$T3 3ىȺVUUUЍ@)I3~4,I31E 8Vt$0j* G;}|Cu4$SG `3tf 33!Ƴttt$,9} 53=3T31ۃtQd3 p3T$ 1ۅ~&L$ PjQ\ p3~h3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E<3;3uX(3#,3uD$,(3=,3=3~013 8jG;=3|h3t03;83~<$~83 p3 43$03~1 ;j_G9u<31;3uD$Ph3tp3 l39~~51ɋd34*1 h3444A; l3|١p3) $ <3p3 <3; 3~(4 j<3H<3;3؉^_[]WV|$t$ =4u1WVP PV WVt1@1^_Ð3H ȁd4r1d443444 4 4444444USWVL$0D$,l$$4$44t-9Br }$r1z3|$( H4u$$r4t :=444<$:rBJ jl$(jW4tC:4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?4t_ )ϋ,$]}4t4tV+BJ NF=4uW-4MEu$9ˉ|-4],$ϋ=4t sKӋ$JHJ^_[]USWV1=4tD|$(T$$!t3|044=4t'9PH }=4u11CŋE1ЋM 1 u ]u,444EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}(4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[(4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt4 11؉^_[]Ã=4xÃ=4u 8314Ph#4V4xNH 4d|@4* 4549|jh#z54^USWV|$ l$1Ƀ44tKC9⻬441 41 54v vB1IʅI~nVv 4$9ʼn1I1PPt$R9(4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R(4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=3~%GW8É!Ѓu O;=3|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh$#231111ۉu WVSU1PPWV+(4u Ɖ!Ѓu3^_[]WVT$D$ =,4t 5$41)|щƉ^_fUSWV t$ >-uF(s7h%+V+h?"+艣D$1S6]+S)S\^S[S0jy W>ho#À8t>tkV聪tmSʼnD$%$U% $ȃ$jP'袷t$PSh|%t$U`t$%g  Sa'Ņu>tVh#1"F'U3Uf jPWgW>1FVJ]V'D$$t*P*h#y*/j ))383t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh#.1N\$hV"S4h%Q)SH)h?";)3(1S|&S[jj g1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS@jh#1KtL tGf;t=ËFHN~ ;F~à tQu VSV1Vj f1GWZWg%e1=83VZ^_[]fSWV141K4t 5u'#ar'G__ _Gt Pc GF6u^_[ËL$ 1ɅV-$t: 4'W.t7^uM3 414 443 4 41 4 4 4 4t P`  4Fu,~1S薺PW豺Fv` ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh#x)1HËA QUSWVD$T$1ɾ4=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9 4u 4 4uUSWV\$SκƋ 4t@PPVVu 4 4l_ Dž 4WY_ u^_[]USWV=4|$,t$0h~#W$ l$4 4!ʃtWj UQP" 4u 4 h#VUt 4VU4Ph#W诉u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=39Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P]  $FQF^_[]V=3tjhE#&dt$D$tt/uKV3;m?u7=2xCjh{#뵃=2x%3Qh#l&^jhg#jh#{Vơ3t P\ VޣP3V\ 53蛙 ^33VD$$L$ t tC8.@L$$Vh&Q 2>jh#2xxPh#j VsV||P|0tB D$0Ph#;D$$Vh&P >t.jh#14L$Qh#$^ã42V2x$ 31Vh@BVPRQ_4^VD$$L$ t tC8.@L$$Vhđ#Q 2>jh)#2xxPh#j V:Vq||P|0tB D$0Phs#;D$$Vhđ#P >t.jhA#14L$QhW##^ã42V2x$ 31Vh@BVPRQ&4^V|$u%t$jVt0Ph#N#^V|$u%t$jV؇t0Ph##^SWVD$L$tP4p=3tjh#"VP>PR Zt V踘)X!ЃtV谕54SW? ^_[VD$L$tt\uoPe02_Pơ02t=(2t PX VӟP02VX 02Qh#!^V|$uJt$ =d4tV3- 4hW%_V_h@^^WVD$t t0t$4l7=tDMtGhuXF 2Px44Qhk$5!Emtwt su!FF2F4F4F$27W V^_D$u546Ã|$"7VD$Hs^\jh#7<2V)ht$&Ph #h"#V};2xu'hK#h#h#h#h#hO#h#j^^WVD$t$ʃc"y$l&m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=4utjh#$FVPMy0Ph#^_ÉPh#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;X3~\3A9s } uE9u9t},u E&| t2X3+T3x2 ^_[]WVD$Pt t*$TVPVLD$ps D$ stopD$Tab =t2|i1Gt$rVUfD,VE4\3hn1#P G;=t2|VD andD theDen t$V5x2h'#P; 0Phk$D^_à D$t t+uyL$tJQtQytWjh7#Mà$2L$%2AAD$Ph[#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh$QVP46h#VIt5>t 4 $484tP94#L$Qhe#O ^ËD$Hsjh}#/Åu 3Ã|$u=4D$u =4~GT4ÃD$ u)= 4| Ph# 4ÃD$ u)=4| Ph#4D$u"=4t=3t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh#V D$,L$(t tC1ɉ $4 (48,uT@L$,t$Vh;Q$Ql >tejh#Ot$5(45$4h}$jVhw0Ph6##t$D$,Vh;Q$P >tjh#9 ^ã(4$4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$&d~&s wR$&s wU$&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G841 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qhn#1QZS84^[ÍD$PhS#҃=4=(4=$4Ë 41 3+$4t$4Ph#h4 4USWVl$,H 44t&AUjQD$}ol$,7F]$@&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph#h4 4FVEŅ8D$EH$&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=d4nAL$,9 ItIT$uWoD$,7 4j+o2Ph#4Vb T$jV%D$,|$?+3t PWK GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WJ |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh84P 44I44^_[]É|$|$ u D$Ph# D$Ph#͉-44ōD$8Ph#uA0h#j*h84IqËI1Ph#j*h84.qUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph#=j UQ xt-u)%tt0Ph#1H^_[]SWV9toӉQ@jP ljtG\$=4t <\u ~t F <$t)\tPS; t GFFuD$Qh#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$84Ph"##wƒtuu 9u ty j"F1H$&F1Ƀ8D$,It{N91҃D$1ۃD$JD$ÉE(t6uD|$D$0WjPX ?u+$ྃujhY#F 1~ N1ҋFtʉ׺)t$0RЉ҉u~y &@u_FHs1׋Fyjh#Fjt uFL$QvuF t 83^_[]Ë~ NL$1҃1ɃDžt!jh#D$҉ ҋD$L$1tASËL$"t A tAÃ|$ou'g#u11=44à 4484Ph#USWVt$$|$7<< v tgy11w ۍCЃՃYA߀Ѐ r׃wۃӺ)Jut%D$ tQh#61H^_[]á4=d4tWVh$#-tP{tu d4=2t*21FtNFtWWV ~v$u^_SV21t+T$ 29tAt9t Y$$u^[USWVL$0=2 D$,(2D$D$ D$D$$D$x1P7U ~uƊD߀rb<-t^|$u;t$u1@D$ D$D$6;t$D$~,719ƋD$L$D$ $|$t$@t1@jVD$x$@$>|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hZ/#3rtP!~21@USWV\$(|$$1E=\4uh`4;?\4849<$l$D$l$ =4t=3t=4u2=4ubPjD$P D$tD 29PaHD$=t3t=<4tft$,SW \4=t3u"t1X4@X4| j=y!F8F8#1Hpt9=84t4[1\4D$ D$D$$PD$Pj 9=84t (4t, (4\4^_[]øjh`4蛙UVV)Ve^]USWV\$E0W SV,jUVSh"UPg^_[]Vt$VW uVhj/#h4 4^USWV D$0щL$l$ |$$t$4PWUƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRW6i)$l$D$ ׋ $D$ՋD$1PPU\$Sыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVP(4t 83Z14WP(t>1C4$$4u V WSCu ^_[S=4t4 \$2=4r 2H 24[V524t(42VP52p 9t 83^Vt$52^Ã=4t4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVs1يt/#O u݃|$0xG-Wt$8Z ^_[]USWV\$8T$0t$,11|$GUSRV1يt/#O u݃|$0xG-Wt$8Z ^_[]SWV|$(L$$\$ 1Ѝt$Ft/#NuxF-VQY^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P ƃ^_[]WV t$RVQ t|$P3GuVe^_9Hw @sÃtP=USWVPt$|$4V<$=4uԇTh=3 #Vt$ P]Eu 348JMp;53| 83^_[]VWj .^_[]ËL$T$l1#PPh/# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu4^_[]WVt$|$ zt!2Ph/#Ph/#l1#PPh/# ^_WV|$t$ t%WVra7ft=3 83 j Qu jF^_fUSWV\$l$=4u<؉%t1U1GWP?[PW1WPPUVd[1 jj1=31Ƀ= 4HPVWM Åt!W3 |$t8jh/#'D$ tP:D$ 03 D$ 89t V3 ^_[]Vt$tP96i3 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQp ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} 4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø &fL$tt"u$ 33HI 3I4ʋTUSWVD$T$ 354|1Gll\G9uTD^_[]SWVD$L$534|F|\\|N B^_[á3~Ph541 USWV 3; 44th!t 1G31K;)1G1I4:tl!GtˉP/  3jQJƣ434~PhV1 !t\l^_[]USWVPL$\$As 311H$(u31@$14<#|tZ44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$41H; t$z|#=3|O1;Ll |C9u^_[]USWV 3~.411F1l9޻r G9u1@^_[]USWVL$T$9~1@+54A1G1֋l9߻rB9u^_[]ËT$3!х1A9Hh&*4=d4&t&P 4hQ&4h&2h4& 2h&$2USWV \$444|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$&=4EQ-s4C$ىË $Fw$$&#Fw}$&X!уj WRPBBtDt L=4!153h#P#1sTu~-$PuYQA tLу|=RP螽1 $1=447f1=3u ÊCCs|,v, l,uȡ03!ƒtظ:,u53资j W53QTу 35$4n9|$ V5353蛅PtmƉVf* +1+5Q ic+Ɖ!уRPUV4=4H8 4H=4wA53kP豄 !уRPaٹ $4 3VQRPg 353,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/153Mj WP j W1P9?"@|4l1#9 4t 4l1# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I54Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^52~V5x41=d4tȉt 240A03^5$2'SWVQNj4ع49r Ѝ4WVS0 ;4;^_[VQ!уu$x 3H9}FV!уtt^^Ð14444WV|$ =03t54tZ= 3ta=3|<1W!уtRP虆Ws@G3H9|vu4覍54^_USWV 22D$L$!ȃ2D$2D$ 1H2222= 3=03t4$=3|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$3H9|u $u^_[]Ã^_[]鍌^_[]T4K|$th4m=4t1=44j jh/#"V΋At P# FVC^h4SWVt$>t_w # W# ߅u1F FF1H44 44^_[h4SWVQ1u(\$|$4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-4Vt;xH|p$x Hȅu^_SWV|$t$u;4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^4U1tHt$ !t Q9y}1I(t(t$=T4tT$$1=4uȅt^_[]h44=T4tUWVjW7!t"j]jRPWV je^_]Ã=4u 4 44d 4Vj5<2t24jVx 1F=T4u=4u@11N^USWV(U ]1Nt$ t$tr:tm14PSi( T41 4t)1V54h4 T44ttxq @34 T4t =4tj)T4u=4t494J\$tP1ػ&!Ѓ1ojh/#D$Pj@t$>SD$$PL$Qt$Tt$V>$4$u: 4 4!ƒt&9L$L$|D$;4D$4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$54542$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=T4u?h4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ 3L$3L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$3}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8383t$ t$  }tEL$L$H1USWV8= 44544D$$8u=$4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$} 4 4ȉT$!Ѓtsu!9t$ƄuY454;t$T$$|@Ut$ 9D$ЉʋD$4$X3@Eh4h4}!X3 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># 4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=44!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$ 4 4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 4D$ 4D$$4D$ 4e^_[]1JЋ4$|$9ωL$}@D$ X3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=$4 USWVt$h4tH>tC\$1EjU1GGGUSxL$4G=$4-5$4t~'V u$483^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)54jjSt$DPV5454s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@$4Ph4IUSWV T$(\$$t$ 1`2PURS)ˉ<à uVhk$t$|$u u)u%u!1ɃtsQl2Phj2#wt DhW3#MO^_[]SWV \$ hSh1## uPth3#O ^_[xEhSh61#o# 4$轌t t$譌j VhD3#뙿 hl Wv52t$S jWX|$WH[9uR1Vt$4$0j־Sh2# NVWV|$ 52j/Vt@jWho#QV-^_1@$4PjÊD$d'3J d'3;t'3~{у ts \'3Q\'3jPh$4h1#" th$4h{"PRt:j52P? f=2u5X"4h\'3Q&h$4h1#"USWVt$81GWh9"5"4 1-$4ho SD$h"4SD$U Wh|%45"4u tLtFPFuf=2X"4tjQP: Pjemt$4l$0j3D$T$1D$EHM~EHMUڃÃ=$4uf=|2u0Iڃ% tM 1f=|2@ ЈD$P D$ƒ t|f=|2Qq f=|2uf=ܳ2tT$j \$Ct,j Cu\$T$f=|2x댉\$ 넻 $f=2tD$ @D$ Phm1#ڃf=2$45l2MjW5X"4| $4 $4 u61=<$4#$ |29uj5$t h3#VJjܻڀ tf=|2u j ttFPFujÉUt$jf=2t'+\$|$f=|2q1#t1#WSP jh|%45"48 h"4jjg(^_[]USWVP\$D$jP5X"4 f=21=$45l2޺jD$P5X"4  W9=$4ttػ1FU Ph1#KtMVhx45X"4- =$45l2iVD$P5X"4蕅 WL9=$4u^_[]WVjPh,%4h1#% t ^_h|4h,%4Hrh,3#\Hы |4u 4Q[h{"PtAf=241#t1#PQhWWh1#V \Wh1#Lh1u j$4USWV$d'3J d'3;t'3у  \'3Q\'3t$hVh1# 1GWh9"5"4‚ WSWjh"4Sj Wh|%45"4ă x>jɓƉ׉U A~*9u$h\'3QEhD3#F11f=2tjx)RPh2# jh|%45"4 1h"4VW WV Wj^_[]j5X"4ZW謶1SjSWVVh2#SUUSWV$d'3J d'3;t'3у  \'3Q\'3t$hVh1# 1GWh9"5"4 WS#Wjh"4Sj Wh|%45"4 ,x>jƉ׉U*?~*9u$h\'3QEhD3#D11f=2tj蘑)RPh2# jh|%45"4 1h"4VW: WV@Wj5^_[]1W5X"4yj5X"4iS軴WjWSVVh2# WfUSWVPhQ3#C1GWjWj9чtDƅtZW=9uhW3#C1Vj[VjP ^_[]h'3WjhҲ#h.2#Z1Sj"SV-2j/Ut@SQU# h'3WVhҲ#躻h"2#W\WVPjh $5"4g~ f=̳2t%52>t="4V裡PVW8~ 1FVh?"5"4!~ |$VW5"4M ?nu52h92#u  ^_VPjPVhK2# t=#4u.5 2V苻yVhQ2#) hY3# BP^Vt$j5"4BVtVhe2# h\3#AEj;WV5,2t)>t$=X"4V莠PVW#} jbj{VhVhs2# V2t$2jh$5"4| ų2u2$ų2%2t$2t$2f=̳2t52t$$52f=<2#tF>"Pn2t$22%42t$2j2t$$2f=2#tF>"P^WV,|$8V5X"4hF>"Wt! $#"4 $ "4"41GVW5X"4 h"4Wj8^_WV,t$8W5X"4=hF>"VO1Ʌ#G OWj5X"4W8^_V1Vh{t 5X"4] js`Vhzt 5X"4? ^S\$1uDjP||[ESWV|$\$1FtCWPt1^_[fUSWVl$$1%4%4D!4%PhP2h4#t$4U1I~1L$$D$= 48O>HЃ sX 4HЉ5D!4jhP2h4#t$4U藡߃ufH1K$4&D<%4뷃EFD<jh;"SA jh@"S) h"ScD$QPuVD<h%S3hZ#Szh"S$_= 4D<H"41@D$<$XD$%4=%4D<j/S蠴%4k<$$YxD$ P1PhPjPP5D<d D!4L$ !P5D<h95#Q~6P"4%4T"4=D<W**ShD%h%4; 1@1H1HD$1@$D$~1HD$$!3)t5|$L$(4h%VCt5H"4P"4%4T"4Y VjLVjAVj6Vj+ 45D!4h5#j VV4$jh\'3N"w&P_ D$tu1= 4 1A111ɣ<2 222=%4t 2=P"4t5D!4 uW6uB=P"4u5D!4 u3^_[]xVhm5#Hh5#Ah5#:h5#jX5D!4h5#!h5#h4#h5# h4#h 5#j#h'3jj@h5#萲jFh'3jhh56#pj&fUSWV,|$@hDŽ jmW^1ۅ 4=P"4h 42u.j ת1=T"4ȍPU8vX"4j詪X"4x3= 4u?jPl X"4teQvX"4Uhk$菅 4WŅ?1GVj= 4t1O,^_[]ÉVQ=T"4uL$ @Vj5X"42 1Vh t 5X"4< Vj!1@ 4jh 41fWVP=(!4t 5$!4t$uh8# ƅh8#t8/u228# Pѯ Vh2P %1&9uQPt$荺 &uڃ=D!4u%hD!4hc#t$ u D!4%h%4h$t$¼ u %4=%4j:hB9#t$ 1Ʌuǡ%4u'>/5%4jV%4%45%4P"4%4=D!4u D!4%%4Y1ɉ %4%4t=%4u%4t =H"4lj:h$t$- 1Ʌ %4=P"4u6%4t=%4tP5%41P"45%4j:h &t$Ȯ t 2j:h6&t$觮 t 2j:h"t$膮 t 2j:hS#t$e t 2j:hl%t$D t ̳2j:hK=#t$# t ܳ2j:hp#t$ t 2j:h`#t$ t 2j:hu+t$$4t P Vƣ$42h"Vts<$4hZ#Vtahu#VtSh{%Vteh%Vt1'3Vhg:#WO W<$4$11ɺ20 ߈$4Bu^_[ñ1WV,|$8V5X"4WVvWV w#NF=T"4t L$f=2t D$#$d$d$ wfD$ f=<2t $Vj5X"48^_h"4jj SVPf=̳2tjMt$R 20utztD$=jV5X"4z f=2t|$ "tl1#P,`u 2 <2tu 2tt A8u1f=2t .3DAt x.3DAD$jV5X"4 f=2D$P/h\"4jj? USWVt$D$ $1=#4h j%D$1CSjh\"4SW Vhk$$h#4$tWD$ h"4jj t$jUj=#4uD$ 1;$ȃ^_[]Ët$$4$'3H '3~'3H '3h'3ceȋL$ < U;t$ KD$ V1FVj5#4h "&*Vh#4#SWVP2\$ x2t%4!429u Gt+t' u9tpD$jP5X"4 Yـƀ_r8$4^?t@آ9$4:$4 8$49$4h8$4hk$}PW1^_[P'3H '3~'3H '3$'3t1Ƀ=<$4!YXD$_r8$4^?<t@ 9$4:$4 8$49$48$4SWVT$L$D$=<$4ut1<1@$41F9uRQPd y)8thR%*u^_[hY:#USL$ \$1B1t 9tA8u[VL$8#4tSA 6:#8t6u(^@\VPt8$4)ƃuf^?݈@8#4^VD$PhA:#=x2x24!4Ft2_r8$4^?<t@ 9$4:$4 8$49$4h8$4hF:#Y_r8$4^?<t@ 9$4:$4 8$49$4F t*vPh8$4hJ:#4!4~ v 7^ÐWV1F|%4VW5"4Mb VW5"4}c ^_USWVt$jV5"4[c  uD$41؍oD<jV5"42c D$< t r֍,f=̳2t$4t P u̳2D$y1D$h6#P$4tD$y̳2D$nD$jP5"4_a^_[]1f=22USWV1GWj|Wjq~ VWbVjW"4fCX"4CfC 1l$jjS7b ~}D$tvjh|%45"4a ~]|%4Bt8StGWuG1GW|%4U5"4` WUl$5"4a 1f=22D$hU5X"4wa j# Ɖ,<=<$4  A9rWD$Pj_ f=̳2$4tyf=2~g|$_r5,2Pt. $4YSQ;Y~ڃ tZG9r QRl$!y-n8u!PWjl$UiVEh@jf=̳2t$4t P jfSWV2t32^tPGtF tFFu҉5 2h:#hWh{"WtRVhW t4=@!4tWh:#j W覹tWV;%%2^_[USWV|$hC,%Wj Wj=Wt@C@uSh%WŹu S6ÉXj?Wřt0tO@t8JS:?!tOYt@t 襖tWh:#~5=2t,2Ft = @t ^t~vuك=%4~h ">!%4^_[]SWV΋%4C!w\C%4؋ d'3Qd'3; t'3h\'3j %4 \'3Q\'3 X%4#|>Wأ%4NI$&Whj#%4@%4N Q1f~ @%4d'3H d'3t;t'3lh\'3j!-l%4v Wh;#" `Whj#%4@%4N tEPP~%4V\'3H \'3!6hk$%4#|%4h "^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n:#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh%S2uW 1@WX7ljR1^_[SWV21t8ϻ2WPt!CtWPӵt Cuމ^_[USWV׉A tS^؃H$4&n tWU耵tjPu UO WerF tQfB t 謒th;#*N 1?!9~ t~ N 9tF N^_[]h;#fSWV,1f=2t h<#G|$$tl'4$ h=#US ƃw$l& @&4׃BD<8jL$QPk $9bT'4X'4 A&4냀 @&4wD<l'4` @&4T @&4H-D<h7B#U|ſ =#&h;B#URvVWUU u<7t;upC @&4KD5tX<=Eh%Uuƃt=tUuUCkD$d0@<=uEajD$PU L$9! t , K@&4h7B#V,<0$ $ D<=#5D<O'4VP~'4t=G$tjVPd$ @&4`'4d'4 A&4}=H&4rh%UtUPh>B#@ pjh=#VhC#! WhyB#&UVshB#hJ'&jxWhWB#QWhB# D<Ph=#j9xu*@&4 t5!3)~1҅ S|@hC#hC#hq h(B#hB#hh{C#hqC#hKh>?#躳 D&4u8D$PFu h=#9$=#@&4 D&4y!ǃu h^># =#&t!ϋ D&41Ph=# &u sD&40h=# sD&40h>#AWh1>#n.t%th>#Q|$ D\'4$ $ 4hW( uW$ 4h"ō$UhP触 tʼn-L&4=@&4h'4hPUO P&4uR%t#P5L&4h>#hT&4P u5L&4h>#jH&4uG=\'4tyH&4'4='4tV'4h@&4QH&4u7J$ H&4z$u+h@&4Pu,H&405L&4h>#:u5L&4h?# =D&4uh?#hI"h0Yhj$$ tN &4u$ th?#h&4Pu$ th?#X#&4=tD D&4Au$ th@#P=@5&4*O&4$ D&4@&45L&4h@#H&4tpp 0h7@# @&4uG&4@#tt@##&4@#@tl1#QPhl@# \'4tPh@#@&4uu+ D&40Au*h@#N D&4 @# D&4@#"h@&4u Vh@# #\&4=u#5P&4`Mu5L&4hA##K5P&4Mu5L&4h6A#&4tPMu5&4hOA#]j$ th?#lUSWVt[ׅtf΋&t#&tVPt%]uWVh?#PPPhC#h'3HD&4t@t h@&4ЃjD$t@0hA#S1hyA#hnA#hh>?#蔭D$t@0hA#1hyA#hA#hh>?#^D$t@0hA#1hyA#hA#hh>?#(USWVhB#1O&,&Qh{5%h'3/&t*tu6h'3jjhB#h'3jjhC#h'3jjhC#$C#tI#FKrh'3j <^_[]USWV'39u1Ht$Vhht@P V$PPftхu! $hYC#&tc D$O&&0tBVkؽ ;$ݸC#D$VPh{5%h'3D$I#uh'3h?"M^_[]fL$t11f3QBuhE#hE#jThD#TWVD$ tRt$tX|$t3fPh,E#fPhOE#f1@^_hyA#h!E#j` hE#h!E#jahD#ԪUSWV @$ @SFX~ _cf ߃| RQh!F#%19ս|*Ձ tRQh\F# 1 @^_[]û l$ WWSUPL9tmv hF#W$ =Ut%tv hF#hjU膬 1$ PPQLÉ11 Զx$" 9/9$ $ =JA|$  D$ |$< |$$u)D$L$T$$RQPT$ L$D$419ع#PhG#Dch Pv tOPSQhF#6$!u$!$!j?PQ` t$hG#Q+PQhQG#$ "u!$ "$ "hPQ th-G#$ QRPh|G#]$$j@P$!P* Pt$$"P$$ Ѷx"l$$ $8v+)t)+8uHJRQPm t h'H#Í$  tL$(SUP藇 l$ M1h$ US\ |4ōPUS+ < ߁WjPa N1\$ PPh t<=NýjPU` 91E 辬8t贬8覬8u.N1 T$ PPS 9tǃuzx8u~\$Shmdv蛔 thKI#ZSN1 T$ UUP ljl$ShmdvX 9=tWv hI#2v htI#ghyA#hE#h8BhE#hE#h91hE#hE#h: hE#hE#h;h F#hE#h<h}E# USWV$F~ 1jUWSPG9u!D$=жxt9wwF̓uv hF#R v hI#ST$1uD1Gu<jUPSvF9tu&v htI#hI#1^_[]hPv hI#hyA#hI#h hE#hI#hhE#hI#hh}E#ţUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ PC D$VUP s DD$st$s 8D$ s <D$tf4$l$4U(&}t_uh[H#h,%hk$h'30 (&h3"h'3 uh'3j ,&D$l$4$sf@8tD4$t$xVX@S)bPSV \$$Vt$S\K1D$0D$,D$(D$$d$sD$4j@HPRc st$st$hH#t$hH#t$hH#t$ hH#t$thI#L$9,&t uQhI# (&hI#O|$4tD$4Ph+I#6|$ gvVD$PU谁 16D$8uT$Bg)QPR* thH#1@^_[]USWVӉ͋t$V贑 1Htkt$t$VSUzCtGU>t$t$VWUC9uVSW t'Wܡ  Wơ 1H^_[]W赡 USWV$$$|G8-t !3$D$ 1FD$h%J#WSo it 1X&29t9At&9IuJuiu3$tHPhI$ AtPqh=J#A 늡D<A뀃Dtou&t$ mt$dD<$W$uQ 1t$hWV  jSV]x $FWPPU uh%VhiPƍ u hN#j2cW=T$X&2l$D$G_HrY7ShjD$*P= ft$fD$CL$fA37ShjD$&P ft$fD$f\$ $T$0 T$T7hjRƠ S]Zft$fD$fD$PSUH~ $T$l$GD$x|$ hhjD$$PJ \$ $ shO#Fsh6O#6s hYO#&shvO#shO#shO#s hO#s$hO#s(hP#sHh5P#s,h\P#s0hzP#s4hP#s8hP#vsXf|$rL$IQ#fw p&L$T$ t$"VRQPhQ#hN#hN#j^D$f=212hjD$$P fD$|$<2fD$ $T$2hk$H$D&L$f|$Q#tQ#PD$=ufD$L$IL$}1|$D$L$ t.314/Drt#E9uT$ЃDPhQ#;~|$uj)jPPN jt$t$ Vq VhiW^ u hS#D$(|$ u,$PD$D$,$|$ 1hSW  GG?t$>hSD$$Pۚ G$0hSW辚 jl$UWq whR#h\'3vWh:it$V~ uO j.h\'3vjs Wh:iV9 u Cw8)|$S#S#P$rkLPD$$PQw $<1|$Vh#R#t$kL4t4`&hhR#hR#48~1D=P譿G9uh#k4 D$4!4"4#4$4%PSWRQt$hR#14(hR#444,40k<SWPRQPhR#4`h:S#׿h_S#ʿ4\t hnS#豿t hsS#蟿h#4d6|$1A t$t&u/7t$t nu QhxS#BFL9Mt$ $t$qV3P$t$RV3hO"PhM#h'3G j=USWV։1hUS菗 jWSm sUPPJ t'Sh9iPZ tVL3Ĕ^_[]h%hN#jXUSWV׉1hVU jSUdm }VPP!J tAUh:iPۂ uGPhQ#A1FS2Đ^_[]h%jXVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1PhQ#W^WVhR#Df>r1D~Ph&)GH9|j]6^_WVhR#f>r91D>Ph" 9} j:G9|h#趼^_WV$fGjRWk WhiV` t Đ^_hS#jVfUSWVu }6thl1#je hS#VWb Hw$&'4'4ԃBu|1PP5D<@ '4불'4'4'4'4'4'4너'4'4sjh\'3wh_'4S3=!3='4u.1L$A AAAQj j/ ='4'4'4'4'4'4'31O=t'4b$3tch#VLt^='4ukjjV. ƅD$ PVyD$(!=<\$yB  '3u1PPV7. Ɖx\$'4j'3=t'45'4PL$Q- ƅ~E1'4VPSJ, i)u5'45'4t$d- ƿy5'4hk$2='4'31O=\$t$9ȉQ,.L$5'4u ύD$ PSyx5'4r*V '4Vh:T#'4'4'4'4'4V-3hk$T<'43V`-3h#T#1ˋ$B65'49rPhS#h'3袺 1@'4b$;'3t=h#W藆t1\#='4u{"PWƺ;? \$'3\$='4 1$ӋFHN~ HVnƒ ='4u u u1G1='4up='4u< u7 ='4>hl1#hT#h\'3臹 h'3@t>$@$PhT#h\'3]ڃ h'3@ t_  ='4d'3H d'3;t'3h\'3j$}  ='4xd'3H d'3;t'3h\'3j^':='4,d'3H d'3;t'3h\'3jMͻڃ\'3H \'3$\'3H \'3^d'3H d'3!;t'3h\'3jIm \'3H \'3I \'3H \'3Md'3H d'3%;t'3h\'3j- ڃu!\'3H \'3-.3DPuWd'3H d'3;t'3~ƒ t\'3H \'3h\'3R虺ڃd'3H d'3";t'3h\'3j^^ڃuv\'3H \'3^?tЃ@Ӌ d'3Qd'3; t'3~ ȃ t \'3Q\'3Vh\'3P=F @t5'4hk$7'4f h'3@ui'3\$t V=('3%'3Whk$?7'41;`h\'3u'4e^_[]h 9"jMhb$fUSWV$$0Qhl1#jB 11E1D$D$D$D$$׉jh 2hST#$VMQ~Hw@$&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jD<$ىY1ɉPXuG !3$T:-u"j9uzuI !3 u !3)t u <$u|$uM1ۋD$Ã<$D$ ptD$ $4u9>WuTWhT#D$u5t뢍D$PW u!WhT#MhdT#jsK$1 |$ $jSV  u h%P<1u融8V_1CHHf wy$0&|$uhUÅu뼋ss h PVh"e |$u.jSU  ss 1 PVh". 1F $tCPpQC|$t KP;AmPsT$Z|$Oshk$31F7h,%j[J&PPhT#h'3UjKfUSWV$$61hl1#Uٝ -+4-+4-+4-,41Ch2U#VW_U e'H wu$d&,4-+4-+4Ńo'fil,4뙃prv,4oa+4,4+4%+4-+4-,47+4-+4-,4,4 +4 ,4,4,4,4 ,4,4u !3)ǃ=,4+4u-tX1Ƀ=,4=+4tL$H=,4=+4=+4=+4tʉT$4Y ,4jY$,4PYt$lVUhH2D 9rUhU#\hH2(CH2 @2QT$/u>t$|9A@2A @2I2vy/th?U#htU#jGt$ D2Dh j衆=+4u$PhH2C $PhH2 u@28uT\=,4u=+4t@+4 ,4t3D$ P61#$=@txUhH2D$ P66 u6hk$jpF#D$=@u+4 ,41ۉ  t1ۀ|$/uhH2hU#.t9UAr|/u (IHr IH9/touɉt$P(,4USWVT$juQ PmD$1t$CHfw?$&ss 赙 PVt$ h"讽 PshU#蜽>|$(5D2C,H2)=|5TShH2hU#` t$V 1Ga{DuO|$u C(D$?Cj/D$ P9xt L$)@L$D$h #QxT$CS(L$)ʀ</t ~/t/FD$щT$H2)rPhH2hV#t$PV. L$@2@2=I2vx/u H@2=+4tD$PhH2D$PhH2 T$KP3Qt$31 u@T$(3Qt$$3q u.shH2h@V# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH2hfV#芻 1Gt$#KPqt$1BD$ $&=+4L$ QP T$ +4 ,4sHtbffM ,<4Q,<4T$ ,,4t$/D$ !=@8fushV#蜺jSt$ V\ 1G)=+4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=,4t$tjQ\,<4H ,<4<(,4tICPphH2U4shV#裹D$ PhH21u=,4thH2sh]"蛦 V Åc1G18uV\e^_[]7hk$h,%j@hW#hW#h6!ԂhH2h2W#h+W#h?hV#.|fWVt$$D$(H0JH(x,z H4x8J z@ \$PD$D$T1l$P\$X1\$|$(9rD$)D$VPt$ 9n)|$(=(,4tkt$H|$Ll$H X&D$X|$D$ fD$&l$&\$4l$D$4(,4Pt$t$WVhH2t$8h^X#h'3$AD$whk$-']=,48hH2hJW#h'3¥ '3H '3'3H '38= ,4<u0H2VH#GPhV ƃhH2hk$_XO\D$ظVʋE@D$ T$\$\$@T$T$Dl$@\$(hh0<4t$8 Å11Sh0<4t$ H29߃=(,4tk|$8t$/uD$PVX#X$hSW/ W=t?$ VPh@%hW賖D$PWX#t VQD$PWÅH<5WVQf/PVet@\$L$/PWjet@L$ Q\$Seu)D$ )=|\$=8<5u=<<5h\'3'LWhX#h'3t '3H '3~'3H '3h'3oÉ؃t9 t4'3H '3~'3H '3h'3roƒ߃Y=0<5u#D$=@uWrDW蚷u8=H<5u WV 4<5 PWQVQ tW#1ۀ=L<5$M<5VPWhX#h'3jj hX#E9D$t$QVPFL Ƅ fDŽ$.$$PQ\$4$9|$ t#t$WPK$ D$Ƅ fDŽ$.$PQ$3$$3$ $3$$3$  WVhX#蒧 fD$L$TTPQCcËD$L$TTPQ*cUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQPb^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPbb^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPa^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQPa^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP0a^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP`^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP`^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP4`^_[]USWV |$87hl1#j jqPt7D$Phht@j9V uD$tL2X<5\<5`<5=u d<5t$41۽hY#WV6 HσG$&`<51h<51X<5<5<5\<51h<5`<5l<5p<5<5낃w<5<5^<5O<5@<51P<5"<5<5@1X<5<5<5x<5|<5<5<5<5 d<5=t<5t t<5l<5<5<51V<5G<5<51C+l<51h<5`<5p<5\<5t<5h<51`<5l<51@<5l<51h<5`<5p<5\<5<5<5X<51M<5<5rP<5c|<5x<5J1X<5<5<54p<51h<5`<5l<5\<5!3D$=\<5u=p<5u =h<5thL#.tPL2=t<5u t<5<5 l<5L$$ ȉD$<5 <5<5 P<5L$D$ ы<5 T$ L$u1 T$ =<5t ŋ$u|$u|$ t+uh<5j <5 <5=<5P<5tL$t*t,uw) kL$t;t=u^ Ra K =|<5u==x<5 t/x (H !F =|<5u=x<5z t <5)θT =`<5u/ =p<5u! =l<5u=h<5e t <5t1AT2U4T<5 ^_[]3gPhY#h'3c jYUSWV΋\$=<5 t1PSRt ~jP1ɉ=<5tW L݉t$=<5D$WÉL$ CHHf$ &ks y PUh" T<5{Dt{T.u =d<5tw=<5uL=<5u%shZ#ۊ1TShU#舝L|$|shZ#诊<5VWʼnى=<5ut jSW  WÅf0WGf0f8u ^_[]jh,%j$WVD$ qH1ftYT$zHftIf t$f tf9t=<5uyDt,RQ<51f Duf u RQ^_fu1@fu1HUSWVL$d<5D$ l<5u =<5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P~w PSl$$h"st$X 1@F FT<5Z|$dt~T.u-=d<5t"fu=<5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=l<5t-T$$L$(=<5t-sh&j $Wr$D$\l$t$0KjsBsDžt=<5tsh&j $U)jsztŅtщ|$WG‹L$@D$9ʉT$@l$ U&ʼnD$<9L$<=<5t/h#sl D$TPT$ 9щL$ 1|$PL  à t$P*| Ct$ P|=<5t +Cl$TUP{U\ ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=<5tD$|t$ |$ n<5ʃQPRWQ$RPhL"jVFV}D$|=<5t$ |$ tHVUUUȉD$|$D$<$$SWh5$VUU$t$h&VU迂U$=<5tDŽ$Mt$4t$ d'3J d'3;t'3~у t \'3Q\'3Guh\'3Q赁=<5tXD>d'3J d'3;t'3~!у t \'3Q\'3Gu7h\'3QTL$D$ ρÃ<5T$9<5}`;L$}XD>d'3J d'3;t'3~!у t \'3Q\'3Guh\'3Q辀d'3H d'3;t'3h\'3j 蓀\'3H \'3 1D>d'3J d'3;t'3~!у t \'3Q\'3Guh\'3Q-d'3H d'3;t'3h\'3j \'3H \'3 e^_[]SWV΃=<5t vrhW%c1TVO^_[SWV΃=<5t vhW%1TV^_[Ã=<5tATPqh@%Vy ÃTQhk$DyÍ` f w5$<&d'3H d'3;t'3h\'3j@I/d'3H d'3;t'3h\'3j*d'3H d'3;t'3h\'3j=kd'3H d'3;t'3h\'3j%Dd'3H d'3w;t'3oh\'3j|!d'3H d'3g;t'3_h\'3j/~1@á\'3H \'3@\'3H \'3=֡\'3H \'3%á\'3H \'3|밡\'3H \'3/1á\'3H \'3*USWVl$(}=<5tE G=<5t=<5t(DG<51 <5Í4^69L2} ^_[]{E ;\2~*P5<5H tM \2<5<54FMt%$Q  Qt $ B$Iu$ L2șƉșD$$t$D$ D$|$1ۋt$=<5t( <5 U tt$ ;4$}Z;D$}El$)šd'3H d'3;t'3h\'3j |\'3H \'3 MuC;\$rd'3H d'3~\'3H \'3 h\'3j {D$@D$;D$ ^_[]jGLUSWVt$~=<5tF G=<5t=<5t(G<51 <5Í,C L2-9} ^_[][Gșljș|$$.1E  E;|$|6d'3H d'3~\'3H \'3 h\'3j z1V =<5t(41;$}D$)ád'3H d'3;t'3h\'3j Gz\'3H \'3 KuGm=d'3H d'3~\'3H \'3 h\'3j y^_[]USWV|$=<5t_ C1ۃ=<5t=<5t(C=<571F  Fd'3H d'3;t'3h\'3j,Xy\'3H \'3, +N,d'3Pd'3; L2} 0;t'3(h\'3j y;~&\'3H \'3 "\'3H \'3 h\'3j x1W =<5t(4_ŋvd'3H d'3~\'3H \'3 h\'3j gx^_[]fSWV|$<5W9t pSP&9 t81PWV Vhk$ rVsI ^_[hZ#WhU#j USWV$U4(F$$1 |$1 9$)덄$PSUD$Pl[ tXǃt-tat$] ?tL$T$d$.?T$O$E1 $ ;,,3r9vL$?T$$$^_[]SWV ΉRQS[ 1t4u t|uHth\'3PjSU t V] lj ^_[fUSWV$$3虩1hl1#W^ W%$ D$D$ hr%SV mu05D<5tChP$WfG 뼃pu D$ 뭃u !3,uk5D<hT#j #D$=@u.$VtP 9r*thZ#jP|WPvd ty/t AƄ/@L$M$D$S|/uH9tx/@tj/S:ޅt@VxL$rShZ#<1A $'@PVt$  ٍ$Ct1@$Mg4$ccGPPh\#h'3njc<5USWV։π=<5ujVqt~VWt9sH8uR\$@SVt{SW9Whk$1ۀ=<5VWh]"k VWhk#  w=<5u=jW'quWh[#H#D$H=@V7=<5/jVpD$@PVjWpuD$1Pt$LD$2x l1#td?%D$1Pt$\8W1Pt$`XVPSt$D$BPh[#h'3l#D$H=u}1PPWW t$HhV; \$D$<5=5VJCVh+[#1C؍e^_[]ÉVhJW#h'37l '3H '3~'3H '3h'3uBÃtH tC '3I '3~'3P'3h'36B '3 tuÃ߉1ۃYM@Vhk$'$<5S/ =5t$|$SPt$  Å11S5=5t$D 9x߉=<5t{\$(t$,l$( X&$$L$$D$ l$ |$T$ fT$l$\$l$T$<5RQPVSt$(t$(h^X#h'3j$5<55=5t$  Å6|$W\$SCt$uVhYW#SD$hL$l$JD$pBD$tB D$xBD$|BRWtVhF[#7t$\t$\W D8tVhT[##D$HD$Ht$\$ \$D$t$Phk$VUtVh;[#t$S1V5<5t$t$ЋD$HPWxtVhh[#V$Wvt*C8-t$Vhu[## WJtV|$W蓇t Wh;[#H1ۀ=<5DVt$SWVP׉jWP t$t-h[#h[#xh[#h[#1@^_[%tPh[#h[#px VjWP襪 t$th[#h[#%tPh[#1돸[#=<5u[#[#jWVh%Ph1"S3|Shk$jk@[#jVh%h[#h1"W{WUSWV8`2t P`21=5 =5=5=5=5pf52it$L$h&hjV `2AVhJ\#0jG`2hhV= `2=5hjV  `2@Vh\#0jͳ=5u21`2=5d21t~ =5ttja`2=5l21@5`2=5l21@D@Vhd\#0jE`2t =5tj`2 5tQ`2h$=5PT"xC,=5%= ts=`=@5=5h\#j許 U?5=5h\#0j膲5`2s`2=51HPhm8@5`2D' 1ɅA =5-=55|=5=5ˋ 2u|552v$|&=|5=5>1jSS5`2&!ƒud>8f=5-=55|=5 a1H 22==5Gt =}r t~=55q˃u#=|5tPWUVe ~jWUVe tw߿(=5u 5~~=2|218^_[]111RSWV։ωSo2D$t,t\$W3l4$t$ctjt$Ao#1@jt$)(e#1PW4$t$jSVVdx^_[h e# he#h,e#jVP=`2x=5 5t}==5ut=5tD5HQP~'Q &pf51 =5=5$Pj !e55h\#55a 55==5uKh$=55`2>u4#,=5=u"=5 |=5u5=5=5=2w=5t2~ jP5`2b2~jQP{ 5 5t4==5u+55h"b555:`2= =5u =5tP1 =5=55t2 5 5t'=5tG5HQP~Q pf5Pj c55tZ55h]#,uC55 55 u 55jhQP_*RPh]#V_1V55.5pf5^USWV=2\'3t'3D$WO+=5 =5 u1@1ɉ$L$=52\$5555h;e#hS![<$t$W5555})$hVF#RPWhFe#hVZ$VShc#hWZ}WPW}tf=A5t]t$58f554f5h;e#hV{Z$VhA5hc#hW[ZWPWj& 2u_5pf5<$t$WjV($h$RPWhFe#hSZ$S]Vhd#hPY5D$=2Opf5D$ ;e#D$5555VSPY$5555VSPY5 5 554$t$VPQ'$hVF#RPVhFe#hS4Y$S]$QL$Qt$Wt$$hd#hPY$t$V,PVj "$PW55h"t$\e^_[]V~==5u(=|2~h~V5`2 |2~^V=51==5uE1jVV5`2xRP5`2)/ y-6h$]#0jd 1N^Ã==5uhD]#jI&1==5u5555hv]#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSUc ~)t^_[]WV5|2==5t$t$5`2` ƃu*~3 =5;55tc55tU=5L~  =5?5|2x52h]#j, 1452h]#0j^_USWVP5|2|$l$1ۡ`2$WUt$k ƅ~)tދD$9u=5 =5!|2=5Hs-148 uc1h]#Vh5|2:~\%tS1jPP5`2Kx})RP5`2, yPb38tD38t:38t0Ty:38t 38u |2138Eu |2xt =51 =5==5uh ^#j腥`tx>5Ht)t h^#52h]#jL 1%hx^#j252hU^#0j^_[]USWV1N==5=|2 2uh^#j٤ =5<u=5-=5sg =5=51jWW5`2xXͽuWURPIZ)jWU5`2oyQu t# =5@ =5=|2:h_#Ff@Phm5`2 x|2h?_#j1^_[]USWV \$$|$ l$(1uu5|2=51jVV5`2x\D$ljT$Ӄ==5D$=5|=59L$ujRP5`2Ix+D$T$EU,==5u#0hs_#0j |21N ^_[]USWV~=|2$(~$$~=5t)h_#j蔢I1u)1ɍ|$h~W5`2C 0|$fGWhm5`22 fD$D$Whm5`2 \$h~S5`2 $h~S5`2 GfD$D$Whm5`2 |2t1<$uzfD$D$Whm5`2\ f $ 511F$$~jQURы$ʉD$ ʋ$$~) hE`#b1F|?1jPP5`2xg)y11=2|!h_#11Fs1o_.hbd#RjRP5`21yK;.h$`#./.hBd#"#.h_#.hd# .hd#0jB 1N5|2~^_[]fD$D$ D$Shm5`2 y-t$hu`#-t$hd#0j٠SWV Vh5j yk-h`#0j袠 jVj y?-h`#0jv 1N==5=5==5=d5u55h`#趟==5hl2Whd2Wo =5aXa#tMa# 2(a#tna#QWPA S8 2a#t?"P55ha#ha#h b#h3b#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5=55=5hb#sWhdb#T55ha#Aha#4h b#'h3b#<=d5thb#j{52hb#55hc#ҝh'c#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@htc# h7c#hSc#Y55hc#Fh'c#9sWy\Whc#=5|255hVb#5 ^_[hb#М=5t P$ W=5t =51=5|2hc#j|52mtt$11Hfhh=5Eth=5A51P)h]e#0j臜 1Ht$!)hze#0jX 1HVt$Vu(Vhe#0j*^\SWV|$$Wƃu[(1~tHNtt 9 tu/(PWot#D$=@t b(1N|^_[USWV1F5PH{5P kjQƉ+lf5Hw> 5SPhA5Q@ Xf5$ \f5L$QPhA5\hA5CjuhA5[jhA5^uH=A5/u+-Bu"A5PyPhA5A5P h\'3WVhA5M<h'3@ubXf5`f5 \f5 df5QP.t 5P(jh5j xsZ1e^_[]&he#0jՙ USWV (2x&,2kL29|׋yM1II1tf51PQÅy19}WDu=2hh#j.hhtf5OÅy1ۉ9|(2x(,2kLShtf52y݅u=2tehh#j迗tf51E$sVhuf5tf5P )؍tf51Eh*h#ji1IkFL25Shtf5#1ɉ^_[]USWV D$5xGD$sf5$1F1tf5SQ291C5htf5hA5P$ 5Qu*D$PUhtf5Q8 tf5tu=2hg#j耖t$huf5htf5 $W1CttUtB:x9u=2tFhg#j,Whtf5Q19uhBg#j1H ^_[]hhg#thA5Q<t pf51hg#USWV1C5PH5P yjdƉ׃=5t/52t"hf#0j4 e=5t Rrx7t$t45P(jh5j lzbV1ۉ؍e^_[]Ít$\$D$lf5Hw5 5VPhA5Q@ Xf5D$ \f5L$ hA5kWehA5duy=5tShA5pt^5 5tShA5QhA5UjhA5Xt@hA5EmXf5`f5 \f5 df5QP=A5/u+?<u"A5PPhA5A5P 5 5tShA5茡 5tp5|NPWt$hA5)6Q=55D$L;f5D$Pf5PhA585e5t@t= 5u Pl=2t1lf5Hr@tZ tUhA5l'9D$X;f5D$\ f5?uD$PhA5$Ã|$= 5ut$hA5Å5VShA5P@ = 5uShA5/!؃=5\$C=56D$5HQPQ 5=5D$L;f5D$Pf5Xf5`f5 \f5 df5QPDy hA5j=5\$^=5Q5HQPQ D$L;f5D$Pf5D$X;f5D$\ f5OPj G5D$uXf5D$ \f5L$ QPpe5x5255aXf5`f5 \f5 df5QPhA5ji\$=D$L;f5D$Pf5Pj F5USWVj/hA51UhA56t>5A5h=5U /tOGh=5WUhA5hf#jjO1N,K|/t1NuhA5hf#jj^_[]SWV=501F 5t9t71he#jێmQHb5P R=5t i<5x t `m#5 5t#55he#55A 5ujhA5^t(Xf5`f5 \f5 df5QPu1=5thA5hxuthA5ly5P(ljgSW, xa5 5t&=5t55h"251G*ƃuejh5jg ^_[USWV $5xu d?*1F5P,5@0D$ jD$T$=5jShA59]jhA5Q$=5thA5~ghA5+thA52dlf5 w's1PP5Y5B $jhA5Pƀ=A5/u+4u"A5PPhA5A5P  =5t4$hA5Z' 5t:5|Pt$t$hA5s.PhA505pf5hA5T$t8=5=55HQP~dQ c5L$Qt$A5SPD ƉPS?&=5tc=5tZ5HQP~3Q 2Pj A5PhA5%dPj A5D$L$ʃ|QP  \f5Xf5ʃ|QPxnhA5*1C@TPhA5Z%5Y5hf#0jhA58chA5)t 5P4 jh5j蚭 =5tn)11Fe^_[]þA5PV$Vb뙉PhA5$뇃=5t cxIx5PHx11@USWV $$h 55Se = u$ /,4ŏ4/t EƄ4/FED$P55D#D$=@`1Gxv%xmlxd=5t exRhA5!(ttjh5j! Gm'155hf#j 1GĐ ^_[]55h0f#0j҈55hWf#뻸 )D$ )D$$hA5 X5 5tV1=A5/A5t$PU ;D$vhA5hyf#jN _D$PSeEA5WT&W^jhA5Kt'hA5K`hA5&'VShA5NR xơ5 5tD$PhA5ȔI=5t55hA5+5pf5=5tEhA5C=55D$D;f5D$Hf5hA5{lf5Ht 1PP5Y5 $jhA5#Pt$hA5 WhA5D$P;f5D$T f57wD$ PhA5;5tk=5tbD$D;f5D$Hf5NhA5hA5^^D$D;f5D$Hf5D$P;f5D$T f5d5Y5hf#0j蕅PA5WWWhA5!PhA5=5e=5X5HQP~ Q Pj #;5 D$D;f5D$Hf5Ufx5xj5|5u 5@|5=~| h~PhUh#thPhh#j蜃1Hã525=5y x155 x5|5ʉ5 5x5xj5=2u=|5t4=~| h~Phh#thPhh#j1H5=5 y xx5555155x5xj5~25USWV=5thi#j艂1I^_[]Ã=|552u|51IxՋ=5+=5|$\$52UVSW8)9|11UV$)݃x5|J5 25~H55P55;5r֋ x5 2551)ȉQPx[x5Ɖ55 2ȣ5)=55 515521hDi#jWV1N=2=2uhvi#jy155525x5Z12~9} G{u'Phi#j~ xI1=5=5525x5~ x5 555 51^_ËD$L$5)ʉ5QPR USWVu ]1D$ D$ D$5 5)ȉ9؉| 5)։ 5QPVSh5)ЍT$RPQ 1ID$L$ )5 5|~ 55)ЅqxUtX 55D$9ؿ|‰5)ظ|D$L$ 1H1@D$D$e^_[]V1=5525x5~# x5 55 55V1xC=5t/x&5555525x5~51 51H^V5;x5v*55)QjP 5552^USWVt$5 5ƒ|]; 55}O1hk#W}=5=5$-x52 ( 59)1 -x51ۡ21PUK;2tS155Sx5 259)QP륉5 5Nj-x5S55Uj +52)US55x5 )VQS. 55Htt51O1^_[]É-5USWVP\$1~cl$5$55<$)"523x3ǡ5$559|WUV 55)11H^_[]USWVPD$~Z\$ 5 $55ŋ<$)Dž~95$559|WVS" 55)D$^_[]ËD$)USWV\$ l$؃|~5D$=5t$)#524x\ơ5D$=519|VQWD$  =5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=5t7P$y#$ h\#0j.{$|r 51N5)ȅ52  59غ|PQ$語 ~|)à 5 5ظ| uXP$$3D$8$3L$4 $ hj#jUy hx$ hi#j5y L$ hi#0j z'$ h\#0jy111o^_[]USWV$$x$|$$D$x-D$PQt":4$h/j#0jny L$|L$1$p0L$15 5)ȅ\$^ 59|4$ST$ RT$RPQ$P~R|$ =5 5tP;CJ 5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=5t% u!$9$t4$hWj#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=5$4t1PWy# h\#0jQw1HD$sD$$P$<4$tVh/j#0jw $l$ l$\$ 525x5W踚 lj\$11ËD$ 9D$D$D$x5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1525x5$<. ljޅz11 ͉$03x$3|$ uRD$$P$8q$3D$\$3L$X $0<$\$t*Whj#<$Whj#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]$0hj#0j8u1K<$<$W$4hj#0j uUSWV|$7t6|>/u/1N=5MWh8k#js 5.|$tjh W˜ V $=55_Shk#VP#$EƅE<$8$S x<Shk#P$"$Eyw0=5t55$hk#Vjs155$F $eQhk#0js1N^_[ÉUSWV|$?/tGj/P*ƳUWou/Fj/VƅuhW=5t$$W jW(y3UWu%D$ PW)jUPWV/Fj/Vi1ۅA4t*PW%t1K#D$1=@ۉ؃|^_[]/WVD$t$ $P'yu~Whk#0j r$tDPRCy$hk#0jq$U 1$5^_USWVD$Et$$^߅tP膖y:Whk#0jpq=5t<$8$W 1 5tt)$($u7=5uj5P55!UW2 2t%1PPL$H$X$T$W$tJSWy!SSWhk#0jpWA$ 1$5^_[]WV1uA|$ t$t$W8 t(55VWhdm#0jp1N^_Vt$#D$ PVt%55 Vhm#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PV|tVhm#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WVt68Nu} u&WV+unVh9m#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV`{t%#D$=@uVh l#jm 1HjW |^_[USWV׉L$]D$PSzt6St$薔thj0wwS tՃ} tL1@_1=5uTG3D$ 3L$ uKG3D$O 3L$ u9t$h} DShZn#0jl댋D$$u1@Ë $jPUWV}wPVy1@xN=5t1A$$3L$ $3$ u*0$3L$,$3T$ uVh:l#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $&55h_p#>uu=5tlD$PUxuZD$ !=uHhWU ƄD$PW_xuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUaUt$袐 4$UWeL$ t uu$UFD$y)Q8=5us<$8$U xZL$ A$t$Uhil#0j3j1H=5t2<$8$U Uhk#Wji1ɡ5tt1Ƀ$ !($t($t$$55h]#;jUhxN1=5=2=2Uhl#Uhl#j7h 1OD$PUHvx=1$ ?#D$ PU1@=5u;L$ ($/t$hl#0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW_u1x1K=5t މ|^_[]ø#D$=@u5he%W1EtXWyĉm#$t W#9y55k#dWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5x5t5 p5l5L$T$tI AQP DUVP 9t_L$ xZjPUQҋT$0y@oEP Džt<$\$MQVP D$8+$T$0)+|$$>hm#jJe*t$8hm#t$8hm#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh5St y%m#m#\$xSV0je^_[Vt$ xFP葊=5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$(蹈 ǀ$1111틴$(3x$3|$ uUP$(xLX$3D$8T$3L$4 uF1VVV$(xE$($\hm#h\#.hn#j%c #$(h"n#0jc1N|(^_[]V=5t5=5t5=5t@5=5uh 5t01x&=5tDyhn#jhb1N^WV5tPTu1551N5t 5tqA5uj1'3H '3~'3H '3h'3tN;42u1tB 59G= |+5xx5 PW1t-58j55h58l 5&1^_SWV|$tR?tMj H tSƋ\$W'H~ </u>ۉ^F=5t%5p!hn#j`1Hhn#55551^_[á5t@=5t5=5u0=5t'D$$u5tjP55! WV=5tB55t;11G~u)uhn#jA`6h~#h'3 vu^_USWV =5u%51N5u5}$ $ $L$Ps5t#HHf w=$&phyo##"ph#o#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p豃  5qho#0 phAo#p j_e=5t\@PL$QL$ Qpp p09Bx85jjt$t$t$t$ph]o#p j[_ 51N1 $&LJ$Ƅ  LJ$LJ$=5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 5 VqPޥ  5VqP轥 55h]#1u5@e^_[]fUSWVT\$tl$h=5P($誐T$L$X$1V8$aV<$l1#l1#t4$tVjQjRD$Pho#S $u2@$%  RPho#Uh~#^|$x$ho#SEPD$Pho%S$Hs Uho#u# Uh]"SS SX^_[]Sj !USWV@L$E\$CD$PS{3jg9!p#|p#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($̎WVSho#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPS\VSԃGu܃^_[Ã^_[鸃USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V5~1F1u5ho#j9W^ÐSWVL$D$t$|$D<5t5tt\^_[K}\1KZ5teSP藶ti:tdx:!39}j D<@!3sPVW菭 hV5:-u/5È5n55`S6h-p#!3=S6hDp#h'3 ?^_[f1Ã=5u1á50hq#jV 5t"H 5p0hr#h'3a 55h_p#lu_sUSWVd|$|j/75t@l$x5h_p#PB5_p#1C5d5D$ D$1D$$jh2hs#WUHЃJw$\&;t$$@$&D< =5묡2t 252r2t c2P=2$t#\$5! D<k|5 |5 =5q# =5Q%255D<R2t 22\$5t=52e55L=52=5.5 Pt$5 * NL$ D< 5$LF=52=52=52=525D<5 =5-S$5q5D<[Z 2@K 28D<8-u x=5D$ =5u 5522 =5p#5255D<WO 5d5s,5d2U55?=51@D$ )2 L$ ƒ ʺ'3t\'3 !35ƒu 9u , l$D$kL255 51"1$jh82h"r#WU/~HЃJS$&42ƍHw$&,5뫅!D< =52d5| =5-S$m5@X5ˀC51 =5p#"5 D<@Ƀl~mtKotRpd5SatDeJ1A 5 5 2 2 2"25 2@{peD<=5SH53 D< 551ɉ5D<"]55D<L$h jLjh2Q5bl 5D<Vh"VN245 5@5D< i@5=55 =5Q%55D<9i D<E |5N545 $! D< }555D< =5@5 2%=25\'3 0akG1A11|$<$t 5D$tGNutNj]]h{t#SS1t[ht#S?uE55j55S^ 1AL$y#$]15<$D$h#Sl$\$th{"SDžu '31 ðt5ht#Suu35SC I 1urL$tP؅uAJjht#Sޅ uP5D$t t P CPىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P| h#St W=5<$l$S|$;5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u 5ܼ2=rnFr0s9-!3D5PM!39}j4NxP!3@!32!39 1VV4b x!3@!39| Qhkr#j?H 1FPhs#V(H V5D<hUr#hps#jHj5D<hr#hhr#5D<hr#jG '3Vhr#p4%52WV- 5ܼ2WV Vh$p5D<hUr#0hr#jjG!jmh4t#jCGt$h5s#jjP$t,(XN8@tUjP$yFD$8Uh{t#Wq1D$h.D$1$h#U>th{"U|Džu J'3tkðtAht#Stjht#S藁 tj1ujSðuh#Ut W=5Uht#l$}$l$ht#WU]tjWB\$rt D$W2|$ td^_[]á=5t8uhB"f=5t8u=5B"Uh~t#j E USWV|$W%UW[)UV-NJ00ht$跩tAtZ/UV)UW488ht$vuEt$hq#0jxE1H1^_[]á5t H 5h'3hx#mjWV'31FWVhht#WVhhku#٤WVhhBv#ŤWVhhtj,VnÅtj=VZtmj 舺 tdAE0H@5=5t |5s|5uh\s#j6B1O^_[]hps#hs#hps#j B4$ ɋD$L$01WV55hs#h'3U t(οs#Ph:$h'3- !uء'3H '3~'3H '3 h'3j u^_SWVPωPQ+t4Ƌ$| tC$SA t'ǍCPVWϨ DG 5 51^_[USWV$t%t_݊M\tS8uEEhx#j@Ej詸 UEƃjSV t3l$hUVPWUhx#j\@S $EE<\t:uCCU| $AStRC1fGt,PtStgtstp1B ы$J@u $A=5tZ5HVV[4$ Whx#ji? 1H^_[]V'V hx# 5 51V4$ Why#USWV\$tK;tFj tLNjl$1pSυG woD$G955t%5x!h@y#j>1NhUy#=5=5^_[]WV55t;11GFu)uhy#j^>6h~#h'3 vu^_USWV51 l$$=5Kt(=5t!9t)@tB9uKKt8<5CSC Dž$hy#j=z$uEP-zt?NjCt /C;WYC |/uHC C$#hy#j2=Ct/C1N^_[]USWV|$LJ$5tOwCu kPUC |/uPV3x t2[u1=5O=5=5 2$=5tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=5tGtlD$@1G8D$@1D$\1GEt$ hQ{#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhk{#j59tNjE|$tDD$@t:$t$PVh{#h'3]Vh{#h'3H $t+Et$h PV} 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh7{#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 75'3WVVjZguD$L$ L$$Vj|Vj1guD$L$ L$$VjSVjguD$L$ L$$Vj*VjfuD$L$ L$$Vjh |#51 5$5(5P 5t$,NFF FF |$WVj: y|$ujWj" WVj y|$ujWj WVj y|$ujWjʾ WVj趾 y|$ujWj螾 TWVj芾 y|$ujWjr (D$,WVj V  WVjB 0=2t"VxÃt C|/tS 5t}ǃtCPVWw 5D/h=5eh) j苻2HwN$&ʚt:h(|#0jq1 5e^_[]h{#jY0h{#覕-= =5u4!=2u2Ҧt5h|#jo{Vt$1@55H|#tm|#QP/5t P1=5tVU jfUSWVt$=05t38$/>3i=)‹1@?9 tR=45t3<$/>3i=)‹1@9 tR 851QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=05ujh=蠯 05#t\u#uGW蚣 tjxGj jWG ) />3i=)Ë 05,t 98t#@u $ja t!8h $1(Wh|#j9- h|#h|#j!-^_[]USWVP|$1N=45ujh=裮 45#t\u#uGWz tjxGj jWJ 賝 />3i=)Ë 45,t 98t#@u $jd t!8h $1(Wh2}#j<, hZ}#h|#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh~}#j+1H^_[]1j聣 ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj_S CS>tKt^?tYڃCKt6C;C C})VWh<~#j*S h}#C=85t$<5X Vh}#jW* 4Vh~#85<51Wh ~#j** S該 h_~#}VQh}#j*USWVPϊۉ$ts.311JDhu.e[YAuۉ4$蝗Åt>Vp,FN4A1R]113WZp1J 4$$&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=@5u*jh @5uh~#j1(1N^USWV @51Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj肟 Ël$EP d $$$KCs{ D$C $C1^_[]Ët$ h 3Po  1$$CHC1FwCE3X SO SD h~#j&1NwUSWV@5t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j芘 tx@ LHDhÁ#jY 1^_[]USWVL5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjx J1ɉHT$, $$$P HN HF F t$1 H;@u L5-T5P5P5-T5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@P5=T5l$T$s}ډD$0! umщjt[T5=P5 tIje t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  hۀ#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=X5u*jh=l X5uh#j1N^WVX5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$pYtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W hG#jj ^_[]USWV X51Kt$/>3i=)‹/uPV Džj$u tWWXtN$$QVQ4y8~V Q(y,~VIlNF \5F5\53Wh#!Wh#j V| Vh{#j ^_WV5\5t~1F\5=5u~ t v6蚫2 2tWWvvvv 6踫=2t v6ά6 V 5\5u^_jhÀ=`5u1WVL$T$t$ `511H<>u5Guu%P=d5t`511@^_V|$ |et$>t\jh]p#PT t 2=2t#h#j|j 21H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#Scu3h.t#WNu!2u9h5Džu91FWSh##Voh.t#h#hQ#V WSh#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD Shp5hl5   Phx5ht5  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQS^ 7X 1D$ereRPQ$^ ^_[USWV $ $Hw.$& e| Rh/#{=h5x1ۃd|RhM#Q1l$ hVU! $ jdPU$,] $$$Hrjtr$@ L$ D /f@ 0 wh#h΂#h#h#$F1 $F2 jdPV\ fF0 $j j0P< 5 5t45T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U距 $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0UI $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U؜ $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ hk#$%$ $LJ$m9rD$ )yQj0U苛 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh]p#WK t1H^_jh#WK u(=d5u|5u|5h#jjUSWVl$hUh1N\$1h$WSř K$ǃ4$Yt"Yh PQX Ǎ A/G<rH )Uhp5hl5o   Phx5ht5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$,&<2ǃ$)$Qgtxu%%-u~t6h{"VDžu'Ǝ0Ӡ PVh{#jH'31FUWht5Ë$rt$Vh#j$_Ft1N1'3t W<^_[]fVjhm"%xKhV"P諅5t)h{"V蔅51u;55وV &=5thm"hJ#j 1H1^WVPD$$|$t 5t$5 5t"=5th'3j 5'355h"W# 4$VW膷 Wj  ^_P5t$L$T$ $RQPX 55zeXSWV|$1N|55t,\$OPWS0 t;j S^1t^_[SWVPD$ $|$t 5|$t$5 5t"=5th\'3j 5'355h"S" 4$WS腶 ~VL Ph$R$h'3 h'3j f ^_[fUSWV} u7hl1#jq \$1hh$WV U LtPt߃95!3D$h#Oƀ8/hf#V肭ush{#Vpua$PV; tKD$Phe%$ t4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02V'h\'3:ch'3@uj臥h 9"jkH6Phj#h'3f j\USWV$$6hl1#j 1Ɉ 5 51Ch{#VU|S e~%q~3كrtރvt_x5ŃV.PtrكRtwftAi55뒃Wt6duq5z5l55W5I5;u!39|=5u 1Ĉ^_[] D$h| jy$D$,$ShB I9v9/u؃@]9v8/@tj/S8zt@À;.uCt<.u{t0\$u h #C\$5EHu]j$8u 5PSjj5a$8tӋD$t$ VW 5tRtD$W.!=5u8ts 8?ti8t_Whk$/Htj PWh" +D$@uD5u;Wh#ǽ5;;=5uWڀ=5utV/tD$%=@t/==5u uWWX 5 5х ˉ4=5u Ő=5t@jPt$ u h#7P5 u虆8V NjGHHf wO$&=5WOwP"{jWV+ GG \=5uWOwP:GHftIfgft9G =5u Pڗ PW}G  GwW5苅8=5uG ?tow [ PUh"X c=5uO1zuSwt)5t 8t18?t'8ut/whk$+5VS Dž6=5u =5t5wwh,%j/Bww x PVh"jAނPh+#h'3 j5USWV΀=5uLVh#h'3۩ h'3n\'3H '3'3H '301C=5l$$#E=jRЬ萃8D$Pu)=5uvVh#胹1Zh'3Ɖt9 t4'3H '3~'3H '3h'3Rƒ1ۃYÉ؃^_[]ÍD$x l1#td?%1Puɒ1Pu)VPWSD$Phچ#h'3~USWVAӉ΅:#K1jhV $ǍD$PWd.D$3CL$3 D$(3CL$$3K #D$ =D$W1PPPW@j D$$h PQ} KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWR D$L$D$)T$T$ 9D$t;$SV5Vhk$6()5Vhk$(W;1@e^_[]Wu1PPPW0i uh h$P| KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PWK D$L$D$)T$T$ 9D$t1W1PPPWh h j$PG| KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW D$L$D$)T$ T$9D$t1WKj1PPPWg Th j$P{ CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW ;D$t$$P$!Pa L$)L$L$L$ |$D$ hCW]|1PPPWf fCXK\D$L$ȃ|or \$9ËD$| S$PW 9D$)؋L$D$ظL$|W*1USWV\$l$UEtMƊAuA)k')5j)UXGG SEG5<5 5t^_[]Ã=5t^_[]USWV\$tKƊAuA)k')Ƌ,51Gt?uSntmt&uSnu45jVJ1^_[]ËD$t @ъ@uA)k')5WVt$ >tVG t|$u G?5wv wv Wv  5u=5t^_WVt$ 51<5t5VPs8uG'u 5t^_Ã=5t^_^USWV|$tWBuA)k')51t(l$sW@mtu tC uމ^_[]jt$ }t@1ËD$L$ pqlSWV5ƍ1P1 5tQ:t @ C'u9 5u=5tMh jVW5~R1ۋphd#E)p32HQPP$2Q C9uW^_[hR#?WV11 5t)5Q:ujPuFȋ G'uƉ^_USWVj_58H 5(11CEj=PKtAQUljUtGUhd#5(w22HQPP#2Q Uhn#52' ޡ5H 5(X1^_[]Vh6#stauj45t$1P ơ5H 5@u1^ÐWVP5`5.3DBuFv&ut t- X5]$&NF밉jWV` l5h5 v&jX5p51D>Gv&uGPh5WVPQ h58^|~u$PPhȇ#~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5`5^_ÊVF|uܹո ѹ Ǹ É)B$:@Bv&uVPQh#NfUSWV|$,t$(S=X5jLV Ht:xIuxNt@jLPj VG1tE@j PG)=X55\55`5"1,=d5uƉSϱ^_[]ù#V=d5)u ^5\5Qh#nWVl1#|$ |$wL2 P2 5>t'F 5Q5N@>vuڋ7 5Q5t躲 @뭅訲+L2@Pů505VrƉRPhk$Z# 1 ^_USWV8׉ˋ h5l5D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhL"jV軕jVt$ % USWV Ջ\$$St$$tƉ׃=d5%up1҉  ډD$$=d5&uU1ۉ D$h5 l5ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$,&  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVxbƉ׉^_[߹i#z#]#wSWVP=05p505Q(Ɖ=05=2ttxt>ua7&q1ۉSPV Z Ɖoq9u$8t*^q8u+$t@v& t$@u^_[ù#%USWVPՋ\$St$gƉ׃=d5uKh$h5 l5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաd5HwSjP ljաd5uND$h5 l5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THh5 l5N"ىWP1Eكra$"ى=d5#Éd5݅~hd5 h52É׃'1Hh5 l5NLىWP1 1h5 l5NىWPÉd5Lh5 l5NىWPe$É׍Eكwd5|$4t;~l-d5b1A1Ǎt$WShL"jVjV5h50't1I1@1l$QPhL"jUяjU6 ؉^_[]ù0#T"#JK#@USWV֋] $t$ơh5 l5L$ D$T$uPV֋=d5Ww,&8&}uPW ֋=d5ȃ}tً$VPt$ ֍Gw&;E Qȉe^_[]fUSWVf2$1hˈ#B=etuj50\$ht5VSfS%Ux%@PJát5)QPSF t5)١5pQ躅V1%PS$>jh #a#ƅu)hΈ# >-u~u5x5u5t5$>e%t<.u 1.D8t/ua$Phe%utGPVdt6$3D$$3 $ u$$3L$3D$ 1e^]Shh$軺t/hh$診u58Ltj58j75t5uj=t5522f`5t52HQPP2Q 522@u1[h#]0e0=w PhJ#Ch)#9SWVW!WP臀u2\$V迠d8"u6WWPUtV螟t5V胠^_[Åud0v Ph#jt5tjPh#l hU#fUSWVD$ 2fa1Ƀ|$‰tpыLhz#SV$th"SUu 1t$.4NJ]taM\uNEU\rw$l&\0u!11ЃwxAunjt$>2HQPP 2Q t$.PN    ȉš2HQPP 2Q<$t*2HQPP[ 2Q 52 2Hu 1^_[]ÁfHh#jf5u^L$ 5jPxV=5t 5K1550ppp VPjQ 955t =2ujV _VG`^jpPT$=5u 5D$ $1APV55t1It$aLVPL$T$ D$$PD$5jWVP|$t$D$$Aa4$ WWV׉Ρ\2t P29ty u hP2C =55uu_Ph"hd2P =5t55h"hd2/ t*t$ Whd26 x4h.4%hd2xVr Phk$hd2 2HQPP 2Q hd2o ^_SWV|$t$\$`SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$_4$w^WVt$ |$_WY^_PT$D$ $1IP>XËT$1It$)Vf&T$ L$9upu'0fuQh&j h55@^15555WV|$ |t|$wL2 P2 5>t'F 5Q5薜N@>vuڋ7 5Q5t j @515J+L2@Pgơ5PV 5^_USWV\$0t$,|$W505jVi j膶=<2thƉ؃$1t7=2u.D$0t f $uQVi=5u"Wj"=<2u11EiW賙u 5D$0u^_[]jUSWVL$,|$(206̓V$$&Uw1ۀ=2_=5Mjw1ۀ=21=5$=5jwH1ۀ=2=5=5uQ=85tjw1ۀ=2=5=5t  u8V胘1tu 51l=85t\UW_j\$0SWh a=85t0WD$,E=85tt$,WK_=85tt$,WE\$,SW=85tUW=85tUWyPh# hP2Ek=85tswww. 5@jw1=55 jwa=5t 51VVŖL$,=5t =v2t 5tu u^_[]PjUSWV@|$T55D$$w=.2tttn,5505P$Pqh#dGtj P52 KȅuhK#452l$jUgth5555j<$t&4$hR#52|$5\$X5-5j w7D$ 5u=5tSw555jB 5u=5t]<$t&4$'h\#52@^_[]j55蔫USWV\$;s3=.2{,5505POPh#stj V52 vh'#tu h6#b2HQPPZ2Q 52l$5ttu .|tF1ۃjU|Sl$SPi~ tuQV/|5Ju 5u=5tjs:UsV5 5u=5ttJ=.2tA{t;,5505PP(h:#52^_[]SWV|$5jw1=2t 555^_[Ë\$15u/? 5ut΅tSw555t"u85H 5K5jw=2tru+5H 551 1@655+USWV1=2t55|$0D$P`m[thUS- =5tiD$5,$\$4>G05=.2 ,5PQ Pghz"Zw O2HQPPG2Q=u2HQPP2Q 52juw I Sw55=2uZ5t"u*5H 595m"u5H 5 5 555D$P ^_[]USWV|$0t$V袏@O 05jPw+ _1=51{t'G05$pWXWuuޡ5[tZtT1=5uI=2u@l$41; u{C05Us t=5u =2tʋ-5-5V ^_[]USWV\$K1t@ 5PSwƋk1OuD$}t 1{PuV_y uR 5u=5t~ jW1|$x4$Ejt$jux W<$t$mE{t Vv1 V{5 5u=5tA^_[]Åx WoQ0|c Phd#USWV$$D$1t$ 5D$$5D$D5D$Ht$055$P55E05L$XIEtH1F\$Xljtw蔹uG05hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG05w.tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P8$D$XtH$r4$ ȅu$1ɉL$@=2t=5u|$ ~ $@D$@D$ )$=.2,5505PP$l$41dz=u)2HQPP2Q9}j=WT!Ɖt>u2HQPP2QFPpU 1Ո`1t$XtOË$t)2HQPPO2Qv É΅u$u t(PV52 مt ȋN΅uء2HQPP2Q 52W|$ +t$4~jhH&W u|$$ƅuf|$X" L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$6 fD$D$X" f=85t*fsD$= t= u ft$}u$D$@f%u D$5jUqD$,ED$D$tD$L$` =~2u f|$t$Ut$4$s t@5|$D$D$`t$d D$,F L$5=5tYD$t;=5u5=5t.t$`jt$hyL$D$Hs*|$^" toD$ t$,;u5.u D$ 1@t$,o5=5  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]5D$(55^<NjD$ 5 D$(5=55Y1PPWs O1ɅȉD$PPV5\$pf5D$ H5$5155 5L$( 5L$L5D$D$hPZ 5u=5t$jV.05D$ 55|$t&D$1f|$tH 55$5h t$8n5H 5=t$L$QPy 55t$9D$(5D$D5D$H5D$L5h5膚5t$pD$ 5|$Pt j 5u=5t=5u 155D$@z$jWۚ5D$ =5h!t$8H55t$Ut$8>oWt$Ut$8pD$ffD$0fD$8D$L$D$u#|22x22@L$D$5D$pSD$l5D$ 1D$T$PWՙt+5D$|$D$5=5D$$ 59t;D$=) t=6 u)5D$(15D$TL$$PQ t$u |$ uD$0ufD$D$451f|$ˆQPW$5$551@<<!3D$52f`4$t$T$$L$t5D$ 5w2P22d2|$Tt!D$(55D$tD$p5D$D$tFD$t D$f|$t$lQ5=5t|$^" t j|D$u2F x2)N2|$@tht$Dh"& $P^_[]hy#55t$1=5ȍPu =5u"D$4thB p;ȅu~55t$ t$,Pt$=5uS'h#h55t$p|$Pt jNt$hLD$(5D$D5D$H5D$L5D$ 5jP豖|C0 5u=5tVrU Ph#x5u5jA5t51AWVt$tr|$w$$&j Wv M $@Fvu;Ftj WP( $jpV ыF @v 빃^_V t$t8>u3Ft,p蓨tF 5QjRp ^SWVQ6t1OS jjP  t6X>F1"jjP tv-^^_[USWV|$41GGG =2l$0\$S}5AjUfjUPh uA5=5t 4$1CSt$WSU\$t$c$w 5u=5tS=}^_[]hy#VP5u1PPVPjh2xtF$P`{5t.1QQVPjh2Ct5@=PATH55@; 5 2 2^á5SVhl1#ޔ58uj1^[1ۈ22蠎55thB v655A 5SSQPV5á5ËD$ 55PËD$@5 5155Vt$ |$|v܉Ph#1@ 59~1Ҁ8cB5 51^WV155Vȓ590t\W'{50PjPH55555@5jw55JW {5^_USWV$5$j/Wt@D$PWwD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UV#uD$ %=`uVyjWS ƅuWh#j%Wh͋# Wh#L$5x 5V|$|D$ p 5555uu~9} ~ 55^11@1USWV4hl1#|$$WҕT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#52](14^_[]UWV׉΋ 5uj'k< 511D$ T$l$ X&D$ $,$<$\$ D$#D$b^?6u0uFjhQ$W %W{|80uHx.t x0@te^_]fUSWV|$7j/Vu#$jVP uaK$$WV4; Pu臻 1@Ɖ$m=5ud$$UVuG:;8t8+;8t.!;8 uPVt :Vvju$P OfSƒrtt~ 57PSCPVh"jSWVt$|$t$VWm e:t Y:^_[Ã|$u0xjWC6u55V!jUSWVPD$tnt$ t%1;t <:t9tGt$,89-P2}v,; L2t,WSQL$ L$ |9/u 1xAA/D$PL$Q;S5E9u,;E-5L$Et <:tEL$<:t1ED$(Qq $+ L2AQ:t^_[]USWV$1C1D$ 1D$D$D$\$h#nHw5$P&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 59A593t$$1CjWtV@wM$&|$t&|$ t4t=02x'@ |$u5H 58u5PVD$ PW9D$ft $|$t $|$tftjWt jP:4뇉4|$ÿ5/tPEȃw?$&|$u/|$ u&u |$tf<u t$Um묃`5r52,2$@th#]1@$$$$^_[]SWVt$55t5Hftfu9502| PF1 9p}Ëu̓`5r 5t^_[Ã=5t^_[USWV$G$$&o5EjWS PqM䃼$$twh;#Vhe#GPhk$`5wPQ_ 5u=5t ho#yD$Plhu#_/thS#Lh\#?GPhk$ t*2HQPP2Q*2HQPPV2Q ^_[]ÃPWhy#SWV|$tWȊ Bu%iC)ʾ!)!53tFWP&tc6|$tT5WCPnƉf@@ WPM 5u=5t u1`5^_[5`5Qg.  5u =56USWV$$$j/$`turfEE^59tth#V#Ut $j$q1Ʌt@@t`tm$umtisD$ P$豲xfE$K28282$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VmG5tAPh#{t$t-'55h#{t>/u19}-9j$$PM ƅvvD$ PV8x3D$(!D$ =u8=5$Nu$ 18t08t 0D$}o$E$\$|$$t$t'52jS\P$hB&VfEo$T$pƋ$$5|$ÍD$ uj$HfxT$ ufBuω7 5u=5t ׅt"G GfEG EG fEGE fEEĜ^_[]5T$ Éuj$fxE$ufBj 5tbiVC+L2PujVtij$t3fxu*SVm$=5V$h#SWVP&1t8|$&L$8u%tWP L$ t us^_[SWVP&1t3|$&L$8uWPh L$ t us^_[V&t%&jPf@NHu^V5 02trft fuxB =`5r^USWVP\$=51N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#wt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWV55>t+fuwW' ߉?u׃`5r 5t^_[Ã=5t^_[WV|$D$ 5jP+@ft*fu vfFGF GF GF 5t^_Ã=5t^_WV t$D$L$ 5fO 2fOPGWVU 5t ^_Ã=5t ^_jt$itfxup%1USWV t$811G$1D$h#<ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP5:KB5*#$1\$ D$4$߅u U@=&t,]&&8uUPujU*ƃ<$t0vh~#4$5H 5(t|h+#j vtuh9#vh~#*584$t2HQPP2Q l4$t%Uh~#PhI#+h# ,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$&D$j/UsjUR~1)0>; Ph":uhh#:Yuhk#Bu h#7t.Uh~#+5 t$|$tJHh#t$5H 5(ouh;^$V돡5D$ FjUD$PK P.dN<$ul1#|$tV#PhO#Sh~#t$ct$1 ^_[]hЌ##ctl1#RVh#Vh#1PPt$  5L2@PbUSWV|$D$\$=2td5H h5 L2 l5 P2 51ɉ p5 5H 05Sp5tH 5~l5l5dH l5l5+L2Pb55u%Vjap 55s5UVW5-555x=tE50va55΅u!Idl552V'55t O5G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t5t D$2 5D$l5+L2D$?~uЃtRWT$4$ D$1@D$ wy< 5H 5fl5e$!PVVoT$0/>u!y@u=D$ D$d5$5H 5Rl5Q=d5unl5+ L2;L$~[xuUHl5Q5H 5l55H 5l5$ |$D$5ЉD$$ 5H 5l5aT$,H l5>~=u|$ D$ RV"T$4| u055H 5~#l5%`T$,H l5 X~`T$,H l5$9Ut$ yT$4l5+L2jPHPT$8 !`T$,H l5>5H 5~l5 _T$,H l58 05_T$,H l505_T$,H l5$^_T$,H l5D$$ 4|$tu^_[]USWVt$,\$(=5t5t$D$ 2&j8\XNF5D$ p51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=555u(Q29PY5NQPS55 5 5u=5tP59t31Ʌt AuQP "u=57vA 56^_Vt$t"50v55΅u^V5p5t156P 5p5 5uۃ=5t莻15p5^USWVt$(PYl5+L2PXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 5Q5*[O@랃tPgY^_[]Ã=5u Z5L28t!P tx P!Yu$h #ljPXGËD$,tÊr&$< t< s4< w*5H 5~l5RZH l55H 5~l5(ZH l5Gw/u}/uEYP USWV,D$DD$L$@9A|$$D$t1v&‰T$D$D%D$ j=L$QD$pD$$L$(<$ L$ u:|$L$D$ PQV1ڋ\$L$ P5T$)11Gl5+L2D$D$<$u \$H l%t$l$UPRT$LQT$L$ t,1t}y;@ڋL$ ud5l5+L2=2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =5t1C L$@11ۃ9|$t$ |$Wt$T$RV; WqL$(/<$ }D$1|@uD$5H 5~ l5ՍQl5BWl5MPl5EK1ۋl$$]|$ D$EÊr&$< u.5H 5~l5 VT$H l55H 5~l5 VT$H l5]EuKl$ u% l5L2)l5 5\$\$L$ D$E< w.5H 5~l5 VT$H l55H 5~l5 UT$H l5]Eu1L$ }D$n $Ip$&|$t5H 5~Tl5R1G>L$u0L$ QV1>t5l5U7l5ۋ\$uh$U\$H l5=l5+=L2t$ t$(St$ WVdul5=L2l5)=5S1Gl5+L2t$PS  <$t[1@Ftuրut܋ h5 h5̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#d)Ѓ505h#F׊t!#u(HL$IQWP505h#D$ƃHQWP505h9#USWV5l5+L2D$5p5D$ t5D$$x5D$(|5D$,5D$h5-T2T2|$0WhQ+L2PjPD$ P$WWpQD$,|5D$(x5D$ L$$ t5p5D$5h5-T2D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 5u=5tJhWt$裫 yw8t5HD$EEt< uD$C낉$L$}1A95} nRL$ƅ~N$ 5 FK1:5H 5Q FK1Ƀ=5 R1ɉƋ$|$tr&$< t$< s< w 5F$ 5F5D$ x P身D$t P: D$tPi=5$u+L2jPt$$ 5l5 5u=5t˰^_[]USWV D$4L$@-l55L2l$)hP#D$5H 5~l5PH l5=L2UEWD$ PNl5+L2PM505W=ljӍD$ PNL2 l5l5) 5 5 iPl5SWhL"jPl5xt$GF9Iu|$"tjVU0 l5A l55)5D$ ^_[]SWVt$|$\$5t#9Xu 9p ux2j0L 5p555Xxp ^_[WV=5t$ 95x5~?=p55?P =p5 5u׃=5t赮p55t?9p|58P 58 5u=5tn 5u9q~)q$95t5~ 55p55x5^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`5H 5~l5WBH l55255l51l5^_[ÃЃ wj PV 8ű$<=tuw~;555b5D$55ØD$D$‰؃AD$$Z|$ T$L$T$|$,r&$< u*5H 5~l5AH l55H 5~$H $ l5Ql5 @l5 $Q$ Pl5$eØt2l5 $Q$ Pl5$eØt2H l55H 5~$H $ l5Ql5 1>l5 $Q$ Pl5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G5P5=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡌ59tH9u W%8/t Fe%Q4D$;55tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWV55=5tt$tWE/Q 5߀xruX@8tB@9tD$P55X}x55,Ą^_[]ËD$1Ʌt AuQPFWV|$ W޵@P7WPHj7p 55^_USWV\$D$|nOʼnmIWP)|$SUÉpsx 7u߅u҉3D$^_[]SWVt$(\$$W7C h5L2l5P255js5H 5~l5k9H l5l5+L2P{6jVP W7^_[USWVt$FPhn1#2HQPP謥2|$Q1ۃ|11E4E9uSht#衩2HQPPR2Q|=1C4轤2HQPP2QC9u1^_[]h^#rh^#h5H 5~5H 5#=~u5H 5USWVP82H 5t+u y5H 5~xhP2Ӥhd2Ƥ 5182~PX5hSps {e?8t_82xL&8#>WjW !PjjӐ  h#n82p582@1ҋ5  5@@P t 1+5582{tXAˋ-5M 5~ @لt5أ5=2t$55D$訢52JD$5H 50~^_[]ø55155h#USWV=82w 5^t)kUհ~D(< t< u <2Hc F5F5F 5G $9t V  5t^_[]Ã=5t^_[]V 51~^Ë82r t ~6u1@1z5 5SWV\$t$|$5 82y tje1 82I  82A$A 5H 5H 5H XtK =555 5t^_[Ã=5t^_[WV$5jW葍ƍD$PVuT#D$ =uD1PPPVW u2jPV u <$ELF1PPPV% uZVI9t:$Ph 5u=5tCĀ^_Wh#蟓V豍h#茓V融Whʎ#xV芍Wh#dVt$5hn V?jjV |$ t82H~Q=82pxuh/ 82A15542 5t^Ã=5t^Z82tL$T$9PuHuá5 82A 5A5A42Aj8/ 82@1ɉH H$H82WVt$|$ 5|$t=5WJ55542 5t^_Ã=5t^_锑V5825Fx PFtP ~ u82Vf 82H 5H 5H 5@42 5t^Ã=5t^ 82Vt$ 829t5tPu^h#B=825t-Ã|$t=825u5~P#82@fWV|$ 9=5=5@2t Pډjhm"@2MP@2hr Pu5@2N5B׌9t jj:1VjƕVj軕Vj谕蟌 59tQj15P5@2p0 hF 59tQjD5P5@25@2襈@21VjVjVjܔ=5@1VtVs@2Fuh0#肛2^_0 hPh#0 h0 hPh^#蹎@2;D$u D$@2hl1# E5SWV=5jQEƋPhk$|-1GPhA $؞G;|ۡ2HQPPz2Q 臝5@2OtJ5V[V 5u=5t/^_[h#菍h#腍X0e hPh#fVt$ hl1#C^USWVhl1#C=551FjPlj+5i5rO@QPh܏#艝 |,PhA $cE;|ۡ2HQPP2Q W58tH 5@(1^_[]h#;h#1USWV\$n;%u(sV8V08Hݐ#KSw8ݐ#dS8 5M55At#~i9:0#I {5ݐ#4$D$D$=5C1tQ~H$8?uEt$PuUt$ 7t ݐ#tlݐ#K\$ueZ*t%tS-tU+E#D2x+;5}#55it  #\$1|$ t5^_[]áD2t 5i#뚽#SU2USWV5)i5rO=D29u=D2)5~9ut Ku ]t]tu`ǁTtCiu3itit0 5D2^_[]SWVt$5~X1tttG9uމjQu19}q~5@tu ƆH 5t^_[Ã=5t^_[+55i5rO@Ph#g+55i5rO@Ph$#LP2 Ph #8WV11FhF#>kt!Zu忀ރlt puԉпɁu5tg8tbPhk$OFm=2u =2u@5tA52jPvW:5H 5@ujEW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh\"W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thS"jD$P ] 5)i5rOC-D2+9tti-;)t RPhڑ#jl$ U蝖\$D$Pנ$t+,D$0h#jShS\$覠ŋCt:tBuM ,%Ph#jQD,ingD,Runn}=tQ( l$ ,j SP0 D$xxl$ ?S l$ ō,@)QPh#0 hE%jQ芕 ݍ,PğWD$P赐݃FD$ ݋\$GHO WH EuݍCWPj$u/1M|t؁PhA $Wx N1MM|FGHO WzH GHOl$  WVH|1GHO W2H ~T$KW衐D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@2D9t%5@25PVn$=5~y\$t$1=5tEt*t t.<$u u/S0=5u WE;-5| $^_[],09 hjPh#:USWVD$4\$,tl$0|$WUS ƃu8=5t555D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o5D$ 5$iD$ 9T$tcu tQ=5t 1=2uL$,uP9tPtu 2P 5u=5t^_[]Vt$59tPx džƆ1z 5t^Ã=5t^#WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hJ#W5t$ntpu5D$D$D$t 58D$t(1PPS IjS!A=5u|$ 15-5~6@ 5D$u}t!AH Et1jPƅt=u ED$u >u G t$Eu5t Dt111D$uD$5L$L$t$D$\$l$|$ 5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$5C$jU9 L$tc|$tNuJD$1rȋi4hn1#jD$(Pl$D$D$L$D$u UD$\$l$t0~Ot)D$5y\$l$D$tUD$tMjPSx ?jVDžtjuSW =2u V| hŃ퀉0^_[]hN#A{Shk#6{Sh#+{USWVP1$1C11h#~1it"gu$ڃjt puЉ̉( 5t yjPƅt,1t5)i5rO@Phא#4H$t#tH~1i0 tPh\"11G^_[]Ã~1i4h5#蹊2HQP~G ;| Z %PRG ;| 2Z;|lh#yh#yV1=5ujt$ Ot1+^V1=5t. 5~$A51F:uI}^V=2tO=5tFD$t+ 5i5rOA1ɋ2u0VQh#R.^USWV=5u655~%=5Ft WN5l$5~"55HI}5tfiPƋ-5=5iPUV ~ ;uKuU l$hnƋ=555i 1҉AJw)׉=5 5u=5tw5fdž=2151B|iP 5u=5tv^_[]SWV\$|$Awƅtt.VSt$W\$<$D$ #^_[0 Ph$#vUSWV|$ 5tW`W4~*1555d5V:V~55l$t$t%t =2ttttk0hWjWjt uumul1VpVh-#%otOh-#%h#uVj=uV5@2ytTWj{Wj{t*=2t!WjzWjzWjzu5^_[]0& h|Ph#'uUSWVt$ l$|$1ۃ=5t/t*=2t!ttSVhu5<2tEL$ji4DDt QP ^_[]WVD$t$ N 5=2u=22t=5jP=5~5>f@..@.^_WVt$ p5NJujVj 瀾tW5@2Nw<u%+5i5rO9D2t ijVt=tu  ρπtt=ttu j{u VG 5u=5tr^_0 hPh#rSVD$L$ =2t1ۅ SPj= ^[Ët$1҅tހu1=5u25u) 5~5:tzt Iuh5#~51@SWVt$$1@=5|$(1@$"$&Wh#bjvu h|#hd?%tjjvjv 1~ h7#21@^tjs%;thZ#ht$jvhݙ%1WvhM#1WvhR#Wvh^#jvu h|#xh #kjvm~ t+u h|#Ghb#:jv <u h|#hi#m#Rjvu h|#hu#7hz"v h1#jvht#jvu h|#h9%%;hz#kFp]h1#P~tF1SwJh #.Sw 1> #t#P uh#h$vh#v#'1#1###1#N9tQhn1#jWWSxuF x%Phn1#jVVjv S h#51^_[hW#hW#jvUSWV fD$ 5 5l$ 1D$U$u1!" $&]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ ‘# tƑ#,$$׃߻@&!$}D$ɑ#ϑ#} uב#$ݙ%)4$<$zT$tvӃux<&t ur>u<&_pE~FЃ r󿯑# ,$t#\$҉Ӄ9uG8,$"2D$1&<&:&$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I 55 ^_[]WVt$ tG|$t jV~t'hd?%hd?%jVvu^_USWV$t 5 =5D$P 5t 55 $=5z1jh &S$ `P>;Hx@u8/UD$PVLx D$pL$t 1D$tD$p1ɋ 5955tH1 8t:tGt89=P2Z 9=P2~55L2WPVd >?#<=5 V莅: fiDle cDhangD ged߉Vv2HQPPv2Q D$pL$t 55E;-51-5D$PĔ^_[];fUSWV<1UjD$hhh UPja ɚ9u ׭9ÈX5j U$c \5jx``5hl1#U h#h2,$Uhd5t$T|$P5d5,z55t.fD$PVWVW(=X5 Àu@{=2n$h-#5ttQu 5 5<$B=25=5(ȃu6Qy555$5uk=5u72HQPPBt2Q hd2tD$P5=5tg$$=X5u>h #~ &t1Ph:#QPP[V$=2u2 X5t N=X5uEt$(VhD# t8t$PBTPV$05=2t =5tjp&luD$P5u/jM=2tFh?"rhd2Ss*1ɀ=2ˆQPi=2u=5t420555_p$$#uSWVD$8t^5jP^ƅx jVK 5u=5t&ex"1=2t=.2t.21G ^_[11=2t 21jLV3V:=2tt.2u2^_[ USWV|$(V11C=5tCn1=2u4t0j52qjhd2q2P =<2t.te=2u\1Ƀ=5 5jPi1;tW1R=2uIu=2t7=2t.hH#pEVu%$uDV#^_[]Vt$5jV']x1jP| 5u=5tWcj^Vh#ct1Ã|$|D$pPmmft$虯 the#act$t$f the#BcWV|$ WN~@PR tWP^_he# cSWV|$P29~b95؃P tr H2 L2P2H2 5u=5t 'bP255L2>L2)P2 5u=5ta^_[he#ObD$t L2) P2L2j hr#jY D$ H2 L2H P2H 5H 5H5ËD$5H 5P 5u =5FaVt$5H2;t H2P< FL2FP2F 5 5t^Ã=5t^`USWVP2<k5-L25H25t|F9uuH2PV(  H2H2+ P2 5L2=P25tG90uC H2 L2H+HH x@WSUPi 5L2=P2 5t^_[]Ã=5t^_[]`he#i`D$5L2)P2 5u =5_V5P2T2x'|V5L2Po N555L2P255L2^V5P2+55sP2)55L2^ËD$ L2) P2 P2L2+D$ȣ5USWV(L$@D$D$@t-΍i11PzwDGÉ,$Eu1ۋD$"S t Ѓ s^_[S'1ɅfVt$ |$F5(2Ɓ62u2j5 5u 2 =2=2u't#j蓖tj腖t22<u=2u 2=2u25=2ut 8-u2(62u 726272uހ=25u:u655H 55jP#555 5t/t_9tZA55Qt 55ȣ558t 5Ax@u5 5^{h-#QUSWVt$5H 5-t+C11C<-t1Eu{-1Eb USWV1\$@<uPƋtPEu1ۉ]h55=5555^_[]SWVP\$t$t2uh"%VJ1C$"hu#^Z.4%(02u*62S#42RQPh#^I#uȡ2HQPPtZ2Q (02t"62#tF>"QPh#h^ u.$(02tPVYtuS#VPh#rM<$u#52t(852uƁ62u숟62h#1 _2t$]2t(852uƆ62u ^2@uă^_[V(D$ T$429tuS#RPhÕ#FLt#52t(852uƆ62u숁62^WVt$ ~t)~tP袨 uv莨 ^_USWV jA 5t_y 8-uUD$$515P  5y8-@P1F Pơ5)55=5~-5Ft7ɧ 51Nࡼ51ɋu5 5=5[J1F55P)ƅ599St5 55lj4$މt$\$)1*C/559rL$ 9v!\$ۋ4$ P; 5w4$ 9vQ9w5 5u=5t[IWv1 ^_[]h#Ihו#Ih#Ih#ISWVT$ 5tstm8u'1z:trrD8uAÀ~:u"9u 5Q5 tf 51ɉ 5D55>1t6?-u1t+O^5-uta551^_[PhZ#HPhm#H|$u1PjPPge5jw58t PI 5u=5tG1ËD$Ѓ w#j jPR u55ËL$~ND$tH  5=5u 555h5h5Qpph#GUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhl1#h!#Y J|$:uUD$8@?jPh!#Y ^jUh!#Y 1|$D$0)@<Ph(#hd2V jh!#f1?\$D$01@11T$4*l$Phn1#j UVhUhS#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph<#K1L$0L$4@Uj EfVD$ <21qqA1Ʌ 50PQ<2p ]t u 1%<2<2@j* <2 u^qqhI#EPD$5/$aQXUSWV'ơ<2@tu'tƃ <2 x,$@D$t.$x*Z$18uWPKtG&uD$tKjD$p*t6NjpV`_WPV4 E$ht<2@^_[]USWV<2@|$u <2A1p811+ǃu<Hs C)uj X@Åt"j jtMHXE pXƉōGs1Gt,u|$uq<2@@|$Fu6|$uD<2@ <2Ap8 u踭|$u<2@^_[]jjX <2ASWVƻt u j cpxʡ<2@^_[USWV<2kE1͋ <2x t*5,PqN<2@ C1Ƀ8Qs s j@<2HOH O oKy K9t?U1CSp< &Shp&P= <2HO@ G e<2!^_[]WV@t$P <2A uyWM\ wWhK#4&h~#j"Q Whc#j"PQW \uL$Lx4&h#Vh#jPQWUSWV<2@1u 1=2tMtݡ<2@xuUj Y@j@ÉGpj,aC+t<2@tj(pƉ^_[]h{#<2t$p0h#?USWV<2@$ u<2@$EŃCߡ<2@$,&$ <2APUj 6á<21Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjBljF j0G5jGt<2xJjG B u0<2x,u%@v&t@/@v&uh#jÀ=2tjjj` <2H0+H8O U <2p0j*@ <2QPI H pGu5<2~ h&h%v覐m|$F<2xujD$ <2Hu <2H L$ qx0j\@<2HKH K {@;u.<2x }<2x|$ T@0GjG <2@t(HS u <2@<2x\$\$jy <2HK @0Cku<2x ux,uh&h%pj@@21ɉH H <2Q0PCAHrAAtejC9t jW\G @:<2@ u<2@$EŃ!ߡ<2@E<$t!t;tj <XÉ{؃^_[]/ uS\$|$<2X0jx@ <2QPI H X t\$|$D$C <2APsVL <2jj 5jj,jj#jj jjh&h%jjjjWV<2x$G Hs<2jpW$ uq<2p(x,u~ <2At8 u @A8 @tHA~րxru\tuՀh#<2p0+p8j@ <2QPI H pG .P"t<2@F <2t1^_jjVt$&9u^jVVL$1v&tA1B1t Av&u^uVt$j@ <2QPI H p^USWV |$$tD$ D$$D$l$E1$<2xc <2x0$t $j(ƃF <2QVI N ~ut. <2Iv&tAt=t Av&u1c<2H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 <2A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j<2 $+H8N~L$NL$$N @0FEPqj/viuG42 <2+A8FF<2@4 ^_[]jjjjh×#L$1v&tAt=t Av&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;`5}X;\5~P\5I;-u{tBuG<2x0+x8j@ <2QPI H xF^_[F h՗#lUSWV|$42D$̛=u ?vl$$5L2P25G$|$ t u 菛 t19uDp $ tC9u?,$ u42<2HH }AMt9t u>u:<$ t=uY$)jWPX |$l$$uS\uN5H 5\FÚ u%5H 5 F42#á5H 5ƈF tq=v42W=t hD& u42<2HH 5H 5>=L2)FV<2x42+D$^_[]USWV$$1҉T$ T$$D$(542<2r0=p&t1$|$ fw|$1/fFn D$j8fNL2 P2 5=t&u ƒ=5‹nD>  $&=n&u f|>z 542Bס<2=n&Xf|>LCD>fT$ 豘T!uhЃo茘0N,s05,/L>=r&fu 5Bn׍MN|$ @01fD T.fTT.fTT.fTDr&fD1AL$!(ljƒ(M 5FD 5BvNO|$?@81ɃfD T7fTDt&DfDfD>  = 5\G'T$ t$>Hff 5T$ Bf|>D>u6t${ nMn 5}f|>  5BFfL D$$D$f|>tD>t 5Bf|>u D>v 5BW 5B*Ã{t v& 5}E+=L2 5E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $* nMnD.=n&u 5 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDp&fD 5T$ B1AL$ I) NjFfL 5B) 42<2@8xt 5 5$8W Nf|F\=`4" $"}f|  5T$ BFu6$p Ft$HFu蘖D$$D$ Poſ1۹$&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDp&fDu6t $] FHF 5B}= t]\t 'u t =u 42<21Ƀxɉ 5$6 5T$ 'uF|n& 5F$Ҕr&$< u 5T$ BT$ 5 c蒔,t$@  42<2xD5?v&L$ .3DAD$D$ |$}~r&f|t 5 5B\r& u 5BNf|t 5B1@D$ 5 5B݉ý {"XŃ', D$0$ nt$T$ Mn 5B1@D$t$C5$4#U 蔏` Ń< ?\uj\ 0 \$1 HЃ w&Hw ÃHÃéOu M 5vNO|$}@81BfD T7fTT7fTT7fTDr&fD荑L$ uk%=I =5 D$ wF 5P?ˀ 5@ww 5 x?ɀtw 5@ 5W?ˀul 5GXT$ W 5x ?ʀtw 5E 5O?ʀ 5Gw7 5x?ʀtw 5E 5O ?ʀtw 5G 5A?ʀtw 5A 5H?ˀ)*55D$D$$5 1zv&t.5H 5LjGq v&u\KЃ w45H 5}LjG; ÃЃ D$ u t 5׃Z 5H 5)=Gt/ up}tk5J 5#@ǽh#tE%t@Ń:bD$D$$c&^¸U1#,W9u袍1|$Nf|uf|t Ms@ L29T$ vNK؃|$ؾ@11fT T3fTT3|3|t3ft1BfTft|n&fq fq ƋT$ 5H 5~5H 5 袉ËFD\$D$$c&]Q1c&)G 5x?ʀtw 5E 5O?ʀtw 5G 5A ?ʀtw 5A 5H?ʀtw 5@ 5A?ˀa2 5AD$ ??5H 5~2G:5H 5~$_1cݿ:B ˿ˆB1=n&nD=t&G=n&tf|cf|.35H 5Z5L2Gf|uNT$ ؃t 4$t$:ŀ>ts4$flT$ )B<2L$H,L$H $衾<2pM tΉ${ Nu<2xĨ^_[]1HE;`5} ;\5~\5>uxkjy1$&tu>tyu6EBE9E0E"EEEA }<2h$ Ή$Zz Nu=tuS$#$#42 <2A0$?#u$$#b$m#V$R#J$##>$:#2V <2xt@@ ^Ãx t#5$@)<2@ @8 42H05H 5~5H 50sƃ~0:=F $H& t=uG럃F~t\u^׃ 42@42 <2A0yt5 K5$S(*;|u0d|<2@=t*蒆4$D$D$n&Kuۡ<2@1v u42<2HH @1@Q&<2@-<2@<2@&tQ;ub<2@ 軅<2@蠅<2@<2@ o<2@u\u? u642<2@81Ƀxɉ 5P& jjh@" 颁Vȋ <2y8~0 5Q5謹@ <2Q8rq8^USWV\ӉΡ<2@D$ 1,$5D$&+L2D$$UPD5$~Sʼn$S5L2PU l$|$tD$$5 5u=5tw42D$-L2P25<2x t*5PL%<2@ hǃ[~!\u9Wǃ[C tJ$Q u"42<2HH s`un=ub\tX`tS42 <2QQ NDt""u$5H 5~E\E \@ŋ 5A5ȷ@5H 5襷EL2@|$t~P贴t$jPU D$pŋȅut$ j艴E<2xtH@1D$42D$jNǡ42D$Kt5 <2At$ D$AEx<2@t$ Ex P29ًl$脵 P29~=L25t1SUWR )55UPs $ 5t\$=5\$t  <2T$ Q5Nf|u%Du 5Q5@Vt$+t$ 5Q5ܵ@~.F5B5ȅ踵AJ։ȃՃ\^_[]á<2L$H0h#WF<$t 4$Qr /<2@D$5jPjj#jjVtQ r N^V <2l1#ytA55t7t u(5h5542P55Ƙ#^USWVt$,|$0l$UDz5P2̱1BW;L2u(V/G59w&5WVS`P U覲^_[]Áw: t9v$P55hk tã5$5랾ޘ#뤾#USWVT$L$ -5蚂Ɗ.25D$1|$0<2D$|$ljWtJD$<2.2VQ-5D$55l1#jU\$t$l$=51F55D$0<2$V\$S zVhp&P <2A |$t|$t=2u #@݅u:T$1rIJ$JB .2VVRM -L2=<2D$.2t$OD$5D$5؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV $51t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 5tu(Mxju PQ.Ex P U|n uF^_[]USWVl$ t$\$|$t|h@VSF VSFDžt9u 9t S 9u95H2}5H2^_[]Åy(s05 PVSh!#9WK WVSh;##USWVt$ |$\$l$j茭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!j8@ $5$$5M|$];`5};\5~\5Eu9] u(5tX9X5$5t-pt 9^t6SLF9t S4  (51tF9Yt? $5tHt 9Y jjS  PkD$($@t 9XjSK 1x5 5  b 5 \59|AQjS  ǃt;=H2~=H2x jjW j詫$JBXxp 5|$u=5tu5t$(WUN mCp1O ntuK5 5jST DžDbp8t Xp8ujjS) Dž7p0D PShi#I\$t 2x2|$t 2x2^_[]j  PShf#o0 (51tT$9Qt uÉVt$5 5j V u 5|Qj Vg u8FPj VS u$j j VA ujj V/ t;H2~H2^hp#V WV|$ t;G; 5|.GPSƋG9tVPWw/w^_WV L2 A L21F |71FPWW y w;H2~H2Pgfff   5^_USWV$$$~5 8k$l&n  (5t9i V $5tQt 9j b Y<(O8=2tNnjUƍD$PV-P#D$ =nhh]n$SUoƅtjV!SjV $/nhh nhh UA ƅV;5H2~5H2|'u" 29uu-jjW 9t1jPWV 5uQ=5tH A1jPWUy v Cl0P~ PWVPWn 5t Ā^_[]Ã=5tĀ^_[] hh j } PWUh# k0} PWh# Jh1F55kV0S PUh{# k8Vk85okj0 PUh # USWVP8?xa|$\$;H2~H2oUb$= VUS 1jSS t!t$.$^_[]hy#4$1EUjgUjgUUgUjgSj gVwt$ g S,iVD$5$55PV]$5V%e  5t^Ã=5t^1=5SWV5$5t4|$t^tCx PBjV6u^_[SWV|$ H29|ȋt$|9}9| H29tVjjVW 9u^_[iWS{ PVhW#WV 5 |;`5| p 5t$ Pj V$ y28i8t .i8u> 5 jjV ;H2~=H29t V1^_Vj 苣tL$ T$5(50(5PH^á(5tT$(59Pt uP^c USWV$|$<\$81D$ $D$1F5<<5!3h#WS1 !1tbhH$WRh#WRuo1<85tE5485_[ 85t jV 5u=5tF@u85>h[#W Rth<"WRt D$1p@|MD$K}h%WQt8D$D$h# j521CKD$D$u}h# v11 t=t8<85u.u h#v VaPh4%  GF@uh?"A F@uu=85tk1uu莩ND$E11P@É|$t<85tW485h~#Ah#<85t485 h#{SfPh2@# Eluh#52 Cu|$tE1F-5D$t P贘1<85D$t485~X D$85t jS< 5u=5t2Et h?"11<85t:858u.u h#aVLPh4%   GF@uh?"/F@ut h?"1<85t?858t3h#485VPh2@#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=85t61B=5tbu^1Ƀ~7t@tuH1=24 85t1Ҁ9ƒ (u1=2B1ɉσu1B<51t)9t`tbփub1^։PjSZ $u=2d1@ָ: PSYXt^u<5u jS1D$ D$D$$K?r Z 1@ jPj ^_[À=2u=5u =2=21@V585>t8t61U 85r85 5t^Ã=5t^SWVt$u 851ۃÿ85t6858t+5SP 5u=5t<5=85ru^_[,^_[V1=85u#851A:t2>u 85r^WV|$ kY085u"t$=5tg=|5u^5WuS =@5tӃ<85t>858t2t-55=2tu=5uX0^_WV|$t$ <5uWVj<5<rjVUuƆ<5^_á5=85t1Åt8uUSWV|51G5<5u@@uu5=85u΋485tã5ST-5VjPVR !t<$tS--5m |5^_[]ù@rA<|5tøWVt$ 955t)1Wj;Wj0Wj%55^_ËD$55USWVhD$=5u5)=|5t5t D$D$555=5tt$,jVԩu 55et$,jV趩u455=85u%=85t?t185PWt5jVmu55Bjc|$wfs 55U1ۍD$X XXPj&SW^S\$\$ \$\$O?r V1@ DD$jPj* BVP{uf52t$WVt$|$ ?t*FHN V>Qu952u V^_52t$WVt$ Nfu5FNtF t0fu^~5 ?NQPޏF N)N5v衏F FF 5u=5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'Vm&t~th#V <k>t!hD&VȪ1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVhD&Q j'Vo$t)19<>^_hP2ohd2bUSWVD$~@|$l$1SWU t Q8tF r)~1H^_[]ËD$)D$5\2tP{L 1\2T2 5u =5>PD$L$ T$$RQP XVPt$t$V tt$ P4$ L ^hœ#QPD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+05+5Pqq hA#jh5ur5SWVP5&C PVw u,$$w$CGσCGCuhl5Vhb#8 u*$ `5`5d5h5^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUvs t61^_[]ËD$t8SV pƋd5`uh5$I d5m#tf#$đ#t9%h5㟉d5t$D$$;# ^[WV<551$|$PW艡t $D$PL$LT$H=5PQR 55$<^_USWVL$T$tHtA|$9t91v&Írjt/9t+1v&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UVcƋ $A$~ C@ $Q$f=t @UP=gWVp ^_[]SVht#WV<555$|$jWu"D$LL$H=55PQ55$5<^_USWVD$ èu|$=^2uÍD$PQW Ƌ@5Nt$݁ uF @SPуF`u vAG F~tuF1Ɏ! s%t É^~5t5u5t jK~ 5uk=5tb[r2jXxL$H @ $  $#`uWnF `u W^F fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=5u0@=5tc@=5tf@=2ti@=2tl@=X5tp@=2ts@jPh#,WVt$|$ 5tw蝅VP? 5t^_Ã=5t^_CWVt$ t|$Wv 6u^_USWVP\$5jƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR賄SP}j=SS苄UPu< ؉G@582582hX2PM# ~ F1gjt$L5uQG L$<=u55H52UjS $81F FF5L5~555 5u=5tw^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ 5t8Q12<08uF=u =ut j=R@F^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVt51tr:1҃Љu5r׍P节ƻt5Nj+t7Mȃu%EttUЃuEmŃ5r^_[]SWVt5>tLGu% uwA Gu#WA @tw詁Gg;u5r^_[2SWV|$tfh#WW9uWhk$V't*tUj'Wkt8)WPhʝ# hǝ# Gh #Wh=%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh&$tUh&$>=uD2HQP~ j( P 2j)n~=uGuth#EU2HQPP2Q ^_[]USWVP5u5 h5T$ t$\$t51<$?tIOt !T$ ttуt݋ 59|QPYT$(5%5)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPI1>?f u%PV軽1u%#L$1PV1t1Ʌȃ|^_1@Ow$D&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$] t$19{USWVӉϋu85fx@$&$PW蛻1ۅD$PV胻r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW̺1ۅD$PV贺$L$$t$<|$@11$;D$D9t$ aZ$PWU1ۅBD$PV=,$3D$ $3L$ $$3L$3D$1 dVW+1ۅTVW+1ۅfVW+VW+1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]5Q9-u1tQyt8ytBÄthǞ#Q*&t1h%* jjh&Qh%* jjh&h8* jj h&RoTËD$L$  )VL$D$ 2)u AJ)^USWVPK8j PVj lj.88t"$8ځ8"u 11E9s:$9t( .3@DQ@uuN9t ڃ^_[]Vh۞#Vhʞ#USWV׉5Yt 9Fup  ^^ 9uM1PP+~ōP rPU~ LH;NuS 2 #~^_[]ÐUSWVt$(hl1#jH D$,^H $x?-Ok-u)sstdluu~xwGW裐Åu".3DHt'1Ʌ Sґكh#h.3DH\ƃ~ƀtVUtV觑Vh#jރ $ha7&S'1Ʌt:S衏u+$891V52V|-$K$8ʉT$h%W9'1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.d%|" $4Pho% 1@D$l$t jWD4j D$PU ljӋD$9t-ف8ur1u M48tQ"xl1#UPhL# 1@D$\$ $4h'#1@D$F \$ t$|Ph~#jg5PPPPh#522jDWVPΉj WQ- 9u=у|=}^_Vh6#jhQhc#j52jWV@5555PK=>t)j=WthW>uPhn1#j@VTjVh[# Vh2hb" #VWhS# Tđ#t9%VQh;# j,h`#hh#q VWh#bL^_L=5t 155?<2515559$5tj=$5u2P22d22tP, 2Vjҵ155><25595X2t`2@8@u jR5jD|5uƀ|5@u 5u=5t^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$h&$&Vw vVw d_ t"Vst Vw?wN@F1Vw q#w qN@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uh&E$&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t( Ã|$( USWVPu }<5@52f`|j%vm O1@ 0D5D$,H5|$@t$(q%v>%L$ h#V<*u C h4#S؃1N .u{*u{ 1HD$Ch4#S褃1HD$  t$CD$'C`L$&~QF0 $&. D$׋L$ jj D$tfL$tjWt$QPh`5TFu$&D5l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph`5,D5L$ Q0m|$D5H D5T$ l$=@5uM|$L$ jL D$tbL$l$tf|$ L$D$$`5bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$`5L$\$L$$X8GD50D5E ƋL$ cjl |$D$VPt$wD5D5D5D51  D5 D5Wt$*|$$`5 \$$5\5t P$ V2P0 \5҉D$xF\$wZ$&a=&t1"u@"*\\t#'u0'btnv fre\qFuZ.3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V5L5T$t P# T$L5P5t Pw# T$15P55T5Љ\$H\tF5T5X])P0tXM\$u/^t-u#F5T5벸^tic\$>T$ j5T5F5T5{ .31:DYt 7GuF5T5\$DF5T5ȋ\$+1L$ jlD$t1L$t5WQg5L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h`5 PRQt$QP  =5FP& P5 VjxP" 7sP5T$t t$L$ t PVRQhL5蚀MT$L$ t1PRQhL5{.VWh`51PQ*t$P PQhL5K tL5X5T$z \trB<]*<0tu$d& ?$8&."'#Eu uSh# <5 4$.3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hؠ#l<5\),ҋ4$u|$ uWh#<<5 ^_[]WVPD50tpD5!1ɉQPVgQ Nj .3#DQt$cˡ#r& D5+ H5VQP <51^_SVˡX5H X5 u:2Prp~r0 P{2Q 밅uX5)2HQPPD2Q^[SWVPD50t"D5<'t<"u1B^_[11fQ 1ɉQPV lj+t:<-t6 .3DAu)D5+H5VPhK# <5 $ڃ^_[SWVӉQǃArVh<#A<5GPVh`5 D$]5^5Ƈ_5^_[USWVP׉1PPP螂 ,>U@PUQ肂 x$tG9tCD5+H5VPh_#調D5+H5VPhT#L <5$^_[]WV9t"΀:t9D5+H59t\VPh_#ZD5+H5Ph#/D8"uD=D5+=H5j"0 PVWh<#RPh# <5^_USWV\$$8l$}hE j jh&U:ƅu!hE j jh&U9ƅH h]SuD$L$01ÐWV|$ ww 7wh]#E@&t%&NLQPh# @  uWWSPVh#? ^_USWVj:t$$@L$h&D$PKƀ8j=VMGPh#W~ k^cih.7"V +h%V Ph5#W( $L$A$ltkou|hA7"V hR%V{ uTPh5#W $L$A(h#VI u"$L$Axh#V+ &&:uPV t E ujEuPh5#WE E $T$L}t8|$Y#$L$$L$A܋$L$A Ѓ^_[]É1u hϣ#jQh#jfSWV t$ \$81?-uGF(8hH j jh&P6t0Hu~(u+t QIN4tVP1@1 ^_[Wh#Wh#O4D$L$01 VD$H8PdpjVp$RQ^ËD$x(t2#H@KH@@8+$@#HDHD@<H8"H<#HDɀHD@,ËD$#H@KH@@8+$@#HDHD@<@,Vt$v4'fFfF0^ËD$@K@M@PHDᜃCHD`9@,VD$H8PdpjVp$RQ^Vt$~(t D$Ph`t6 F,^SWV\$1PPh$謯 x ƍC8j,PVW VlyTj^P}C8uC,Ph#h'3\. jR#fUSWV$$3dhl1#j 51ɀxo 5$1E1D$ D$D$D$D$D$jh2h#SVQ~e~/ftOhtdvl$ǃK!tTHu]1,$뱃Rt&l$dt`LtPuV$1댉l$놉l$ $rl$iD<D$[u!3)t u |$ul$ u1Ƀ|$!<$t|$g41H55|$uσ=5u0uˍD$PW谆WhT#j:Su&j.St"h5SNu @ t(<#th5S"uٺ6$5=5t D$45D$85jWV u h%YP腌$u804$ $HHPIf $,&ujPV萘 |$u^Vu랋xp  PWh"; xp D$h PWh"e;D$ 1G<$ǡ5|$t*tOP9Au5OPt9Qu A e55PwӃ t"|$uwhk$1G<$0|$%w_h,%j]h#j!5=5"tЧ#PQPhb#h'37*j-Vt)<#tVS t@ "5^SWVP׉>#uFj PV3 8u$8u؃^_[Vhk$jWVhN#j\USWV f65Z 6ƒ 65 6€ш 65 655hO=#t h#t8ƿ&̬#PVtG uVh#j $$1ɉh#SU P6$`&5kj j5D<2 ƃu8"555v D<f5Wj j5D<+2 ƃ _%5j j5D<1 ƃu8"G555551A5D<{5D<h"VWtch#VEK55B55/5# 8"tD55  9u5rCjhe#5D<hJ##Vh#5D<h1# 5D<h#jJu h# 5t 1ҁ‰56փ955u<95u2695u#69 2t 255=5u\1ɅQh# !3=5t)ͅt=5ut 1jhh5P4 $yh5hk$j =5u1D$(Pt$u#D$0=u 551N1$<& $$hּ"@>"t$h#Qh@%hV VlCthV"P'$Phk$芥55 $=5=5p5B=h{"tP$t1@$$Phmdt$ hhɨ#h|tW轻Wh# $=5u 5 =5u 5 4$h5 T5 $$1 uWhPh5 155 5$5tjVh5r h5\ $RhS5h5VW0 55VWF5 Wcl$t$D$ 1ɉHHD$UD$ Pj腒 譚Džy#28#Bjw芚x߉DžVPx9ujUj1 1|$nh{"$P "<hjh5 ^ Wt $h#h\'3'3H '3~'3H '38h'3zljt9 t4'3H '3~'3H '3h'3:ƒ߃NyjUj h"15\'3h5VW4. 55VWj3 h5dtd($Phk$聡$P?1@P%jUj苐 P蝓P_h#肾Ų#tǍ$PWho%VTD$uh E"Z$P~>i$jPho#QQµƃu W VyWVθ"# &PVt uVh #jG 55G5G5O16t^_^_WV΃=6 6t>5t49t0##9t"9t"QPh­#/ 5566^_SWVm#D&&VSht#h'3eL"ujQVPjj"Pm thߪ#|.1Q1&$ =uhH} jj"t$ 諲1$4kRF"u4$ 1@^WVκ. u1H3 r1P^_V΀=5u6=5tہ t41t)Ph50h5hedAV xk^Ã=5uہ Jt=5t75t.h5hedAVp th5hrdAVY t=5ujh #j趴h#jzUSWVPύAPjhױ#h\'3Gw4X&h#Ph#h\'3t \'3w(h#V^ w,h#VM w0h#V< w8h##V+ w4h*#V W4O<W8ұ#9tQhұ#h1#h\'3l1#OHtQPh:#h\'3l1#OJtQPhD#h\'3l1#OLtQPhN#h\'3l1#ONtQPhX#h\'3fl1#OPtQPhb#h\'3Fl1#OTtQPhk#h\'3&<$f$1۽a\'3Pjjhұ#$wVht#\'3PwVh|#\'3PGtmÈJ9|6{u;[tVPWh#(D$(ffL$(D$ 1ۉa)D$u!)tPt$h>#Y(L$4 <)ǘ΋I<9vt$hk#0($N<.”T$9vt$h#($D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$hª#' D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( 55t$(L$QhVg'  D$ 1hѲ#V自tG<$h8B#V~G4(1>tYj:WD$AL$\$h8B#S6G,1tD$hb&Wftkh $WTh)#W>\D$PhK#W D$q;5ef5ujh&l$!U诪 l$X&1tUP QF&r܉1hD$ Pj <$Whղ#%D$ D$t$ <$}trÉD$h"U t:h"U t/h"U t$UWh#7% F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh3#$D$ D$\5FʼnD$uf55l$u D$l$l$h7$W<h$%W&hw#Wh#Wh#W h#Wh0}"WThdz#Whճ#Wh#WvUh"W`kh#WJh#W4h#Wh#W<w ~W|$Wh## T1<$X5jD$<$rt$Wh#" D$f5@<$WhZ#"5f5jUh5jUh5 <$t$ht$0V" J21jD$ Pj< D$(5뜉1jD$ Pj D$,5q1jD$ Pj uuD$85J1jD$ Pj uND$05#1jD$ Pj u'D$<51jD$ Pj^ tt$W|$Wh#\!D$451hD$ Pj uD$fH51hD$ Pj uD$fJ5a1hD$ Pj ^D$fL511hD$ Pj .D$fN51jD$ Pjc D$P51jD$ Pj8 D$T5; 5sr"jW|$WhW#W|$Wh7#΍L$$ t$5|$6L$$ L$5t$6rh8B#V,@l$}}&1ۋ>t.W蜢Lt t uPUW  Á&r D$.3MDHu D$"91hD$ Pj t4$hղ#D$ \$"r)Ut$h# h#D$1ۋD$5ND$5Wġ4(t$|t%h8B#V? L$1Ҁ<tʉT$D$< w'<$$\&L$ L$5<$tL$$L$ L$5|$6cL$$t D$|$6L$516FL$<$C fF|$6L$! L$5|$6t8L$$ D$|$6tL$511A<$D$ h51D$ ȁ(^_[]4$hx#D$ WVPθWEV55f5h5 f5=5u=5u#$}h5hgdV 1h5hfdV y[8t Q8uv$=5u(PhmdVn xX52h} 1=5u$h5hgdV2 y #1G^_ùޭ#hɨ# 뙃=2tt$ t$ t$  1HVD$ t$=5thPh5c ^D$L$01GVKt,uVh#-t"uVhG#Vhk$%Vh#Vh®# ^h6hmd52& USWV8 $RPh h5Q6 5v|Pt$h_# lj D$T$1D$ XƉ 11 ‹l$,6 6595hWD$P $;D$l1#=5t =}t=}uЉD$$#=5tȋ 5=WEVuT$tf95rD$Pftt=5%4$t$Uhʯ# D$t=VEW=5$t=VEW4$t$UVh#2=5|4$t$UVh#=5$D$PSt$Ut$Vh$#=5u $h5S\'3V 55SVI SGSt$VhVWI 5D$ L$D$11t4$h8#,8^_[]USWV T$ $11F1Ń=5|Uh# QPWD$Pt$~9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=5tUPh#8 Ɖ ^_[]Ã=5tUh#=5tUhٰ#ċL$T$tPh511@PhD#t"j QP u8"t1H51YhT#j&Phs#軤t"j QP9 u<8"t1H51Yh#jݝSWV։ϋ\$+5tItEu51tGtB5,669w15 1tth5QA1@^_[Vh#jL$1=5T$ PG1ɅɉWV6~( WRPh5Qb{ 69u ^_hM#uQVhs#jȜPQVh#j艜USWVPӉ΋l$|$uj WV Eu"9"t:M";L$ w,O>t" t9t.3DJ@t1^_[]WV1t>΀9t7h8B#Vߗ<t#ƍFh8B#P41|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Whx#1۹6؃^_[]ËL$9/up85D$\$A/jPU u$D$ ,5D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Whղ#56!Whx#61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#6D$$Th#Sut]"l&WqPWSƉ '> uۀ$U-$T14P&D$XP tpC"uD$TPh#$T$끹#P&j" $eFMu SQЃ {Sh#,h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h#~/$PQh#R~$ #Sq t*Vh&S tSho#~뾋$G<GJPh]#S' Ot,Vh&SG tSh#4$fGJGLPh#S t,Vh&S tShº#$fGLGNPh#S t,Vh&S tSh#$fGNwPh$#SE tqtNVh&Si tShC#V‹$GP"Vh&S= t'Sh#*wThb#S @s$GT^_[]WV$ Vjh#W~ jWV ^_55t$h\'3 Á0}"=6uu"Ph#Q? ~5$w$&66 hf#2+Vh#P~I$ $u ~ˍ|$@WVK9t"b&J~PH k$&1OJH w@$8& X&B(D$ D$$l$ CtGtngtbcB8D$D$l$cX&ɋB(D$(D$,l$(BX&ɋB(D$8D$<l$8X&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=6uHr8jVSW]D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#h#~USWV|$t$t$hZ"V1 Gw4&h]"Pha"V  GPShl"VGPShx"VVjjhv &GXtVjj h"GXtVjjh"ܞGXtVjjh"ÞVj w(h"Vg w,h"VV w0hÅ"VE w8h؅"V4 w4h"V# wu 1<1A71Au01<  $jj@PD$P7D$ Phk$C9u<$u4d'3H d'3~\'3H \'3 h\'3j 1^_[]h#jfUSWV $ $ D$-@1666666$666t$ h#US c~!P$& 6˃PtdT]=D<?1AJ5D<56뒹 .D<6hl1#n 6b 6D$6T$:@=6lD<D$ Tnt uBxou D$ 1Ɉ 6h%Vt6hl1#`ءD<$j:W菓C-6tWuKtm6S c$ \W6t6t 6!39$ 1ɉL$tVh$P tj/Uu Uh"h{5%h$ UVlDžuVkDž7h$P苔 Ƌohw#W-t(h]"Wthѽ#W pV 1QQ$ 4PU7L$9C9$ $ 9tUklj?,$u1QhD$PQV# h6hzd@P赧 tq$ PhedAW蛧 WW|$ W|xD8$9",&uW7W6,$h hG 56P Ġ ^_[]hb#jB|$Phk$j^|VhԽ#j!|hL;"h9"ʍD$ Phx# D$ Ph#j&|D$ Ph#롍D$ Ph;#땍L$ Q4`&h#USWV։ϋl$jX V͘ U˜ CCCOK G^_[]}hx&Ph&#h'3jUSWVP׉΋tASvWv4$4(VS[ Wh*$Vt$ P W( É^_[]USWV|$1_hw#S7t$h]"S%thѽ#Su\6toU3t[u=6t .=6t%6toU3t [u^_[]USWV$D$|$6l1#tW3xt CÅush$t$ UuD$C/%D$ 6t L$ mt L$ ^$D$ D$hC $$ t$hY+%hV$0|$D$4$L$h%Q1G@΍K9|,SPZ Ŋt><-u(GD$tj=V膍t>FD$ GD_#th%D$Pu|$1F1B,$֋$$$,$D6tPl1#tX"P$h#4 xF1Ë$4h4%C9uj '诎t2ƅ|$t t$Q 4$F tA710h#na|$t t$ 4$ ^_[]ÍD$jPV" x!L$ȃtuuh[#`묁tlP PUh" 끉 6utD$P$uW$P$su?"tI#Pv vvh#h'36Z$SWV։ϋY Wss ss҃ d$6t~j (Wss ssԅuA d$6^_[ÐWV1t$|$ ɉ @4u!BȉXȉX\ȉ\ȉAAA PQ40UA40<85A<8D@AD@LH@LHTP@TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40;@40<8@<8D@?D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7?Vw wn?V FwwZ?VFwwF?VF^_USWV\$l$EffEffCEffCEffCu u>S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu)>SCuu>SCu$u >S$C EDȉCDu,u(=S,C(E@ȉC@u4u0=S4C0EHȉCHudh#VŋFN%6tbSQP %6x X&6~,=0&6tffOfGG@ Չn,~$N()ǃ~$N(=X&69<$D$hP-X&6>N,ș)N,)n$F(teh#V$FN%6tbSQP %6HT$<L=0&6tAf=0&6t4f.<$ ^_[]$6X&6F,)F$N($fOt@ $6븋D$L$t$ QPQPUSWV$$$ $$$(h&$SV\1j GD$SVWUhP@؃r_T&695P&6rPSV Pt7=0&6tf%ټ"=@t|-#WQh9%d WhH#T^_[]USWVP|$\$s s@=0&6tf9uR(&6t=$6t=&6tj:D$1PPPs sQs s6Ol$63C h$63K u 2&=0&6tf%ټ"=@t|-#QhW#胣s s/)SUhe#茾 $6u =&6t:yj 茽h|#$6th#9=$6uh#u= &60&6t7t;f5$6D$(&6jhQ#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=0&6tf=0&6tGfټ"@t|-#Ph#/SVz.=$6t)1= &6L L h#h#{$p$l tRQf@ l$6h$6 1VW 2L$@D$DD$ t$|$ &6pt950&6tʋ &650&6T$Htt tɉL$LL$QPh#=$6uh#5152PPPjl$6h$6  52RPjjt:%6=$6h#D$L$ l$6h$65l$6=h$6 tYjj= &6H0&6tt,fI=0&6tftfI=0&6tfIfHVW51l$6h$69$6t-j " l$6h$6 djjQP l$6h$6 AQP=0&6tf%=@5l$65h$68,$t$R=T&6P&6 t# Fjj WS69ݹÉrFND$P9|$P$d닔$hjj RSt6 )ˀ0^N9wh#訞h#Jtf5l$6h$6152WWWjl$6h$6 CRP52jj_h#h!#1$61P^_[]Ë$d#h$6 l$6$tҍt$PtV$lSUQP4$SU fH1G@u5l$65h$6h #SUu.$l#$pth #5l$65h$6SUq5l$65h$6H= &60&6fA=0&6fh#$6hB#h?"jj5l$65h$6D$DD$wL t$\$ VS@@PD$PQVSf@5l$65h$6tfA=0&6tfA$l$p!fHG5l$65h$6mf@5l$65h$6SU5SUhj# t$p$ph## =$6j ,USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ%6@4 1WjPQWWRS 9=0&6f2 X&6ff2=0&6twf2 X&6ff2=0&6tjf22f 2=&6t2ȃ=0&6t]D$ Yf2 X&6f2f2 X&6f2f22f 2=&6t27D$ G UV= &6l$$tApQt=0&6tRP'A(=0&6t1ҋ %6I4-%6teQRP %6xtt$V/11jWp>8 =X&6=0&6tf=X&6f2%6;x4})}jh2W7 =X&6E %6A49rE =0&6t<$fGj \$l$u6_=0&6tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=0&6tfUVfXW|$$Wf@t$$W= &6H0&6tt,fA=0&6tftfA=0&6tfAfH ^_[]UUSWV$$1Q T&6P&69;$$߃9։$PU$T$L1 B(B $BjZr1B$J$= &6pt$ =0&6t ɋ= &60&6L$xtt tɋ= &650&61L$|1ɅDT t$t RP#5X&6UVRP~ tE{[|$t}SW^#ljUVSW~)SW6#lj_{[ |$t]SW#ljUVSWS~)SW"lj?UVSW)~)Ӌ$xX#UVSW~)Ӌ$xX D$4PS $$W$VWVhPWV &61ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =0&6t SW " %6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ = &6<$\$T$|$(t$,DpLtL|Dx=0&6RS"!TtDp%6D$0X0vv RP VFvv  RS VFt|tx|$8 D$T$Rl$$D(D,=0&6tFB\pTt%6B0FN FNDxD$L|׉L$L$؉D(MU =0&6t]RQ*  %6I0VP U EMhɡ%6@0 ȃ=0&6t3ȃ=0&6EhD,t($%6@0MU EhEhD,= &6L$ tL$D$D$=%6,$\$ 1QOP\$  t19}#8@#pLp0l$$ %6ɋD$taVt$P9 %6x4ƍ$5X&6pSc %6@0fPt$t$ %6x5X&6Spc X&6=0&6tf؋X&6f2%6B09}+^jh2S0 X&6%6B0N9rF = &6tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL %6taPt$t$$ %6x= &6t$,|$(DxL|DpLt1҉TxT|FN=%6<$090&6QP)RPzVF^vvc )RPRL$(D,D(D,EM =0&6\$QP %6I0)RPU EEhhȋ5%6N0 )ȃ=0&6t^ȋ5%6T)FN^FV )S\$L$4$*5%6V0)EM Ehh )ЋL$Ev8QS $61Ą^_[]Éjh2p- $Ph#k=$6th#oh#ۻF & %6@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lF &6pt =0&6tɡ &6=0&6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwM>t~1F=0&6tf)9F=0&6\$tAf)=0&6t4f=0&6t'fL$=0&6fVT$Rt)f~T$JR>>fD>=&6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=$6= &6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=$6t Vt$t$Ut$h#讥1Ƀȃ^_[]1A=$6t1= &6<$\$ HfUSWV $8$4}tE1ɉM4M019 &6‹DT 9 0&6tRPM$U(E$f M$E$U( u ^_[]%=uLI%6(9‰|ǃ=$6t<|u= &6tFNFh1 t &6tD$hVP[ |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =0&6t RP %6I0VQRPb ։D$D$ ЉT$t %6= &6Q8k= &6L$$tL$D$ =0&6t QP= %6#8t@DQL!!IT u‹$8U t#DT tE=0&6t!RPD t(=0&6t1҉EU}@U=}@|$$6EM QPQPh$3WWh*#聇hN##uQ{u u %6y0ƃ= &60&6t:tMPW?UUlCD$T$NQt PW~V ~V h"#$&6%6@ 뛋5%6F8E - &6T$$tT$D$ =0&6t RPUv0 I)؉$ʉT$t*DT tZ=0&6t RP $8D t6=0&6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W$6E$8I QPQPh$3UUh*#薅hN#8$<t7%6Ht)$|$- &6Cq qƃ= &6t0FV=0&6|$$tJRP)RP4FV =0&6|$$t&RP)RP)FV )FV h"#$&6%6@ USWV|$ \$tT&69P&6at$6 p$6 ‹-%6t9ˉrux9ˉ\$؉jL$QWPց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס%6t`v0WUH %6%6pxjV|$(WSlk)Љ p$6t$6= &6jVPSDk %6A^_[]WSh#%6@ USWV$׉ν7 y@tnVՃ2v vv $<D$$8D$%6p0vv[ $G %6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP19rÃ=4&6$t$ \$ti= &6t,ۉ~A1_t4T\$F9uۉ~1O ɋW @9uG W5 &6茲t$ D$x[, %6;Xt|$#= &6t JًL B tmt$v vh#hWWVt= &6t$$B1ɉL $6t$ $$Bt$ B C%6;Xt`R5 &6贱T$\$1ۃ= &6t%JًT tN=0&6t#RP7 Bt/=0&6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb$6L$AI QPQPh$7WYWh*#hN#xT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ= &6t+FV=0&6tGRP +D$RP 1FV =0&6t*RP +D$RP +D$ډFV +D$ډFV h"#$&6%6@ 1@$5USWV\$41F~3|$0l$,|!D&6 @&69|)S9у} ȃ^_[]Éދ%6K89}=$6tOI.A!1‰9)=$6l$,|$0t!t$4PWUh\#Z%6PVWUUfNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=$6!$l$|$ T|$0tN# $ND$T$RPWUh#> %6<$\Ttq!qIVPt$ Sh#$@l$19=$6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh#}%6t$Sh#`1Al$,|$0USWVD$,\$( $6$6փσ5$6=$611 J $69$66 $6$6x$69$6@D$ $6=%6\$jD$ PL$QT$Rց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =$6$6t$68$6T$t$6‹D$ȉ$6$6$6WUS5$65&6谬=,&6l$$-$6+l$(= &6|$`5$61VV=0&6tf%=tjvdv`VdF`vlvhVlFht4TCut4uTCuG9a=$6t< %6(1$6SS=0&6tf%=u1=&6u(x$CS =0&6t RP9Ƹs& ɉ @u ɉ @uG9wt$t$t$5$65 &6衬$61Ƀ= &6 x$6^_[]PSh#awUSWVl$|$%6jVUWw` 1ƒ $6$6t$6p$6=$6-$6=$6-$6$69$68#{H1ۃ= &6(=$6-$61$6$6ډ$6t@$6 -$6=$6Wh葃 $6t^_[]UWh=#Tvhb#Jv$6t Pj $6USWV l$ = &61ɅDT =0&6t RP %6Y0މD$ʃQSRV?_ wÉD$4t,PX 1ơ%6$%6QPt$0t$0^$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ %6; %6u3P5%6b =%6t-%6%6d %6%6Q%64 ^_[]h#\tSWV|$t$%6%6QPWVp]tH 1P1 t^_[WVh# tV%6tR %6~%%646g ;5%6s%6Pg 5%6g 1%6%6^SWV\$t$s sǃuG=0&6tfL$%ټ"=@t|-#RQho%t s s=$6tfhA#xh&6l&6{@t1H1PPQQsHsDs sq SW= &6t6hh&6WE -h#荠u7=$6{놹 x&6s s%6H $6^_[WV|$t$ WVh#迎 CT&695P&60WVh#腎=$6t7= &6pt=0&6tPS t 0h&$'= &6pt=0&6tPhS&=0&6tfPh#=$6tqPh"ٍ1Ƀ= &6DT =0&6t RPBRPh#裍 = &6tF(F=0&6tjP|tPh#n^_SWVD$H8=0&6t3P PP0p4u'11C9}QBRQp= &6RMT$=0&6HRP9L$0ơ%6@0 T$D$= &6D$0T$T$4=0&6t$$t RPYMt$t$$=0&6tȋMD(%6@0T$,‹t$(΃= &60&6t+tMVRuVFt$t$ 7KVRMQ AD$:MQqD$T$AQ!EL$DT=0&6t1ҋ %6q0RP| ƋL$ jWSQHӃ= &6D$ t7~SPt$t$$HNjT=0&6t RP|$)~SPt$t$$H=0&6tȋ|$1҉\$$ t/f %6q0RPُ xËD$L$ L$0|á%6@0 T$ʋL$ȃ= &6L$0T$D$t!D$4=0&6t)PQRD$ T$8=0&6t@ɉL$ D$ =$6t h#X=&6t h#Xh #X/=$6u h/#WX=$6u hM#W3=$6u hn#W6=$6u h#W<=%6t=$6u h#WT %6|$Y8֋T$  SP5d&65`&65l&65h&6h#Wd,$kdы%6@DWSQP(?D$T$iщډWSUR>jj RPvRPt$t$t$t$t$VD$Ph#q$=$6 %6+P&6 T&6h&6 l&6h&6 l&6 tQPh%#Aq =$6-%6KC)s, `&6-d&6Ջs4HS8\$ ډD$$+@&6$T$D&6 $ $ډ Љ `&6d&6tRQh9#p =%6t8hN#sp5%6tvvhu#Vp 6j ho=%6t8h|#2p5%6tvvh#p 6j 'o15%65%65%695&6tmj %64054%6h QV 5%6Vƍ=0&6t4%6PPҞ54%6z8%6=$&6t $6j %6y,t+%61TtRF %6 %6F;q,r%6PF %6=(&6t =$&6th#S,61=&6=$6u h#S=$&6t h#SGRtgD$PhW%nu1D$t)L$ jQPhW%hC/%t-=$6u h'#S{  ^_[]1USWV%6D$45%6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B H&6l$9؉|5%6|$0G;~,$LHN4H~KT$މ)1@ H&69׋T$9|5%61҉t$L1F[, d&6`&6l&6h&69S,SދD$4HxL$HD$81ۋjV %6ׁ\Tډ\$tQ!QЃQ SPh`%6A%65|%6|$g D$ D$ {~hq닅t)fQPef $AQf $AQ F4D$ D$f9^%6D$@0T$ t$QPVRʼnׅD$,%1= ̓|$@%= &6$T$ L$um=&6td t^;9иrN $yhtE&6Q(=0&6t=ʋ %67=$6D$ WUt$ Ph#dD$L$Id5%6jRVP{ =$6L$$t$ \$ t(Ƅt$S$PVQh#KdL$<VQjƃ(S$QPF = &64$t 1FFFh%6\$ T$ D$(x+9‹T$ʋT$ r=$6D$Xt1NPSWU/ʼnFظ|߃\$ <$w4F &6<$t LX FuWBsT$ h&6l&6$@=0&6tfL$fAf|$l$$j ( hX %6%6T$ =$6t| $=0&6t RP(RPh#l=$6gq$ʋT=0&6t RPWURPVhc#Ea($DX=0&6tPh# a$6h#Eht#brT$ '|$@@u' T$t$SUt$A p&6t$D$, F= &6=&6$@=0&6tffu$@=0&6tfft}SU{$@=0&6t?f=0&6t/ȃ=0&6 $ApfAAt$f=0&6t $ApfAA $AtfA1ɉ (6 (6 (6 (6l$T\$X &6pt4$9 0&6t ʡ &6 0&6$tt4$tʡ &6 0&61ɉ$dtX$t $D$LPt$衹= &6=&6t=$6u,$$@\=0&6tȅSUh#C h#(p~SUؾ19 0&6t1ɉH\H`HdHhHl$f!B=&6,$(E\=0&6tȅƄ$E\=0&6tȋ %6I0H111҉,$L$ D$t ߋ %6Y8Om\=0&6t͋ %6#8߉@DYL!!ÊIT u,$\$lD`Td t<=0&6t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9%6H4 D$|$׉D$|$= &6t݋AQ=0&6t-RP{!Eh=0&6tȋt$|$1҉11 ˉl$$WVRPSUh#uA=$6tht#yh #m|$t;SU蕼ƃ= &6D$|t1$=0&6t RPFV$6=0&6tȉFhܽ$|$jj$$$$SU z $A`Id=0&6tEQPH $plph/1$D=0&6tWUPVh=#  $AhQl D\$C5%6;^,T$$L$ '6'6׃ƃ='65'6 %69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-%6t$| ؋T$(tu3D$1 Kl$@؃,Ut$HS, ƋD$9\$(s+l$ Uh #>jKQSWUt$@h-#h#m=jWsUSWV |$ ow@u Xw VUp D$t|VUh#w w(6 (6ʃǃ(6=(6|$ |:w whZ#= =$6ht#mjG $D$|$tjVU¾ H&6<)1CVUh#D$,p p* (6 (6ʃǃ(6= (6 j ' hp %6tH%6 %69tDy1Y1 t 9u,`&6d&6$|$ ,%6%6Q1I1 ы|$ t%6$G0W4L$Aڃ]D$ p ph}#J< =$6t)hh#N1C+$6h#;ht#h1Ct ؃ ^_[]$6jpjvNfUSWVP$T$1B@Bm0 %6(6%6x,11=t&6t>Q:%6x,$kd1PWSQh#h'3Xt&6%61ۃVU聶tzljl$ t$ &6pt=0&6tʡ &6 0&61ɉT$HtttȉD$LVUz8tD$PWbu(C%6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$(6ŅtTM1ًU1 u3VSh#w w(6HPUMpX(6 %69tmu1 %6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $h&h#F9h#eh#ejj聴= &60&6f@=0&6fh#8h#aeU1hPVPVҜ1Bh#8h##et21VWhVWVW莜1 tah#+7$6ht#du<tf@=0&6tf @f=&6tjjxfh: j5%65%6T$1B@B: -%6%6  $t&6$Wt>E6+5%6=%6kdPWVQh(#h'3Tt&6uF$hK#vv 躑 X&6A1ڍF$h#cvv 6ǃ= &6F$ 0&6&jPn1 X&6I F NQPQPhSt=&6F$ X&6t%QjPSh#h_#>6#$6QjPSh#h_#36=$6th#7=$61F$X&6 I1)щN$uh#b-vv *ǃ= &6F$ 0&6$Wt jP_1҉GW1҉GW }hjD$\P) = &60&6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L= &6$tD$\=0&6tL$Lu$D$PD$PD$XPyt&6;,$/$6$W=8&6v8&65%6;4$]|$T{$AhjWb' - &6=0&6tt0fD$T@js$&tPfD$T@js$пFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L= &6$|$TtD$\=0&6tD$L$|$TtD$\D$PD$PW٧;4$=%6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h#ss QPTh#$^t~s sqf@fNCKK CQPh #ss oOCK =$6th#ss QPCKh #QPss fN $6;<$=%6%64~^1ۋ/uu p]]8u9rۋ=%6/CK tS  StQP HKX9rjj轄`^_[]$6j"ejBPh #/L$D$@, +A,USWV $0 n8$= &6ui=&6t`E=0&6tȅtNE=0&6t$;P&6T&6s&E=0&6tjPo@E$F0N4 utEhe%P;)$0 F=0&6tȍL$A=&6AAhhe%Q &6 0&6tD$D$L$L$D$h#v v薉 E=0&6tfM9v%}EPh#.*#h#0[4/E=0&6f)=0&6f=0&6fEtf=0&6t΋$0 AI 1 h#QP辈 h#Z$0 F=0&6tȉE$#PlZEL$fAWQU $)fEPUV =0&6tfD$fXWPU $0 G0W4w wmfH$X$6$0 =&6t>}t8h#v v贇 h#Yu EB$6F0N411G9 v vGD$@=0&6tȍL$A=&6AAhh #Q 0&6 &6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=0&6t2f)=0&6t%ffD$=0&6ff0&6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=0&6tfPjU D$fEutEh #P!l$L$Aq $0 JR ωtljhS#RQUW݅l$EMك9v%}EPho#*#h`#mWD$$0 T$ 3F0V4=$6hx#|ڃD$=0&6t΋D$p@ =&6X}$0 ~h;#v vڄ Eh#VJ$6B`#$0 1GPVtXD$T$ F0V4=$6hx#{ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPAifH1G9$0 .1L$AA EL$fARQU! $EtMw\}.uVV4~0|Juh# } .u8h#v v% Eh#U4$F0V4=0&6tȋ T&69P&6s5h#juv v݂h#T4$=&6E=0&6tȃu}uE=0&6tȃtb}u\FN U=0&6tʋ4$h#jRQPX=0&6t}Eh#T1 0&6EtjP|gC$0 A4y0#$0 t=$6#=&6JR u=0&6tPjVRQ菁h#_SƋE=0&6tjP1Ƀ=0&6t f0&61ہ@€@t f 0&6fG$64$Crv $0 A4y0AI U=0&6tʋ4$h#jRQP褀h#tR$6zE=0&6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=0&6l$\$tȋM=0&6t1퍜$UQUPhScSh#$"Ph# %9-$6thm#wl$\$ h#vQƃl$\$$0 A4y0| AI KC=&6taEO9tU$0 AI U=0&6thB#jRQP%GEh#Pu $ $6fO4$E  ^_[]ËM PShQ#"ȃ=0&6tUSWVT %6%6,=t&6t>)"=%6kdPWVQh#h'37At&6}ww cO W $T$ WGO ƀÄ:1=$6t4=(&6t+=&6t"uGO 1F9ƺw1 tbQPc8uS=p&6xJ1v6KNj@ $GD$wOG tQPb8u E;-p&6|E;-p&6=4$h#b"h#ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D &6pt =0&6t ɡ &6-0&6L$Ltt tȉ݉D$PD$PRmu h#!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t l$6h$61JQPBafp%69)T^_[]fUSWVT1ۍT$1BwL %6x,@=t&6t;%6p,kd1PVSQh#h'3,>t&6%6 %6<\$11ۃVU衛VUi`$t$l$ &6pt<=0&6tϋ &60&61҉|$Ltt<8tϋ &60&61҉|$PdtX 8Džtɋ$L$HQ$&xtCVUztV=$6VUh #^1= &6L L tOjh~#s%6tuQ1y1 t6 u_VUUdtl=$6tHVUhJ#(:7jhr#$PxyQ %6Pt jhQ#D$P C%6L$;JWD$ P8%6 &6tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$#PhY#USWVt$tB|$1Sh&1/PhK#Euj 9r^_[]fUSWV%6!11G1 =$642h#;%6蜘%6h P54%6 5%654%6<950&6t4%6PPM54%6)8%6%6$:[#ur#P.t=$6*9$6u~=$6h#5T%6 h P54%6B 5%654%6.;=0&6t4%6PP:L54%6A(8%6jOVjCVƅu jF`u j8`^_[]h#.t=$68@$6fD$L$ (6(6á(6á(6VPD$ L$ $'3QPV# Vj 1jUSWVt$8(6ut5(6h"(6l$\$= (6t!u5(6hF# (6US yW[ Ph$R$(6ttj (6tu^_[]Ë5(6PVhT#N jPD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj jDUSWVu(6$PhW%6w$|hWV( t Ƅ|D$PVv1ۋD$ !=`= بtLV0h$P Džu6h$(6hk$1 Vh$P[ DžD$PWSvVh#Wh#ue^_[]Ë$3D$($3L$$ u(6Vhh$(6 t9Ǎ$PWux#$= uVhۿ#{Vh#pWh#eUEM JRdtHPQh# t$t$h#hh$,6R$,6]á,6tjЃj WV(01Gj0h&W =,6jj40^_SWV01GWDpWSjS0^_[USWV$&6 &6=$6$HPVut=$6u6#$P= t#Vhh}"oht#)jV蓋 &6R=$6<$8 &6=$6t h#Vh#H (61&6l$6h$68%61I $%6 %60%6\%6 H%6 D%6T%6 US ƣ4%6US ǣ%6US ãX%6UP~ %6WOG?$V$S $6tdu`jV\  $6J0 PVh#0 PVh# 1Ĕ^_[]á&6u"$T$LQRjPVDt|$T=%6=%61A5]Džt<$%6\Tu nt1%6!=$6 (6hW#jV3  &6$6  (6Vh$#1=$6=$6=$6D$xL$ PQj5&6SCuSh}#g$$(ffs1$(j h#V VSh# EVh#0u h# k%6 h P54%6- 5%654%62=0&6t4%6PP%C54%6,8%61=$6t%6Ph#%6tZ,&6u6t2= (6u!=$6#tvH$Ph#71OE $6uh#%68< D&6@&6B,P&6T&6J0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ &6$6u@,$\$D$=$6h#B,$\$`L$(l$854%6F4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ %6|$T$D$DSh}#h+#"h%61XǀPh P54%6f 5%654%6R/950&6t4%6PP_@54%6f8%6 &6$6 %6=$6thL# Sh#hr#"%6PP.=%61@L1XP\hhP' h%6W66h 5%654%6@ 5%654%6,.950&6t4%6PP9?54%6@8%6%6 Ph#xh#!ud%6  h P54%6角 5%654%6-=0&6t4%6PP>54%68%6%6h#h# ud%6ǀh P54%6 5%654%6,=0&6t4%6PP >54%68%6%6@=$6uh#h 5%654%6A 5%654%6-%=0&6t4%6PP9654%6@8%6\%6*HHPLщ8<҉@D1ۉ&6 &6$6%61Ƀ,=$6h<#4L$ %6L9| 9Ph7#%6=$6th#<=$6uh#Hh 5%654%6ۈ 5%654%6#=0&6t4%6PP454%68%6\%6@h\#L$A&6%6ǀ,04ǀ(<HHPLщ8<҉@Dh P54%6 5%654%6"=0&6t4%6PP454%68%6\%6 &6$6G?%6L-=$6thx#=h#:%6%6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P54%6趆 5%654%6!=0&6t4%6PP254%68%6\%6=\%6t}=$6uth 5%654%6E 5%654%61!=0&6t4%6PP=2%6ph54%65X%6 h<%65 &6=%6Vh|LVjPv G011D$)9|ËLG8 $HLOd t1SRPV5&65t0|$u)h#ht#r1AL$=,&6tLSVV66 %6A8$HLId t1SRPV5 &6T=0&6t SVV5 =%6G0ŋ $A9D&6 @&6ʃƃVhH&6VjP jw,%6y9 T&6P&6%69؃s%6É%6%6C %6UPGƣ%6US6%6 Vh.%6E%6 $&6=$6 %61Ƹ1ҽhWV5%65&6|5%6=%6%65%6=LBALtl=$6Hh#[h#11IPPQQPV7%6f@5%6.6 %6fA%6FȃtvFjPh:# =$6tht#6=$6uh #mt1F%6f@5%65 %6fA%6Ff=rmho#=$6th#5=$6uh#t0fF%6f@5%6/5 %6fA%6Fffuzh# =$6th#5=$6uh#st=11IPPQQPV6%6f@5%64 %6fA%61Ff9D> <: $6ShK#Shr#$D$0|1MƉ‰w1MPt͋D$,L$H14$ I1)щL$t$L$1t$$jQWt$ v׉σQRWPWhP# 1t$tT1$|$Tt !L$D$ u $617F9t$uh#h#h#h#h#h#ho#h#c=$6th#g2=$6uh# t/Gf~%6f@5%62 %6fA%6fFV1fF %6If9PQh# =$6tht#1=$6uh #5 tK%6f@5%6}1 %6fA%6,5$6h5#]$%6@fF$6$61Ʌ  X&6=$6tQPh#1 %6!u#1%6%6f%6%6@0p9wAu %61Jf%6=$6t QVPh#%6SW8ƣ%6SW'%6t Uh#$6jh+#USWVϋ$6tWh US54%65&61l$-4%61J # <$&%6QP &Vh T$RP54%65&6u-4%6tu $)##<$=,&6tW=$6=$6$6=t=uh}#h# uh#=0&6t h#=,&6t4%6PP'h 54%65%6z =0&6t5%654%6& %6\=8 u&6ǁ\TT1=T &6U-%6Eh= |#1^_[]ÉD$<$ %6D$ t$΋E4Md1C%6QPVt$$%6 %6(%6 =$6h%65%6=,&6u=$6u =$6t_h 5%654%6y 5%654%6=0&6t4%6PP%54%68%6\%6&6M,I\Ttu!MȃMt$VPh<%6* 1=P%6=,&6tX%6PP$%6ph5X%65%6x =0&6t5%65X%6$%6\8 u ǀ\T5X%65%65%6o=$6tVh# ,%6{hr;ߋ-%6ދM9t+%6QPRh#9rҋ $+#1Ch?#h^#j׎D$ &6 $6t(\TtTu 88 \=$6t(\8 t 8uTT\ËD$L$= &6P;QP ;Q P;QP;QP,;Q,P0;Q0P4;Q4P8;Q8PH;QHu|PL;QLutPP;QPulPT;QTudP`;Q`u\Pd;QduTPh;QhuLPt;QtuDPx;Qxu<;u.;u ;u\1;\1@À L~.PQWV|$t$ FGF G FXGXFu  j PQ(u vhWV+ ^_WV|$t$ FGF G FXGXFP^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhW%mUQ=.6uR<sJ.61\$|11 ʍT$ ٰBPVQ^ D>/|)Ot$L$6.62.6$!D$h8J.6$ D$tB?JL$h)PRQ$^SWVD$t$ T&695P&6r==%6 %6jSPV(W)޹294v t^_[PVh#GWV|$ wu$&1XD$@uPw w Phk$.=$6th#2h#t ^_Ph#躽t&6USWV$\TM@$ 5uh`褠h`VP\ =$6t h#w=,&61ۃL뀃=0&6t\,L$UPQ֏ DPP~$\, 0&6L$L$UPQ褏 |$u $PPD1LDffLD@9u=0&6t8PP\0&6L$UQPJ t"PP\L$UQP$  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h#,USWV\$t$=%6!ߋ,t9Xt6@u|$t&j6t1ɉH HHXh1^_[]h#ĺVD$ L$5%6#p9tыR9u @^USWVt$|$VW/%6!t7^Fu+11 33 1u{ %6tqt$0|$,\$(l$$T$.6t9PtjRQ .6(Xxp L$ .6t9HtjQ5%6 .6(Xxp ^_[]WV %61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$&$1Aȋ$sY9U&<`&Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$ &4  <Qh#h#船D$P`wZL$ D$$0&1B(ɀ!1Rh#h#SD$H`wPD$T$ $@&1C%   [Qh#h#襸SD$H`wND$T$ $P&1C%  [Qh+#h#:USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWkƅuWh՗"jj$$<$4D$Phd@U tg1OVhedAUa F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh$t$ 1 ShE"U CPhV"U薡 C Phb"U脡 CPht"Ur CPh"U` $@D$t P( 1-Uhzd@$<Wh t1 VhedAWM hjU4 D$ P$4+D$, 9L$訝 L$9u0$S11:苫8tx$0h"Rb$11҉ $ƅ*ŰPM j PUe ^_[]$0h"jhUSWV01ۍD$,ShPSuY 1NtAljSPSWuWB uMU D$t$$$Q1e^_[]fUSWV]D$D$ PS*$1NHD$ D$(%=@= j/SCxr)ك$0PSQh8#hRD$jP~Jǻ\$$0PS芛: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS9)1@$D$hh S@ ƅ%D$ PV踋D$3D$ 3|$$  D$uH$0PS$8$P$TRPV虡 V@ D$4@D$1$VhN#jSfVjS? ƅxc1GD$ PhFV~  .8u;Vc@ WhN#jSjjSe? Gy D$t P豢<$t t$n1Ox V? e^_[]D$(%= tn=@u$0Sh@#hPzS1Ɖ\$1@$D$:\$ D$ PS0'B$D$jS{> }tSUtN$PhF|@V* x4D$t P覡U$$JhF V$USWVP1hUU= ƉRP*9-0&6t1@fC}+PUUS'G %6;A0u $ytWVD^_[]Ë\$-%650&6SUqRPX$@ `%6ؔؐh P54%6KL 5%654%67=0&6t4%6PPC54%6J8%6[USWVt$(~Ohol0&6tUQM:Չ 1= &6L$$t| tWV:Ɖt$$H$á%6@050&6QPWVsUC cMhml=0&6tUQ9Ջt$( }%6@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=0&6tȋ|$%61ɉSh|#(=$6th#,h#t$" %6QP%$T$1RQQD$PaAá%6;X0t$~~1Ƀ= &6T$DT =0&6|$t RP"5L$ pL$QSRP?ǍPN.6$|$1D$D$t1)ÉعF@jP輓D`r9w<$r$l$T1C @<$9uG<$;|$}%6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡ%6@0)ȃ`T$1ۡ.6ـ#h#蒦=$6th#h# ع`֋,$L$t1ɉȉD$ օt$ tH %6i0T$,RQUt$> %6;A0l$,} $L$l$l$,%6@0D$Mt$ |1TT1PD$T$ ʃ=0&6t RPY2L$(ωQM D$H 9tet$C9\$t$$h#D $64$F4$;t$SD$`1$60^_[]ËL$ ʋ %6f9u Sh^#ԤD$`,t$$h#蜤jF %6Ph#sUSWVT$L$D$0(D$ X=0&6tSU1ʼnӉ OD$$%6@09ʼn} t$t$5D$PSUt$< %6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q50&6t9RPt$ƉT$ O0t$1ӋT$1 t<$G RQ,0D11 u5\$$9t ;D$t`GPD$ GPWTt RP/$<$G L$;L$t9ta щʼn$;D$t`1hb#^_[]USWV %6$%6x0UWt$0t$05:Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR9 .6T$4$1B srl$,$ ȈU1wX=0&6t %6!9GX=0&6tȋL$,1Ph#ʡ .6L$ $  hy#詡=$6th#h#t$D$OPWTP1GTGP^_[]$61USWV|$,P#tU#%61@$%6sll$%6t%6 L$ =ƍD$1PQQV{9 %6;A0-T$zu D$`1]l$z$Ń1EGpD$hv D$ Pt$ u&xMt(T$hv D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh#=$6th#h#qt3s ss3st$Vn[E;,$u$66$t"Ph#`j USWV0\$T|$HOX=0&6t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG0&6҉L$D$td$PQ+É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQJC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"hp#8Ph#8O4$VIVh#h#h h#hq#h^#h hT#hC#hWVt$ F,t@.6th#F,P1~,>d9~8uv0^_h#h#h h#莃D$x,u@Pt PȄh#h#h h#VWV΋I01t*N8~2IN8tPQP PuN0G;~4vɃ~8u^_h#h#h, h#h#h#h2 USWVEH1BT$x,1hs1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vS莃e^_[]h#h#hF h#USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h#h`#hK h#USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h#h#h` h#h#ha h#nUSWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h#h1#hq h#h1#hs h#USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h#h #h~ h#~fUSWV\$$|$ l$t$.6t5 &6SWUh#蘨USWV5 &671^_[]USWV\$$|$ l$t$.6t5&6SWUh#LUSWV5&6C1^_[]V=$6th #2j5.6Gtah?#赌ht#WtS.6xL~61 .6 s"@Pt4h_#踧 .6.6F;pL|^5.6vj.6t'x,tP.6P.6á.6t x,tt$t$t$t$P1WVt$|$ VWJ= &6dtX=0&6ts,%6`uau33 u1@1^_WV $6t1 .6 %61!`u/aʀs2hlpx1Ph#Ph#ht#蓷Jh#%6 ǀdƀah P54%6( 5%654%6=0&6t4%6PP54%68%6%6!1111QWRPjh.6hh#ht#赶lh# %6 ǀdh P54%6(( 5%654%6=0&6t4%6PP 54%6'8%6 %6dPs+aʀu Ph#Ph#)ht#˵h#!%6ǀdƀah P54%6A' 5%654%6-=0&6t4%6PP954%6@8%6^_j<USWV1L$ AL$HAL$@AL$<L$ 4 'L$A 0 'A, 'A( '}u ]hw#WVj}$RQwRPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQt ]Sirt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ St$\D$Phn1#hVr^D$@w ww7VPhS#S 1h#+h.#WfUSWV1L$(AL$$t$@L$ D$ }] h#WS"E aLuKVbtit'cD$ Pu D$(Pu= D$$Pu udt AuZD$ 9!3u~]#D1غ$Phzd@uc tN|$$tOh<2jet$ ut$@u1Oe^_[]h<2j111J$THPT$,L$(HL$x1VVVVV]PoT$4 @T$ƋD$(D$8D$,D$4D$$D$S#D$ tl1# #l1#$L$Ru0QSh#h'3߆D$<r31F4$t0t$hl1#Sh#h'3謆D$@ F9u1H^_[]ËD$j$,( QUSWV|$(jWujWth#W1Nڃ^_[]1VVVjW tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ h"#s,$ʃЃ,$9Չ|ˉ$|$(Wxt h=#'HP ,$9|ډȃ u h[#$jjjW>$\$SGSjPjt$ t$jjW  X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP(DE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q v7 H @AQ@A$Q @QHALhu#S Xh#h#USWVP\$|$tus$W" $"$jPtQ1@PVSjPt$8t$8W E1u>4$h#W VfWSh#W4$h#W 1H^_[]UWV} uOʃD<|RQPh#VJPR&x& $T$W1ٹ|$5D<h# 5D<h "VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjh( 'V 1OujV5D<>uW?,VQ>~Ih#Q1$VQ7 t1Ph#Qx 1O^_SWVP|$1N?u;j S5D<׊ 8u1u5D<h "t$ ^_[WV|$1N?t5D< 1t^_h#t$USWV 1O1;B։ˍD$ j P5D<葌 уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5D<#x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,xJjh( 't$|$ tjVt$|$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh3#VIz1t^_[]1;BB  Fjh( 'P | 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hC#W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1PhM#Q 1HUSWVt$|$ t)l$\$$jWUS~ tWUSh#1hv#V*l$(\$$jWUSL~ tWUSh#V1H^_[]Ã|jWUS11USWV\$1s3h%5D< t^1WD'GtuWh#t$ 1NL'H' Ch%jL Džu^_[]WV|$ P'D'Wh#xu^_USWV t$@\$#t$4)ً$BJ l$$+]\$] l$*l$$Z u $AEAthnu} l$$u)Љى} $KS)‹C ȉC ЉSZًCECD$ $t|$$L$|$t$,t$4RQ\L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh#P%1D$Bh# D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh#u1fUSWVPM(,|$8O] D$1h#uSO sujsWVVuutqD$9!31t$$|\$D$|$|=WDt0L$T$xuXt01΋x1 }@u؋\$ mWt9^\vuSh$W 1HhT2je^_[]þ8#hE.% VM h"# VM hm$蔄WwD$E#D$>#v6 \$ScMv v SNMd'3H d'3;t'3h\'3j S\'3H \'3 \$'d'3H d'3;t'3h\'3j R\'3H \'3 FtHPhL#LN1v6v C d'3H d'3~a\'3H \'3 ]hR"vLN1v6v  d'3H d'3 \'3H \'3 h\'3j R^ Shk$P|$3W \$Shn1#P$ S SWpuhh&W) WhR#K~u(hL/6hn1#hS= Sh}#K)Sh}#KD$Phn1#hS }Sh#SKh#FK$f~ jj hl1#RPj|$7W7 xWhk$K"$f~ RPhT"J d'3H d'3~\'3H \'3 h\'3j P|$G8jm$Sj$P蓴Sh#Jh)$vJG0O4 tQPh$PPhh$3}qh\'3j PFHsF 8-uJF $1҉QQ$$Phn1#hS{Sh#IvG18#hE.% VI h"# VI hm$qWTD$E#D$tD$>#1ot$w7] V:Iw w V%Id'3H d'3;t'3h\'3j N\'3H \'3 \$d'3H d'3;t'3h\'3j N\'3H \'3 GtPh:$H hT"Hd'3H d'3;t'3h\'3j LN\'3H \'3 d'3H d'3;t'3h\'3j N\'3H \'3 Ow7w  d'3H d'3~\'3H \'3 h\'3j MhF D$Sh$G$1۹$v6SJ $|$#v vS, \$'Whk$PS$Whn1#PVVSuhh&Sp VSh"$G GPhn1#hVVh#FG8$jmVj$PưVh$FhJ$FG0O4 t#$QPhRP\$ Rhh$]}USWVӋ$$$$'hW$" Ft h^$Fh$ FF ~1ɋӉ13$ 6@uh$hn$h}$El8|$Vhn1#hW9WuQh$EĘ> t h^$mEh/#`E 1A AAt$Qhn1#hVVhh$h$h$EĔh$D|$uhusuqVh$ohC#Duuulh$$tl1#PRh-%DĜ;8jmWj$VnVhn1#hWWhi$HDĐ^_[]USWV΋\$$|$ ʉl$͍L$jj hl1#UPjQ yD$SWVh1$C|$tUh$R$Cj B ^_[]USWVDt$`l$\\$XT$1 4 'G 0 'G, 'G( 'B0$h$VUF Tt$t7ltytdPD$PS uNtWSu1HVt2jh( 'WAD t9-!3uWhLCD$PS ht2j˽hO&1D^_[]ËD$L$Q P QPIHÐUSWV(]1L$L$AL$A} uh$SWI a~bt)iuRt7D$PV"uUt$D$PVtD$PV^uh2je^_[]ÃluhO&:1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=!3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AX^_[]USWV|$(l$$}L$ \$ t$ T$D$PRVSD$PQD$!PD$$PD$&PD$(PD$(Phd$U4 u/D$1NU8 'tLu;1ɉL$ L$L$ $1111ۉfwfWGO D$ G D$fG1^_[]Ë4 'D$ 0 'D$, 'D$( '$D$fGD$fGD$GD$ G L$ G A똋$t$T$L$ fUSWVTt$h, 'D$. 'D$ 0 'D$1 'D$2 '$3 '4 '5 '6 '7 'PQRVUt$t$t$$t$,t$4( 'h3$j@\$HS<8< '8 'Sփ UT^_[]WV|$ < '8 'Wh%$=u^_USWVL$ l$t$T$<'__^_f^1ۊD CutRQU4'\ ^_[]USWV|$$t  h@h$& ƻSUVɰ   9)uVı T$@fT$D$,$L$\$ $? 04€S؉΃9Ӻiɀ8F8@,$fL$fT$1t$ 1ۉt$t$(.fNfVF^ D$ F D$fF1Ch$W0h$h$WSPh$WV訰 1H^_[]fUSWVL|$`tv\$hl$d1ҍt$1 F0L$D$`lj$T$hY$SUQ tFUtPVW# ufD$P5D<"T$uHh2jTI9-!3u/Sh?KVW u(|$t)ShKVW(h2j˵L^_[]1Vt$|$u>L$ At$H h/6H d/6@`/6 \/6h\/619h/6Fd/6F`/6F\/6F^Vt$|$uD$ hl/60x/6FDt/6F@p/6F <$uȐ $oVt$ ZGU $ɿt$ D$tQh$PK D$Ph/#t$- ut~ d wh}$P jG8Phn1#h$SSh$Vp 5GP[Ph#V Vh$Ï D$bd D$$$Fm~ 1B$/d KƋ $Qh$V "Whn1#h$SShb&V Whn1#h$SSh$Vb wwhE.%V wwh$Vz w$w h"V^ g(jmD$Pj$Wc|$tD$Ph$V 0Vt$貕 $B$$L$ AA H9t$h$t$ t$h$t$ t$ v5t$p t$G h#UhV"UO7PV{\'3tlS ah2j$ VF hm$$71OSt$F 1Ot$tF 6h\'3VVO 1*Uh#$ ä V- t$0F ^_[]ÅtVF h$hB$h h$h$hh$h$hht$v fUSWV]} #D$D$ h$SW iu5D<tFumD$ D$9=!3uUj]$,(ǃD$T$ЃD$,jSit%D$t6h$h2jxjS5 D$ tjStD$t h#w@h#V$tQq "h$Pd )j$PvZ h$Vpd h}$D$ PVd jhPZ D$0Ph#t$ D$0$L$ 11t$ L$ D$Ph$t$ bD$\Pt$ tpt$hd$S< 1O1P|VC 0h$h'$SV\C hI$St$=C ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$PhR$S $Ph_$S t$(F Åt$(*F $fǀU1PPPE8!ƒ[u$t$蒝 ;$4t$8 D$t$rE fËt$01 |$lD$Phb&S D$lPt${D$Ph$S D$|Pt$G$PhE.%S `$Ph$S B$Ph"S $D$Ph$S2 tj$$Pt$ ۔ D$DPh$SE D$D9M$ $ȃhL$pQP t$D Åt$8D U$61QQPI!ƒ~t$ M$$VP蝛 9U]$|$$D$jRP!ƒ=M$$VPD 9E$1SP|$W GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uoh $D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ ; E0t!t+M4S9rQSP 0t,h$ $ MHtU4uL9rRQP t$|$t%u@uhV tI81tSul|$tDEM9rQWP u@u`V u@yu@u`V teEptUt$8ЃtEu8uXV t, ^_[]h $h $Ah $h$5h $h $)u\u\h: $udSh $j蒯 wlhk$j賯 fUSWVt$D 1tvt$oF t[S/ tCPP Vt$H tPUWI uWf' S/ 1S/ WD ^_[]USWVu]Ph $Sj t$f1j?1Nt}ǍD$ Ph*Z$S td\$ t\hjD$P! jS\$S ShiW t$E L$Uf jQh $P je^_[]PPh*Z$t$ u1$YVPt$ t$t$V tPh*Z$V u1$^USWVt$t$ F t Nj\$ P` 9v? 1N*Ƌl$W` VPU )SjU ^_[]USWVt$t$E t?Nj\$ PP` 9s9Ƌl$Wm` VPUb )SjU X K?1N^_[]UPhm%ur t$1H]USWV@uPhA $V7 ] h $VD tP_ |$ P\$$ShiV\@ |$ jS] Ph $u F VI$ ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP] t!Ph $SIF V# 1He^_[]h/%h $hhJ $bWV|$$h $WC t;P^ u1V^ jPV VhiWQ? t^_h $h $jVhJ $h $j$ V/6h2V V /6huV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh $hV%>tVh7 $VFߋD$t$j7QPh $hV>tVhL $V褥F߁^UVuPhT$V t3$L$ AQhiV= u h[$1e^]h/%hO$hh$cUVuPh$V t3$L$ AQhiVe= u h$覒1e^]h/%h$hh$UWV}W#ƉPh\$W tZt4$P<tW@PVZ tGPh$u 3C t>V1e^_]h/%h$hh$Qh$h$h$ h$h$jm h:$t$@ tPh$t$B Hh~%h$hh$WVPt$|$D$PVW t2D$t u Wh$jF PID$L$AËD$L$AËD$L$AËD$L$AËD$ 221ËD$ 221ËD$ $2$21ËD$ ,2,21ËD$H@42 421SV\$ Sh82uCЃ r"CrCr 01H^[h82豙H?r a ؈821ыL$t 461ÍAЃ r)Aw AwÉ 1HUSWV1t$ D$hVP! 02x46t8u^46ǁ464646464646565656 56565656@whl2R&uh $0h29&uh,$h2 &u hD$j $52tvh$2%61"56#56$56D2t2$h82$Uݧ ƃV B~>CN$56F v/FwD$')56Au"hi$a$ '%56xu>Wu4D$P1VhVVj V5D< 0569t$:*ƀ46l `C Lvms2D2u2'56(56r&56+56D$P1VhVVj V5D<H ,569t$taY"56>#56O*56CatTl52+wtzD29tl2x2$ÿ`2؉$D2!3 (56$u =+56uB=46=#56="56u|t =+56u =46uftu^+56uS$ttH)ŋ$L$ T$ RQL$QWPU%u- u&hI"hz$,5D<h%j: t$PD$P & u h$D$t,DtVPyDžuhI"h$JW WtS)uhI"h $WuhI"h$02t H9t@hI"h$$@ uh+$hI"h*h$5VWЃ Wj`USWV+ uhT$hz$j+ Ƹ82jmPll1#l1#t$jL82PIt$USWhZ$h'3(2t VSm#$ul1#WWWWWQWh$h'3$V jV 021tT$q9t Iu^WVΉhjW D$Phq$V` tZh$VN/ tQPAJ L$PyRPQ# WhiV* u h|$"Ĕ^_h~%hi$hh$mWV h$Q. t;PI  u1WI j PW蠲 Whui V^* t ^_hj$h]$hih$h$j. h6$21ÃD$ 1ɉJJJ JJ BRhiP) t1hm$jՕ $1ɉJJRhiP) u 1Đhz$j薕 Qh82۩USWV΅t R* ( ( 0($D$P:!\$D$1t$$tsV<sD$tVPVh*Z$W trC=%56D$uCt\=&56uCuM=*56uCt>=)56uLhj$V VhiWn( t!$uۋt$$4u=(56t ~ j h\'3sqWt& 02ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPh$h$VVUhN$  jl$U$V裯 Vhit$ t$,$t!Phl$Vh[$`|,$jt$VN Vh~it$l t$tPhw$nj ꍄ$P$$ j:QPh$h$P$t'$Uh$UɍE}uj:$$h$h$P趲$t'$Uh%$UnE}u- 24$tVWUmuj|$W$V $$ DŽ$@Vhit$V u$ h2$ 1@Pl$U%jWl$0U蛭 1@D$81D$ƉPV5856 ǣ456V1u 856$hݣ#Z1H^_h9s%hZ$hh$WVPt$T$h$VP tbPA7 V7 PWttIƉPV5856t ǣ<56V1u! 856$hݣ#1H^_USWVt$T$1hi$V thƋ-856P6 Ve6 PWst6ƉPWt>VD ݉-85611H^_[]h9s%hf$h2h$轾h%#fSWV|$ t1H>t$|$\$j> PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V3 tE$$PwCt/$F ~G F1G : 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPk Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} }"WV t/t$ L$Ps(,tD$$F ^C F13 USWVuD$ tV} ]CtP7 tEC tP7 u/D$ Phm%7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V@qt|$,$h%WD$a7&tD$1{tj/t$HtAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$D$4D$4D$ PD$8Pt$ t$ ÅuD$ x+1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WPKh t9t1ۉD$=r;"11HD$$P|$1OL$L$D$L$T$PQRh$VF 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P莩NjD$fVSP sD$ t P4$Wn. WĹ<4$uM S]s {te|$t^t$Vt$t_@PW- WTtNVsE0 ߉Vu> ۉt3EF ^C F1Vt$h$h$h$h$ h$h$j{ WVt$tVAwr1H^_V t3t$L$|$ Pwt΋D$F ~G F1製 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u's<$t@1@>].1-t P% 1GG GG-1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7q t+{0t>-uUsVt>VsFt)uD 71H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1$'4v6# !6 P4  v6 tMtk $t$ 4$UQ$t^h)!$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh$jIb 脤1Hx^_[]h !$h $ja WV0t$<|$jWh$V萴t8W t7HfJBRhiV t!10^_hu $hb $Wh $j{a h$ja SWV|56hT2VS56h(2W@VgW^56hdV356hW56hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!h!$$HQPۍ\$4|$fGWhiU t$!$f|$*u!$=#56t PfD$(WhiU t$!$f|$*u!$=#56t PG|$fG WhiU t2D$*=) Ph!$=#56t h!$fD$(IWhiU> t2D$*=) Ph!$=#56t h!$1Shi8U |$Dh!$o1tPDL@uShi8U t$HuM1|TuD@uD$L|C.3L$P9Dzty:t|$jQh!$] uVh!$11t j,DLxPtT h!$v<u h#j $PhiU tDh!$V$t$h!$8 h#)j ?PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR襳 Ph"$$=tPh"$j $=tPh!$q^_[]Ph]!$j\ h'3jhh"$qÃD$1ɉJJ JJ fBRhiPm t1h$jV\ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h$j\ USWV,$@$PhiV tr$A jjj"nM xgljj2 xi$-hSW4 xB$/uE$0uf$Ciu.h$D1H h$Dh.$DW5 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h$hU%h$h$hJ$h$h$QL$4Qhc$(D$f($-D$](E!L$:!PS E P蠰 $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q 56t 56E56tIAtcAtCAtPA tSA@tBAyAAT$h56UWt$PVt$D$VPRRh$蓾,l$ }"E!Ê<)\<$'=#56`Cs|$[VPWl$Ph$h$ #<*<0<2=#56<$$<t$sQhk$ӽ#1L;l1#y$QRPh"螽G%9u<]K%C=Ph$hk$X=#56S<$CPh3$6KPh8$ K s k t?L$D$F?$PWh{5% NZ%܋L$D$(Mu} L$D$D$FD$PtPtPu$U$ u$"QPh{5%W NZ%D$ŋL$D$(ȉ</=#56%<C<$,'$=#56CPh$=#56CKSRQPh$h$譻C~@sFNuQPh,$u IRQPh"$]Muj>ml$ L=#56?CPh$%(sh $hk$ =#56<$CPh3$KPh8$ҺCk tAt$D$x?$\PVh{5%螺 OZ%܋D$t$)E}twt$D$pD$ttu$U$ u$"QPh{5%" NZ%D$<t$)ƃl$ rPhI$j><$€$$'$rQ=PuJC<u;h$hk$~=#56yCKQPh$Z ]=#56Pȹ$6<"<{$$  $#$-$5$=$E$O$T$]$f$m$h$hk$蕸=#56<$CPh$s1D3 l1#t$T3 ׃l3 URWPQ'h$1uj>?l$ <$v$CPCHÃ)gj EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h$hH$jEQ WVD$(1www ww7fWfGfGwWhiQ6 uh=$w:1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQM ;l$D$tD...P7L^_[]WhR$QM 1<$tɍGrD$X1.Ph"ST? E;,$sGwUSWV։ϋ\$Qhk$WK)Ǎ 9~)j<ݴt+~'K1.Ph"蝵9t OE܄u j-蝴j>蓴^_[]ø w'ø"øSw'ø"VPt$ D$Ph$V[ tD$P^h/%h$hh$VPt$ D$Ph!$V tD$P^h/%h$hh$跊WVt$(|$WhiV tND$Ph $V要 tCD$D$WhiV 1uh' $71H^_h $j|N h/%h $hh$#fUSWV8` y h"$7h7%93 y h"$x7jh#$艹t\.L$jQP D$tPh$$ 7jh#$1 21 VPh  VPUSWQRPh`$1EVRQUhBVWh&. 1H\$(C CCVWPPUPP P P PPPPS8VSj@% |$www wwVWjߍ VWjӍ V ' S' W& D$ @ )T$VVQRWP@C1I9u 聎8tމ556 2tщ1@8^_[]h%$_5j jja h$$a u8$$jVKt$$jh{S$h$$Vh#1"hi$S j 虌j 蒌USWV`~ZD$=56tIt@ƍD$H@ L$1jQRRjPBBut$Vhg$$< 1t$HFFF FF1G>\$SVjQ l$ UVWB +ƅZ21OjUj~ t:9uB$=h#$jVs$  nj8uh 29tttn1VSj裋 VD$$Pj蓋 2vh#$@jjj 1VSj_ VU6h#$1=2u$=|$ u'1VSj' VWj `^_[]Ét҃t̓ u1Ht$8F FFV" Ph$$u1#$WVt#$D$8x xx8WPV! "1"{jh#$h#衃 i$SW2G Whu#$jVSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á56H 56t$Vt$VPh"$ijVE2VPD$$Ht5t$ I?rj$ !P$Ѕuσ^PD$L$ $QPj螜 oXWV1N=56tED$@ L$1҉RRQWjP>t4$ hB$$^_VQ9# jh'*! jV tPQUt^Vh$$>j"Vh$$)j PD$L$ $QPj輛 荛XPD$L$ $QPj蝛 njzXÐUSWV$$D$D$D$,1H$11D$h&%$WSR f~/P w`1A$'5D< D$u[FtR=5D<D$,D$낃gD<8#u(@j L$ QP!0 $D$8LD<Pk@$)D<8#u)@j L$ QP/ D$D$8D<L$QP苚 j D$ P5D</ D$D$8c1Fj D$ P5D<U/ $D$85D<hE%$8!3<=56u-56~q5561ۋtVPxuJVhk$EFtPh'$/FtPh'$j /-56C 9|?,u)É\$(k <D$j4V D$P'V Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0覅1ɉQD$ P4脵 D4D$8u 8tz`Xt$756u 56-56CPV&wt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP jHT |$tt$ VUW2V  UW6 F8C|$$8D$@PWtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW{t!t$ VUWU #|$$tS9u$UW RWc $D$utSPW uWh%$|*1ļ^_[]Ë .3DQu'hJ'&h E"Wg1^_fWVt$ |$7' WVUSWV$$l$WVSU$$hhU3WhM1"= uWVh"j) D$@t.D$t$QPh$'hVcWVJjUSWV$$$1hWSh 8D$$81G=<<=!3D$ C|D$D$1D$h=+$UV4 T~H wV$"' $׃Gt!M5D<L$ 뱀L$5D<-$Ax|$뎃UL$5D<($At|$_ $V $M5D<L$|$0P$h#'5D<=&P< $!3)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PVt\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]h·"j' Vh$gPh+$h'3 jfWVPt$jWV 9u9t x^_Vt$h"j}& Vt$VKt@^h"V^Vt$VPt@^h6$V|^WVPt$jWV} 9t9u x^_Vh"j% WVt$|$ VW' t$?/tWhÈ"`Vh܈"R^_Wh"j% fWVt$ |$7 WVSWV$D$\$VPWS$,$,njS7VhC/%m9 u$gtu!D$"t$"jZه"~g0yPVt$ h/"j$ USWV\$ l$|$t$1E1@<<!3h"WVn0 ou%jSh$'5D<9tEPF9ǃuA!3)ރu4t$$V4Nut$(t;^_[]h·"j{$ AePh"h'3q jgfWVt$|$ VWS t$?/tWhÈ"茜Vh܈"~^_Wh"j $ fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Wh&%7 uWVh"j# D$@tY$$QPhD('hVQV$$$$$h+$ψj5USWVMu1} ]hD$ PVra D$ FxD$D$D$D$D$h+$WS2. L~)Hw;$&'5D<Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5D<L$1@D$kjuh''5D<6P6=N|45D<W1@D$5D<Fp1@D$5D<L$ 1@D$!3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ *tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W/ WC@$N|dže^_[]h·"js t$h$3aPh&,$h'3c jY}WVPt$jWVf  9u9t x^_Vt$h"j Vt$VKEt@^h"V^Vt$VGJt@^h6$V|^WVPt$jWV  9t9u x^_Vh"jX WVt$|$ VWz t$?/tWhÈ"Vh܈"貗^_Wh"j? fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh^$2 uIa8KD$  =<76%D$ Vt$S jHSt$D$@D$ $p QPh,,'hVKD$tS\$O$oj j ShWt$ PStPcPhr-$ot$ SWh-$蚃t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h-$\81p^_[]WVh"j jzSWV\$D$@u+t$t;SP t7VtZ1 66C66C^_[hJ'&j2 j;zUSWVPL$$T$ l$\$1$1<2֍zh,$USe( @~7M$('OӃ23=876<76먀'룋 D<DF@N@늋 D<IF(NnOe D<R2KF ?20O' D<aF8N 476O D<g\Pw<D$ p4t$ N @OPt$(h)'5D<H0Ƌ$t 476t'tOt@tO t=876<76 s=<76876g@tOy 2sg st1A T$ J sh"V.@76$fyhQ%V-L$ A$I$sh,$V-L$ A I$sh,$V-L$ A$I$sh,$V-L$ A|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3j)9}h2݃D$,|%L$,9QPh/$h/$x3U<1H ^_[]fUSWVd$xj[Vh76 j@V't4$Fj:V FA $$|1D$hhhhh hh(K H|$WPh^$VWtPDWPVh/$蕊 #CD$D$ @4$D$ UhD$PX D$,$Uj$lSh2$Y=86<$=D<h$W0u$86G=D<1#PPjPP21@D$$D<1"PPjPPj86mD<1[8$PPhPh<(86P9D<1 3$PPhPj486 =D<=86j:WLAj/W9.?y86D<5$l$0UU݋\$UW|$Pv <86886s.3DH,WѯD$h$Wz.h&Wd.76W 86N19$PPhPj 2,86 .3DHW=D$<$76hz3$!3=2_= 86tVh3$z5D<hl3$j5D<h2$Zh3$Ph·"jF WhV3$9WhP;$.D$ =86u1=86@86$1󫍄$,B76Al$$+D$ -86t1$ 1D$$$MljL$$ PW!?t$h;4$(86l$Ul$RQP( $׉ȉ 886=<861| h4$$t/$$T$9‰sQt$t$WPh5$tFtA (86WPU0 u5<865886t$hY5$|$(F=$PUw uRt$ht5$f A#$=`h@86hc4$1= 86 $Vh,Ku Vh5$al$VjD$P3 886-(86-<86݃=86~VUWt$h5$Y|>9|Pt$t$ O )̓ }4$1\$l$ 7676ɋ|$  76=86 <865886σ|,@σ|1ҿ9  (869|щ 76|$ D= 86Ejjh@86 .h@86h4$76=86t7686t&hQh5$5k 8676t=|hPh:6$ k =76u1=761@76=086u 76086=2,=76t#jh6$h6$h~6$j76=,86u=276,86t$t$ t$4Ut$$Vt$t 9t Vm t U_ =869$Pt~Eftƃh22$%Ej N.Ph6$jd$8PU j j j hW%9 D<6$(86886ApQt76@jxQP$Ph22$ g830NVh6$jd$8PU$T $|$8jU$P/s $,PS$u/jZ$P$\PX u$4mfsjWV 9uD$8%P{DP$Ph6$h5$|$D$D$4jP $u/h@86h4$$Ph($jX h[#j /dev3@86 D86/ D$ E86tD$ @86<$~~l$4 $jWh"K u ƃrl$Wl$$Ux#MGWUe#:l$ ʼn\$4Ë$H$|$86\$L$ u D86$T$dž,<tx(=86dž dž,dž(Ɔ 22u(jh;$N=86-5L<6u"jh;$N=86,5L<6 76N076F4Qt$Qh%<$wN=86w,5L<6F4Ht$PhN<$LN=86S,5L<6F4 (869}"QPhz<$N =86+,5L<6F0=)hPh<$M =86+5L<6F0=|)hPh<$M =86+5L<6F0N49}QPh<$M =86+76L<6;76|QUUUU)ʹ3333!!сis{09\~\{0\\576sXș9}%CX=86~Qh9=$LL<6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hQ=$K=86**L<6{4$=(8611F9tA uPh?$j $Kd=<865886 u։<8=2[ WVh=$HK =86)L<6<$C4$8=(86`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPNjs8ƒPVRWN)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh=$I=86'486tm L<6yxH1҉$q1ҋ8$$)$<$$1C$I8$ 086=L<6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W1C1 t׉Ë$$QPV$$V9s($$$VÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQx$9wȃr$9‹$֋$r‰$$$$$B1WRQPË$Ë$ʃQPRSEI)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ^j$P$$膿@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh=$^B =86 L<6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=2$_|HL!ʉG41SSjhjPS衝\<6N L<6I4QSP- L<6H `<6 \<6 d<6P44Q5h<6щ l<6`@#HL 9| Hh 2H< 76HX ,86H\ 76PTXH fǀ$d%=L<6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=25O _(HLJ$ 86$$$t!LJ^F=86$$߬$$ڌ$X&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$>$< L<6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$J>$<=L<6O0 9| IУp<6t<6=86u\Tu))Уt<61VVjhjPVdx<6up<69t<6t<65t<6jP = 86G<86 8861ظ|(RQh>$; =86<86 8865x<65(86~ ș)dہ|41'GuȹC=86tL1$PP$$586V1=(86VhZN (861u;1$VhjVu  =x<65L<6h`VW" =86tWV5L<6x\x<6hhP2 1@$=86h?$q=86|o5L<6N,I\Tt~!NȃN׊Nd1 t1WPh5$RR]8$j'39u1H$Whht@Pm PPftu!ѡ86t $ Q$= 86u$|&L<6H,$$DŽ$%$ L<6I,$1$ DŽ$1h\'3L<6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h(@$n=86Y L<6j5P<6Q 5P<6FU $F +$^L<6$~J`^p=2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=86uFh$ NlK`ڍOȃ$ډFd;v&h @$l=86L<65P<6F $11ہ~U uv`щSAL<6$~!ـ1@ P<6Il L<65P<6F=2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5P<6N uҋL<6B8H!tk)D4L<6B8)Nj5P<6$9sE)ȉـ1B~U uv`5P<6F$CHu͋L<6B8$؋N9ȉ$J`~U uv`щSL<6$~!ـ1@ P<6Il L<65P<6F=2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45P<6;Vs2р1@~U uv`5P<6F$BɋL<6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$d<6H d<6V$P V PV~x; h<6up=86tl<6s4PP L<6`<6@`<6Kd15l<6s4l<6d<6 L<6q4jP L<65P<6{0 9 x<6PVQj =86tx<65L<6P5P<6g L<6y0x<6$ryxtG$\T%TuCl$AP$ L<6Ou$ց\TtQ!QЃyId t15x<65p<63 5L<6\TG~8^xN`1?9't<6+$~0lj$Ɖ$)ى$=x<6$S%Glx<6t<69wߋ$9w$L<6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=86} $H$$$~A= 862$=|j.E,扄$l1#td?% L<6ׁ\TtQ!QЃYId t1RP$Vh>$,$$;$$|W=869L<6H,t = 86 $$ DŽ$j G+DŽ$CL<6;X,/$~ j += 86 $hjP 2 86+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A)$h $l2fDŽ$2t2$_ lj$DŽ$L<6H4$ $ H5L<6D@VL!! $`Nd8( fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$2@ lj$DŽ$ L<6H4$ $l$h  5L<6D@~L!! $߉$Nd t1$Sv4$j2L<6@0p9w Au1H$$DŽ$1$$t' ǡ 86L<6@0586V$SQP$h$l 86ɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=86CX$tFDŽ$PQ蔙18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$P L<6\T$$i$$ $$$$DŽ$H0$$_$ L<6@$D$@L!! $`$$h $l$  L<6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h L<6@$D$ @L!! $$w#$k $$h$lL<6Hd t1$S6j$$V L<6$ȔȐG$11F$t =86$$=L<640=20w4w+_1x<6$`SWP $PjS =86t$W\=$86tx<6ǀ\8 L<6=x<6x\hhPz (86QPWV=86t\<6 L<6q4PP׸ 5L<6HLNd t15\<6v4t5l<695d<6vG=86tL<6p4VVx 5l<6`<6@`<6=L<6Od1Vw45t<65x<6^L<6@4P5\<6Ee^_[]ÿWjV\ 1=(86VW\h#T"Bh?$2Yj&j%j(D<6j jj'{jth>$Lh>$BjYjRjKjDj=j6j/j(j!jj USWV= 86ua΋\$=86t(86D<6St$P莤 4׋ (86UPSt$$5X<6 9u^_[]0PWVh~?$!j$zUSWV"= 86΅ |<6uL<6H4H p<6 |<6 =(86;886<86L<6;}FWh 1'1I!;HtG#P;Pt;H uV9R_1ڍ_5x<6P=(86Wh De^_[]USWV΋L$l$=86t= 86teUjQp׋ (86SPUt$$5T<6脘 9t?0%PWVhX?$aj"(86D<6UPQa ^_[]SI`wD$$0'1C:Qh>$h'3v! .  [SWV1ۃ=86։ SjQ =2@fF F)f ^_[USWV Ӊϋ5L<6F Nd t15P<6G=86tP<65L<6PP跳 P<6yU +y/\$|$y1U =L<61=U L$D$uq`|$ G`Ӊ $u щw*l$$0'р4l$skPh>$h'3 =L<6P<6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah@$ hw@$h@$S11҉ ^_[]ÉՁ|$U u L$I` L$w$0'ʉـ1@BPh?$h'3 8ʍ 6ʍ   1$5L<6$~3%)1@ P<6Il 5L<6P<6K=\<6Od$sC=2CNdЋT$ t1҉t$VQPRh{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRL$|$ щT$ՉD$ȋL$D$VW|$RP:ыt$ʋL$Vt$QRPb$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45L<6;F8|$}X1Bσ) P<6yU uI`1@5L<6;F8|$|=86tP<6VPP 5L<6F Nd t15P<6USWV$΋=L<6G Od t15P<6=86tP<65L<6PP胮 P<6xU t)h@$O=86(P<6xU ‹l$(H $t@\$=86tP<65L<6PP =L<6G Od t15P<6wL<6\<6HC, $9r%UQh.?$ =86VL<6 $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5x<6WL<6\Tudx<6jpxt$0t$ $<=86WV1L(ɉL(@ u1LXɉLX@ul$x<6jpxt$0t$ , $,;=86trUV胪1tttp訇TtDpC u1肇Cu) ;% $D l$hVUC :% $D9Pl$L<6T$5x<6p0^_[]j j WV։σ=2ȃ@PQR =86t'ȉGffF=2u GffF^_fUSWV$8tW豯 ƅuWh՗"j $$<$4D$Phd@U tg1OVhedAUq F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh$t$F 1 ShE"U CPhV"U C Phb"U CPht"U CPh"Up $@D$t P8& 1-Uhzd@$<Wx t1 VhedAW] hjUD D$ P$4oD$, 9L$L$9u0$S11:8tx$0h"蕖b$11҉ $ƅ*ŰP]j PU ^_[]$0h"j辬 USWV01ۍD$,ShPSui1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VW? t$?/tWhÈ"x$Vh܈"j$^_Wh"j fUSWV|$$\$(SWt$(t$(] )jj`SWō~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP諂E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj:$u Vh5$ <6<6%<6ʼn߃=<6~VWUt$h5$C|>9|Pt$t$y )σ}4$a <6-<6uU-<6uY5<6=<6<6@19lj| 19ǃ| <6u <6͋5<6=<6<6ˉjURPk=<6l$ <6uA@19lj$ $t$u h<6h4$jPVWv|$wext23$2fs3$ Wh"h<6h1'Vh<6h4$} 19ǃ} h5$ <6t$VUt$  U.z t 9t Vz jUSWVӉ $|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph "1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h0"3QPWUt$t$hQ" QPWUt$t$h" t$t$h"j WV'3PhLA$V  1GVWjh"7Vh1'{WUSWVu} D$8jPߜ=@65@65<6%UUUU)3333!!щ%i<6B<69922T$u tv|$΍Q@6@65F6 F6VT$ F6F6ډF6P…Ƅ!) F61f1ҁ‰t$$r=<6<6\$9D$ F6T$@61t$$ËT$ u׍؉)9H1D$ 1<6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ<65@6@62t$ƺQ=F6D$F6D$ F6@6D$@6@61 @65@6D$8@6@6@6S@6@6@6N5@6@6 A6A6[A6fA6˾ fA6A6 2fA6\$H$SW|q 93rWhA6n 5<6|$t"V/YjVh(A6薖 18A6D6|A6xA6@6D$ A6 @6+ @6 1҃r1I15@6~σRVPW"{5F6H19w+5F6|$OL$)9r΅u  A6f5~A65<65F6VOF6YVjP( GD$AD$ 11L$\$@6@6tnA6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& F6@ A6t ~A6 F6@ F61HF6L2 F6D1\$;|$t@6)áF6f\0 F6D1 @6u\$fT1 F6T1fD1L$ G;|$tD$ @6|$11t$@6@6=<6~i <6 i{5<6Q5<65<6PRuh?C$ @6 <65@6PQWh|C$sF6@F6F61QQjhjPQzYF6I 5F6jP  =<6uk<6 <61! V5<6 1N1Ƀ *p&Fu  1@D$$=<6|>hF$2=<6|(L$ @6 @61PQh5$PP D$$j'39u1H|$LWhht@P" PPftu!ыt$<6tL$QT$=<6uL$L$D$ 1D$L$ 11T$h\'3ί=@6t$tXA6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5 A6@61@6 5F6D$ hh@6P謰 5F6F6P5F6Vt$芰 =@6=@6 F615<6ǡF6)؉1t$ P =F6WjhF6 F6H9|$u_@65@6 @6)ʍZ9s1GрF6B9r)F6VhP  t$ 1Ƀr!11ƃF6Cω 9rωp 9ǿs"ˀF6CI 9rޡF6L$  F61ҸF6Pt$ 5@6VjF6Pl F6 F6L$)QhPK u1F6@ uF6L$ D F61ҾF6Vt$# 5F6jV =F6tb1=F6t 12'PG6F;5F6rF6L$ D F61hF65F6 G;=F6r=<6t$|\tX=@6teA6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=<6|$T$T$|ʉj.t$몸l1#|$|$td?% @6 @6jQt$,Ph>$T$;D$_=<6* F6t=<6u&D$ D$D$j u1h#?~ j O=<6d=@61 A6$hjV fF쀁fFD$8FFF fF5F6 ׉؉t$ ֍$fBt A6$,F܉VDF81 L$ F4D$4z F61CL$ =F6WD$(\WD$S5F6tPjt$0 ~A6 9`L$97|$0N@6L$,ʋL$(T$F61GL$ T$D$ A6D$@6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP L$ D$1t$V F61CL$ \$~A6 F6=F6t$,9sD$()QjP, t$L$ D$41ҋt$(VW'V$Yj=@6tA6t +232$2@1=F6à r t$hhjV fFAfFF6ÉFD$8FFF虱 F6fFfFV F6AFmlj\$r*D$p1ۋ F61zC9uߊ F61hF65F65F6f582|$D$1ۉt$ :2x1ɉt$)rF6RQP Wh42F6V 42F6D$ fF6 F61Vt$ \9\$t5F682D$ CiL$T 1VhVD$pP 95@6tA6t22#2fD$TAfD$V 2ƉD$XD$8D$\D$`D$dկ fD$lfD$n F61@D$pAD$| F61hF65F6iL$Tj f A61ۃ=@6 5F6<hh@6W详 5F6F6P5F6V葦 5@6 F615<6ơF6)؉1WP5F65F6nLe^_[]hD$hE$ D$hD$Ph>$PhD$hbE$VhtA$RhA$PRhA$hVhA$hVhB$RVhHB$WhB$VPhF$hF$vjVWt$hB$ghB$`hC$Yh?$RhC$KRQhC$BC$1HD$'hD$hD$"hD$hD$hD$h,E$ hD$hoD$j USWVF6=@6trA6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(F6Ѓ A6t ~A6 F6Ѓ^_[]SWV=<6u0׉΋ <6\$QPSt$ 5@6f 9u^_[WVhF$h}F$j USWV=<6΁ F7u=@61 F6 F7<611;<6-<6ǡ<6@69v@1Shd4'8!;HtH#P;Pt1A xVWhPG7hfQ$ h_Q$Xh'3H81B I8H8@H8H8I8H8I8H8I8H8 H8 uCءH8Q8H8Q8 H8 Q8H8 H8H8 ؉+H8H8D$HT$Ll$HH8+H8D$8D$85X&v?|$ D$ fD$l$\$4l$ D$4Ӊ H8H88Y&whG7 R8R8 H8H8R8H8ʚ; H8H86eĉH811ۋR8R8D$T$ ؋R8H8D$H8D$H8D$5H8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05X&8Y&t$v H8H85H8=R8|$(t$(|$D$ fD$ l$ \$,l$|$,=H8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5H8 H8=H8F7t 1AF7y7dH7 `H79}(R8i-@=B'H7@9uR8e^_[]h!Q$hVI$jk USWVhH8j] 8G7X&\$Du{'-H8H8D$hD$h5X&\$Dݜ$݄$hH8j u{(-H8H8D$dD$d5X&݄$\$DH8;F7D$DH8 H8 t]+ H8H8$$߬$H8+H8D$\D$\5X&@Y&s=H8uZF7tQH8 H8 t5+ H8H8L$xD$|l$xH8+H8D$XD$X5X&wD$DD$DH8G7 X&w١H8 H8 t>+ I8I8$$߬$H8+I8D$`D$`5X&D$Dw\$8F7$fDŽ$jhH8jA D$8 X&|$&D$& fD$Bl$B\$Tl$&t$Tj$PPB SD$lD$lPD$,Pj5hH75lH75F7A <hH8jJ lH7D$8<BC97)؉D$D$8 T$5'\$A9pH8I؉L$A H8Iff9uH8H8`I8H8\I8H8XI8hI8 lI8uH8pI8H8lI8H8hI8 I8F7 1D$1蜩8 臩8l1A hPhDP$TD$ F7t$؉T$΍T$(jt$F$5'hL$΍T$(jt$JhN$΍T$(jt$bF$5'hN$΍T$(jt$$Fft$NfQPh.O$" ΍T$(jt$؉t$hIO$΍T$(jt$^؉t$haO$v΍T$(jt$z0FT_hzO$G΍T$(jt$9FPhO$΍T$(jt$ ؉t$hO$΍T$(jt$؉t$hO$΍T$(jt$d؉t$hP$΍T$(jt$9؉t$h9%T΍T$(jt$X؉t$hP$)΍T$(jt$-؉t$h1P$ChO$/PhO$L$lL$AQ D$iPhO$hN$ hN$hN$NhQ8hO$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظK$L$dT$C;,I8u#Ph0I8QD$X-L$$ D$L,I8PQh0I8i~ T$ҸK$u1GK$T$PL$r |$ rId'3H d'3~\'3H \'3 h\'3j R(  }T$A{^N2D$ˀ) hK$uPt$,p L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhK$hkK$s9 |$ sSd'3H d'3~\'3H \'3 h\'3j   }KF߉Ήs(T$hsK$L$T$؅t%d'3H d'3~\'3H \'3 1I h\'3j rh\'3zء I8;F7*؅tءF7!^L$AQ T$Q=\I8 XI8 t+)|$L$p|$tl$p`I8)ЉD$PD$P5X&xI8xI8I8I8H2vH2H8vH8\$CfK%I8f!tQ8 I8T$ .KfKfI8D$ H8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$JH8@)t2(uK Q8F7t1 Q8hJ$ Q8 F7 PVhJ$P PhiN$hL$hM$h5M$AfPhRM$hwM$hM$hM$hM$hM$hM$hN$hN$h$N$wh=N$mhWN$c Q8hJ$1BD$D$pfP2@)f~\F7tSωL$!ȹT$V!RPt$ hK$ T$ D$,F7t1RT$D$fxf5P2F7ruTt$,] L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B`H7C9D$=F7 ؉T$5dH7|$7H7)RQPl GD$9L$~D$8:H7uG9u߅uQt$,苽 L$IfɋT$8RD$4\$T$T$$T$ $L$E5dH7)H7t$>RQPh5K$dH7;`H7}0u hm$sPhK#aCы\$1B\$D$\$D$T$jhEJ$j|Z 1AhE"WV袜8I8~bI8I8 d'3Qd'3; t'3h\'3j.I8 \'3Q\'3.H I8by`)I8I8 d'3Qd'3; t'3h\'3jOI8 \'3Q\'3H I8|tN=I8t4d'3H d'3~\'3H \'3 h\'3j I8I8h\'3sh'3sH8 I8H8$I8H8(I8D8^_jjf1A1= I8PUSWV׉E\$1AMF7]E uWVhK$4t hK$#ShK$F7t5@D$ X&\$D$$K$ٽF7fyuh'3je^_[]UVh1AtD$PG7$K$腽H8D$$K$p I8D$$L$[Q8tD$$'L$BH8t9+ I8} $8L$!L$LD$L X&D$Ht$H\$$[L$$  I8F7 Q8L$DD$D=xI8@|-I8X& H2 H8\$,D$(\$ D$\$D$\$D$$nL$?F7\I8 XI8 t5+ hI8lI8L$XD$\l$X`I8+pI8D$@D$@5X&I8 I8 t7+ Q8Q8L$PD$Tl$PI8+Q8D$L> QPhiP$lF7tkD>L> QPhP$F|>uGD>F7ufPhP$"L> ffPQhP$ȸ ^_[WVF7u8jjVJ t'86* PWhP$hhQ8!"6 Phk$hhQ8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hR$ $t$t$ t$SPhP$շ UPhP$軷 t$t$t$ hQ$袷t$& PhQ$舷t$ Ph%$nr0G9s'GPh"H| KG9r߃$^_[]fUSWVPƀ8-uFh"V蝅u R8h"V1u R8T$,11CD$D$h'S$Rt$0\ Hw؉$(6'\$̃duE뻁뱀=R8t\랉\$떁댁낃u1 !31;L$(uj }1L$ 1ɉT$Љ $PKL$Au $AP|D$t2ڋL$ PWx7 WKf uމ$D蘳uY|$uj3 DžuEa Pz$t8=R8uIj Vh" Wh0S$T1FVƣPhk$V3O SU\+ h"=R8Mj Vh"輣 Wh=S$V赣 \$l1#I"qS$VWS[ jjVWSM\$u& 1GWWJWj?Wj4Wj)WVWj VWu( u hsS$jN jjX( u諐S$8j u*& j j j( t)qtOQ j j' uAS$8t1Aj jh"s ukWhbS$jhS$)t$U) S$Q60WW}' S$tl1#V١PSh{5%WEM SWhOS$jAVB7&=R8ul1#VPhS$h'3Ej;fD$tPhT$uݍhx8'PhT$h'3jUSWVPu } hx8'WVGX cR~5StET R8͍Hw4$d6'R8벃LR8R8둃ftTdL R8tR8eR8VR8GR88R8) !3=S8=R8tjjh-#%l% S8ND$ jjj"]= S8jL$$Qh@hP~ u hr%4S8i )ލ<S H $6'=R8t1Aj D$<1CPS]D$D$ PSFD$D$$PS/D$D$(PSD$ D$,PSD$D$0PSD$D$4PSӀD$8|$ |$z |$o |$ d |$Y |$N F S8D$8gtj5S8% rD$ D$l1#D$D$l1#_;-S8S, t.H$1ۃ=R8uWhIZ$h-Z$h}U% >ha7&S}g =R8uhZ$hZ$h}U% 1CS8FLCSS H3 VT$W$6' \$@1ɍP$7'0S81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 128S8#S8L$L$# 1AD$ PD$@PD$ D$<+ S8R D$ Pj$S82S82S82  S8$S8׋t$#D$ PjS8d$zT$ ED$ L$TL$@JL$CS8"2-L$#d$d$d$L$׋t$@S8:XS8@.`S8"HS8PS8 hS8\$ xS8 S8$S8 t (S8t  S81SSP L$Y\=R8j$)/jD$D$ D$l1#D$l1#S8L$9a|$u q S8 S8ta|$  ‰4 D$=S8T$tD$1@D$ 41ۉD$0$hxShS8R atgcuL$S8 S8S8(V8@(V8S8S8S8S8(S8 xS8 S8tJt$(~A|t1S8t|$ ObTS8S8tPt$ tH@WVhS8, S8=R8t=R8u4[$S8tMD$tH@Vt$ WP, =R8t=R8uL$A[$S8tDD$(tIAVPW, =R8t=R8uL$(O[${S8tDD$,tIAVPW+ =R8t=R8uL$,][$.S8tDD$4tIAVPWg+ =R8t=R8uL$4n[$S8 tDD$0tIAVPW+ =R8t=R8uL$0{[$S8)f=S8=R8tP=R8uG=S8t4d'3H d'3~\'3H \'3 h\'3j kS81=R8IWhS85S8 u+߃87tՃt)7|$t+u-Y$/9|$PhW$!Y$|$Y$ P衕PhW$蟹w83u=S8t"_1ۃ8=S81ۀ?D$ Sh%#hdZ$ hZ$hZ$j> WVT2t#|$ T2WPrtFuT2F^_USWV,׉1l$u5S8V5S8 D$ VPUhS8WSS|$G"ww Gw\$VVSVjW5D$t2Pj1PPSVjW4l$=R8t'h[$Z =S8tt$ hW$P1|$94D$=R8tCхL$% D$@S8t Ky9=R8Cx$CD$CPS5S8; uN87t 9D$=R8u{=R8t i5R8jt$ P&X$PZ$tH@$5R8P|P&X$P!h:%% 9VoyE~t7tuY$Y$Y$ P|PhW$z1G,^_[]PhW$hW$ h E"hW$j; USWV0=R8AuF8,r!48'h"Ph0X$:aPh[X$'PhaX$F<5$7'vvvhY$F|$(QPh&9'RWh\'3PWhY$諠F(8'QPSPWh\'3PWhY$pF QPSPWVh\'3PWgV xdvvh~X$* V!u:'t8'~ H:'tF\$(RPQhSgh\'3SV e^_[]FPhX$躟FfhY$F hl1#PhjX$胟 F|$(QPh9'hWbgh\'3WtVƘFPhX$4FHfw6$8'hX$chV$ Ph\$Ph\$6hX$'hX$ hX$h"连hX$諞1H9vh[$ -NT$(PQRU FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPhX$3D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$Xh Y$莝PSVh[$迓h\'3H^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV$+D$  P;Z1PPWSjV$|$dt$ \$h\$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t h \$hEU$QQh%PPh \$L C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh\$蜑 d'3H d'3~\'3H \'3 h\'3j XT$h9t$h h\$/ L^_[]hW$ jh[$j}+ D$t'T$tt h \$hEU$QQh%PPh \$А ËD$t%u?\$%tu/\$PhI\$&\$9\$PhZ#肐USWV|$<\$8D$4t$0~u/jU.I u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWh="Phk$ЏPWho#迏 ^_[]USWV|$4t$0=0V8uM0V8hh1V8Ft 1V8'j.h1V8>t@hPh1V8& t"^tCt0Wv`rhh"%h8W8r& ^_[]1w)ȉPjQg SVUdE fEu jUG WUu&Vh8X8Shg\$hh8W8,8W8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh8X8Sh\$hh8W8輌8W8[SWV$L$4D$1G$;'t$"tZ@:t9rD$Ph_\$ύ,^_[SWV|$t^D$uFD$jjPH t1Nj0j.VE<t@h1V8P\u7ut$ "%hVh8W8$ 8W8^_[VD$L$ 1Ҁ0QRRhh8W8VP`\ thh,%h8W85< 8W8^Au yuyt$Qtu ȃP} Q{ APh\$hh8W8:8W8SWVD$8X8Q4\$R3X84\$R4X8ƄR5X8.r|I1AFL$ t`$Wb Vh_`$WS Vh`$WD j:xUSWV|׉΍l$|QhU|1 PU(xsD$tVh]$>D$tVh]$(=,Y8u WWVWh<' u;D$ D$ POFWWVD$Ph<' tt$VĨ ^_[]hd?%t$  tԉ1|$l$Vh$PVS(GHt$t$Wh|dD$PC \$tN1D$;D$ 2i9t$sVt$|Pt!ʼnD$t$Wh|dt$bC ul$$WhedAPGC f$a$>ukSt$h"hض%h$W|Ƅ$tDY85W^$ ^$tY$QPW} $Kà9Éu|$$P 1hd?%j Å~A1ۉhFj"PKujVh"h{5%h$W{Ƅ$|$tDY8\W^$ ^$t:X$QPW| C;\$ mURT|$l$|$$PUSWV ujtD$$D$<$sh^$V Kth'%VJ3hU#- Ƅ$h'%sJut s h'%Vztt s h^$Vzt P$ DY8D$ h^$VuztHáHY8th#P8J(j,SE*tZ S,PD$PUxD$!=`ÉUhk$ SDž?tG<$tSWUh^$h|%h$VyV tEUh^$蚍Zh^$舍?Uh^$ho%h$PCy15HY8tUt5UPh^$y 1@D$8UPh&_$h'3Q|1@D$PUPhK_$h'34|1@D$$t+$PS tUhs_$Q1@D$ 9t WP<$ Å|$u|$jpjphm#jj V΀=8Y8u,h"VGtjVj1PPj % t-TVPh]$x 1@Vh]$1^fUSWV1WWjJ% ~siP?VD$Pj % Ë} 9tVSh`$- tNt$ t.u[D$<"D$$`$ch`$& D$<"D$$a$:D$@<"D$$ a$t$ }2D$#D$$l1#}D$D$D$L$ St$ PQo>+|$t$$ St$ VWN>L$$QPQt$ Qt$0ha$qt$ $ t$,t$ \$WSPQ=D$D$t$ WSPQ= $)T$T$D$( WSRQ=$L$$߬$ $$L$$߬$ X&$L$,L$ L$dL$L$LL$L$@L$\$D$D$0b$$6b$#p$D$ PG1Ge^_[]h*Z#jZ h E"h`$USWV $ $ hSb$VW fu PY8t R1ы !39<$$\$PhV6  &$UVd tJD$PUt>D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hpb$h$Sm\$ =PY8uD$uH$D$ P$P J8\$t$Phzb$PY8PU uUhk$1@$~#QhVb$血1@$\$$$Ĕ ^_[]$Phk$j HPhb$h'3o jdUSWV L$TY8$T$t-XY8*jhTY8 XY8šTY8$T$1i E$48t!u6$t$P;T$ uF$t$Pj;T$ tEM<ǃ h4$b1 ^_[]ËD$ t 0TY8$4$݋D$ t 0TY8$$ؾ\Y8Phh\Y8. uh\Y8hk$j fVD$t.})zh9hb$58n t 9T轴d?%q%<'PQh{5%58WnZ#u58h $ t 9^ËD$ H^WVθq%<'PV(:t)uVhkm$58m t 9SGt8tPwhb$x whb$fuj wh9 G99^_WVD$ t;59D$=0}8 8u 0}8<';pt8@uVhb$j @u=09th09Phb$À Phb$賀u59=0}8^_Ã|$t b$t 9Ã|$t q%t 9Ã|$t b$rϲt 9Ã|$uh 9hc$58cl 螲t 9Ã|$uh9h%c$582l mt 9Ã|$uh9hHc$58l <t 9SWV$$DŽ$HH$p)Ƌ$ ƒtS!=` 9c$tc$c$atσ=l 9 =p 9 PSj $;rtr1Auu($$hnc$PQJ te$P$$hyc$PQ t8$(1;BQPVWEV?ְt 9^_[USWVx֋$$t{tp11@=.3D_t1z\t r9΅t<΄t45.3AҀ|Vy5|.3TVP5.3@u΋$ $t`1Hh 9trʄt<$1ۊx 9t8tCu 9s 9B+$=FFu4$D$|$ 1  9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ 9<$؉D$9$to\[$uvz$\$-.3BDEJ<0HB,t ]tVрy$t[.3BDC$G)=~"B $tG)=BJB5A.3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$58h~m$ <$?uhVW x^_[]USWV0$Du%$H$Dhc$PQ y1E-9h&jUh`]8蜒 t$H4$=8I1VV$PH Í|$0;= 8=9$H5p 95l 95h 9s =` 9c$tc$9ƒ=}8RPSQUy=9uE=8t<}8}8$Hct9}8 9VV$PO Å 4$j9xt 90^_[]Ã$D|Ã= 8t=}8;1 T$󫋄$HRjh4 |$D$= 8ʉǃ=9$H[L$05p 95l 9j =` 9c$tc$9Ã=}8VPRQw=9u9=8t05}8}8$H1t95}8G= 8-=9$H$HL$05p 95l 9j ƃ=` 9c$tc$$H9=}8PVRQv=9u_=8tV=}8}8$H1t9=}8$$H4hc$2rD$P E;$Dnj=8t#8@=u1Hjh?"P jh`]8ݎ WV=9t@=8t75}8= 8}8 815}8= 8u 9^_USWV1@=}8S= 8Fϻm$ͅtUShm$58`58mt$PhVh'3xd|.3L$DH?u"Ã|$t!hcd$hXd$hHd$58JY1胟1Ht 9WVt$D$ tu51>"WDth#WDt,1H71@1L$t&8#tF>"WQhld$RX^_htd$h$8t$t$\t 9Ã|$t=0}8t58h~d$ 褞t 9hd$h8t$t$t 9WVD$ tul1=X 9X 9F>"uhkt$~hF>"WCt(h#WCt1WP}8X 9F>"1HkX 9#Phd$58W =X 9t5P}8hd$58lW 58hl$ X 9t 4}8t 9^_vhd$58(W mhe$h0}8t$t$t 9he$hā8t$t$t 9h1e$h4}8t$t$t 9=4}8t X 9h>e$h}8t$t$at 9WVD$ t+}&}.1=8}88}8#蘜1Ht$u8vhF>"V+Bt\h#VBu$8}8#Wv}8v]8hVW =88}88}8=8t?F>"?t5 858>@#t5}8RPhe$QU8}8#58jj6hOe$8}81t 9^_he$h}8t$t$ t 9he$h,}8t$t$t 9WVD$ tZ}UuZt$~hF>"W@tOh#W@tBWy7vhe$58T 1H_1=81@18 81Ҿ#tF>" щ 8PVhe$58XT1=8t 9^_ËD$uD$L$hf$PQ[ tvD$ph>f$gu<=t 9u0=0}8t58hf$~ D$ph=f$tgu+T999֙t 9VD$ L$t 9t u]H ́8HQtsP& t8 =98t5h9hVf$PS t 9(^KVhEf$;Pjj$hof$'V'^ËD$tIDuD$L$hyc$PQ t$D$phf$UfuT9Șt 9SWVD$-uD$L$hc$PQ  1G=9h&jlWh`]80 t D$1VVt$ ǀ?tx=9tyD$thWhf$eu T9=9uB=8t9=}8}8D$bt9=}8 9VVt$Q DžaSj致9|t 9^_[ËD$uD$L$hf$PQL tmD$_D$L$hf$PQ( tI|$BD$phf${du8D$phf$bduT9ÃtЖt 9USWVt$ |$.E1ۈ$$ >58jj,hf$d% u v1.Lt 9^_[]t 9USWV D$ #D$$L$ hc$PQ L$ ȃ#D$$L$ hnc$PQ D$ L$$|<$Dh#t$t3$8|t+4$$H$g$ 3D$$hg$07D$1E-9h&j7Uh`]8z t D$$\t$=91D$ H9= 8V"t6#f$9t$t#T$$VVP4t$Q9u?=8t6}8}8D$$" 9tA 9}8E_t$jV9$9t4$!9t 9 ^_[]SWV$tKjj[tK~Sk{ 9uWjد1uh.g$Ò1Ht 9^_[þVѾ Fujj苯ho# i$tj/V t@hQW =8t858V 8HQP~ Q Pj QO|j54 9ho#WVE`  jWV7` Vhg$t 9j@SWVPD$D$t&D$t$hUg$PV製 r莑t 9^_[ËD$ph^g$^u|$hfg$| tD$x|$Whqg$^WGPjW;! uP|$hyg$" t D$x |$Whg$I^WPjW  1ۃuM|$ Àu*D$p Vhg$^VPjV   858hg$ D$t 97=9t =9u=9t#h9hg$58I t 958jj%hg$ËD$t 9ŏ=9uD=9t#h9hg$58TI t 958jj$hof$rËD$uD$L$hg$PQH teD$ph%h$\u<=t 9u0=0}8t58hg$k D$ph$h$a\uT9Ԏt 9ËD$uD$L$hg$PQ螺 teD$phWh$[u<=t 9u0=0}8t58h,h$ D$phVh$[uT9*t 9ËD$t8uD$L$h^h$PQ tD$L$QPhl1# ڍt 9USWVh$V\ $|F$$h1Gh4V 9}hhd?%V G9$uVhk$Zu jLTT9^_[]ËD$t8uD$L$hsh$PQ tD$L$QPhh$ t 9ËD$thuD$L$h%#PQ輸 tHD$:D$L$hyc$PQ蘸 t$|$D$pphh$Y Ãtet 9VD$t$50}80}8u hh$Y%(t 9D$ phh$Y50}8^VD$Hrt 9>50}80}8uhh$8YD$ phh$"Y50}8^VD$t$50}80}8u hh$X%pt 9D$ phh$X50}8^Ã|$u|$t5t 9Ã= 8t 1PP)j= 8t 1PP j9|$u|$t܊t 9Ã= 8thh$3X7V1VVcV]9VPD$ D$t}uD$p*{t 9"t#D$ phF>"V+t.h#V+t"#/1$}8(}8##1@$}8(}8F>"F>"PQhi$58K?$}8t 9^ËD$L$0}8ti$Rhd}8QPt 9l}8ËD$L$0}8ti$Rhh}8QPt 9p}8SWVt$|$0}8ti$Phd}8WVst 91ۉl}80}8ti$Phh}8WVHt 9p}8^_[hi$h` 9t$t$t 9hi$hd 9t$t$t 9USWVl$|$$9~E1H^_[]Ët$ ~hC,%W)t.hj`%W)th%W)u1C$1|,vGxǃuv 1$o1FVj襠D$Vj薠tR|=T}8$X}8|$$t =0}8t/8 T}8#tF>"5X}8QRhi$P=tR|=\}8$`}8|$$t =0}8t/8 \}8#tF>"5`}8QRh2j$P<t$j؟Vj͟1jt$ t$ M t 9Ã|$thhnj$Pu5=t 9u)=0}8t58hsj$ hj$OuT999@t 9VPD$ tK}F=h9tQumt$j PvBH x $9tBvhj$58; 5ہt 9X58jj/hc$/H 9L 9L 9 H 9 С8tRQhj$PB;Phj$ ^V|$t%50}80}8h k$N50}8@t 9^WVD$ =8u58hk$D$L$ h@k$PQ tq|$ j=}8t58hKk$4 89L$j qPS 8t.9F9,9u#ts999,9'3H '3~'3H '3h'3V< u# 8;49~F9u '3I '3~'3P'3h'3 '3 tu:Q'3~'3H '3h'3'3у u58hk$ͮ 1Ht 9^_NA 849158hk$WVD$ tkfuD$L$ hyc$PQ tFD$jp謸lj!ЃtD$VWphk$5881~1Ht 9^_USWVE{uE Mhyc$PQ t]E jpPT$$!ЃtI58E xS^PIPWhk$V71;C ~1H1t 9e^_[]ËD$tu}t 9hk$MKËD$phk$8KVt$ hV"jVt$tvvhk$58G7^USWVD$uD$L$hnc$PQX D$pvhf$ktǀ8u0"W9V.,U`UWP Uhd?%S3 UVS( S迹 t 9Sm Vd |t 9^_[]USWVPD$uD$L$hyc$PQ_ hf$苐tǀ8u0"WYÃP茲|@CSWP =X 9H 9$-L 90}810}8X 9H 9L 9L$Pjhc$qVhc$h=X 9-L 9$H 90}8VZ {t 9^_[]SWV|$uvt$>h"l$W!t+hd%W!t h)l$W u: 1Cv荼tu&6h1l$584 z1Ht 9^_[t8u88P58hMl$58z41VD$ L$t 9ʃuCuD2tK2Vl1#tQPj hxl$58!4u^Rzjpp t 9^WV|$ WtQƋ|$@tPFWdF=0}8t3|$t,P6hl$583Whl$58|3 ^_WV|$D$ t 9uIw_tAƋ@tP@F6hl$58#3 t 9^_Rywhl$582 ^_V|$t.=\9t650}80}8hl$F50}8(xt 958jj,hl$^VD$Hrxt 9`=d9t$50}80}8u(hm$F-58jj,hl$uD$ ph#m$E50}8^VD$u5=\9t=T$ 50}80}8Ju:QhXm$E;xt 9058jj,h+m$rQh`m$RE 50}8^ÐUSWV@$(@u$,@tw~!$,@$(@h@k$PQ菣 tӋ=8~+$,@X19j US t F9u19u2$,@pho$580 t 9@^_[]ÍD$h@h8P 9D$@1ɽ $L$99` .3OGGDA@u8ȃ$t \u_GGY .3WDQuViuAG;$(@}/$,@8)Q4V $,@41@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@8)QtV $,@tH|80舆tƃu58hh$'58hi$~ t;= 8u258h0i$ t 9D$@9G=0}8t<58h8賤 8HQP~ Q Pj Z2j 6\$S |8|8058V =$8t'~t!8HQP;H~EQh@D$Ph8V 8$(@|8$,@Pj1븃<$JE1A;$(@t4fUSWV1$D$jhԁ8[ t%= 8t 1PP1<$~KD$@$Ahjhj <$t(= 8t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4t^8=8u 8D$ Y$-@}8t+h#U2t}|tU@}8<$~D$@$D$<$d-SWV։jhp$Q jhp$W tlhp$W(tjhp$W uYt F t8t4ho$t8tjhp$W t ^_[(11VPP ^_[)WSh&p$j USWV$\$@t$<|$j h'o$W |$D$ 1D$D$SyƉ$P2D0hDp$P(t$DhNp$$t$4 $t|$@t$t$@ЃD$;@}8t|$tt$D$L$d).$`.$Y.$tM.|$Htt$H=D$H|$Ptt$P"D$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=@}8t;P=D$HL$H+@}8tD$Ej/t$L t@Pt$Dhup$t$HD$t$@}8L$D|$D$81L 9H 9D 9@ 9$$9D}8t1$Pt$u$\$` L 9H 9|$pyT 9p$h{"t$LƸD$|$t$u$QPFu5$8$<$$$\$` D 9@ 9H 9 L 9t+t$j5L 95H 9PY=0}8tPt$Hhp$58$ L 9H 9 tQPhq$58$58h?"L 1O$=8K8 1O$*|$pu D$TQhp$4_8ht$hW =t9|$Lu:|$LD$puuho$t$Hh#*uho$c~D$LT 9q$|$LD$L8|$dD$t$ho$ ~8P&$$WԶ$<h%V,1A$<$ǀ?tvj:W t=@j $QP%- ~޻t?$9u3;$u*WJ9$<r$)PWR t/h%V+,Džm1Ft$Hhp$1$t Pu$$u |$p$$H 9 L 9t$Lt Vh'q$t$d蔯t|$dj%WOt Whs$1$GGG fGs$P$xPW# $u2$t'8t"$tJ?t1hW%WtVhs$1$(2WZDŽ$t$D$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB x}8JBB D$(PRW$82 t ]0 RtD$(Z$$PN-j j WhSvv t%h"PS j "PW =0}8t+D$(xt!~t$t&t$WSP58v jvo Åx`=0}8u~PvvSvx)$P$P$Phl1#裈ykSޑ 1KW$Ph8t$蓠 Nȉޅɍ$P PW$4hs$i/h1N= }8tJ$t$uP莚$$t$uPi$8~R9Wh{S$tNu1h@hft$h8h %u|8058ދ$tPIDŽ$$t4W虱PjW $tP DŽ$$t4WZPjWN $tPDŽ$D$(t P |$D$$hqj$8<tQohc$$辰D$$\t$ vj:8tV&=0}8tWhaq$58 t$$tI=0}8D$tPt$hht$ht$581@t$ht$hhHq$f |$dwht$V #ht$Vht$Vӭ8tphT:#V跭 ȅuH 9 L 958ht$ӑ 5L 95H 9ht$Vq5L 95H 9ht$581F&1t$lht$V7 $`#=8t"D$$+u$tu$QP|$hEu$ tPhRu$Wج hcd$hXd$hcu$W辬D$$0$|$Pt1$tt$tI#tD=0}8$tPhwu$58 FWhu$$8WM $$0t-=0}8tPhu$58 FShu$W t=0}8t58h#4 hҲ#t$ ۫t$t1V`}\$D$Lt$P52Ɖ$$ىD$ډ׋$$|$^8‹$4$8$ T}8ˉƉ$D$@1S$P8$+$$$$+$ى|g@By)Q赖j$Pӣ$+$$$$+$ΉЃ||$`t$@$Dt$M$|$`tCt$5^85^8臢 hҲ#5^8M|$`=$@$Dt$htI#|h#t$D$8|jj n$D$@hV"PO D$@|$@DŽ$HL 9 H 9 m!ڃt9}M#$H5D 9@ 9$$!;$$=0}8t58jj hq$D$T}D$@\'3=X 9=4}8L}8 H}8ƒP}89}%8HQP ;HQ#8HQP<Q 8tB$ڋ$!t @ 95D 91ϋ$H1 D$h6#P hV"t$* D$@|$@tDŽ$] t$D$@Phg$hr$Vh*r$O"^8)PSh=r$藊hOr$%Pt$Hhq$jBlhtr$hr$qbhv$eL$D$ D$8t$4D$ D$0D$D$,T$1@މPj Z t$ӛthr$jct$@B$=] $#$1V$W膟$$$$$$t$@Ѓt$@Wt$ u.58$PgPRPhr$V L}8=H}8| jjkD 9x& H 9 H}8L 9L}8; @ 9u1L}8H}8D1\$  H 9 L 9PL$T$ T$8t$4\$0r\$ 0}81tt$h/w$58 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$WhTw$D$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj# 7tt$hBw$58S T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@hv$WD$L$ L$8t$4\$0how$/D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hu$$c$D$8$D$4$D$0t$,$$1@މjhpv$D$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$hq$hq$hhq$USWVD1D$ D$D$D$fD$D$0D$8D$4jhp$Q@ t}D$VƉD$j@P t%L$L$48@PPƉD$j:V֯@P*D$ t$D$0|$s$jPW4 D$4t 8D$t{8tvD$ t8tj;P thw$Phw$Whw$WVWhx$  Vho$1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhW%V @L$ǃuC=}8taD$t$uI$t>th%x$V臕1Ʌ $t}th%x$Ue1ɉL$<=8= 8t 1PPӼ=8/|$DhPWO |$L$D$L$D$ tD$ D$$= }8 }8L$QPq= }8 8t=ut$8t$8t$ s t D$,t>D$Pj3D$T$"tQPh,x$ "D$Pj詓<$l$,|$u'j/V螬tG1|$t>tFhh &l$LU l$t$1l$ -T9D$Pj«9-T9*x1l$,1Kd}Z<$t3$DSVW襔 ShW%WF SUW; <$hhj`%t$LVk t$l$D$ D$<4uT5}8}8=D}8o$td$hP|$LW |$D$Pj5}8@}8uj/Ui t@ʼnD$ D$$=D}8tAD$Pj?>uP=t 9uDh'3jhhzx$)1D$PjV8t 91ۃcÍL$%L$0d؁D^_[]1Ehw$Phpx$hSx$j USWV օ\$ |$$jhp$Q0 l$t=jhp$U t;jhp$U t9T$(.C fCPC fC C 1}Gt$j/U蒩$t9lj)CSyS\$$UP { uG<$WxC Uxj@V<|$$tZ{ u 8w@P}xƋ_j:St@P\xG_Ot[uUnj]UŨ$tYÊ@t<:uL)SUV} Vɉ,$}:1j:VstEt$t$Vh>s$1ۋ\$ t3tHj PU }t $9ut=s fCt$t$Uhs$ CC tWt_uk }8KUVh.s$  t$t$Vh^s$ \$ n1HJ3}8(ul1#UvC{u{ W%tW%PvC1 ^_[]hs$jÒ WV։2vvvGvvGF G FfG^_USWVȀ%t u7Qt*5.3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=8t<Phlt$jdV~ 8Iu1IPVQi jh^8' Vd}8j\=8t0}8jP=8t#8@=u1Hjh?"P\ La8=Pa8u 0^jhTa8 V0jO=8t#8@=u1Hjh?"P}\ a8=Pa8u 0^jhTa8 WVP=09|$La8hljXOƍD$$PW509s 509hҲ#a 509肞8hh$W1ɅQǃ=La8t @w3t.VjNhy$ t 91^_jփUSWV]U P}8L$D$T 9"1D$L}8H}81O=D 9=@ 9 4}8L$$90}8t?}t9:-tRh4z$58 tSh$58 =8tSRu 999t jP}D$ |$|$jhe8 t=8jhNjMhթjyMD$h#u VHtM>|jj KMD$~h{"W:. D$|$n4}8D$ D$'34}8u Njhe8 t$jLD$=8<}8xP[ <}8|$tt$lD$jt 9L}8=H}8jLh{"VnD$|$t~D$ ] D$fxtD$xD$(PW誥ux.#D$0=u$$ D 9@ 9u h?z$58 Whg$Vh#it 9D$tt$jKD$tt$j kK<}8xPZ <}8|$ t|$t D$ t$Ѓ|$t t$D$$4}81L 9H 9L}8H}8e^_[]Ë=L 9 H 9V" t^L$ hc$V赳thc$V裳V"u39HD$fxL$ D$@щυtSVho% Vhk$T9WD$|$Y8;e8v+ e8tQл8e8Pmce8jAD$ujj ID$=X 9tDP}8=4}8t D 9!ȉ'D$ !jWPt$,19HspL$1HfytL$IT$fztD$PV5\}85e85e8IE aPhF# gNED$HQPD$~ Q Pà tWtiL}8 H}8;L$D$|T8HQP;H~0Q#58ؗP}8L$D$L$Pj#͋D$@ @D$HQP;H~bQ H}8L}8D$HQP;H~(˃ tًz8H}8L}8PSPj 1HjWQPЅx,5L 95H 9hVz$ c$u hp$netcL}8 H}8;L$D$}%8HQP ;HQ#8HQP~ Q Pj BD$@ @tu hF#dD$@ @t$ƽ8 t hz$d1HL}8H}8j>|$ tD$ t$ЃD$t$h1t$VL}8=H}8 Pj#%hz$hz$h+h`z$褶SWV |$$D$hc$Wt D$c$=d 9c$tc$D$9ƅu=x9=|9 4F959t jVth{$j$= 8959t jVtha8h~$t$ jhTa8 jhe8 hjEPa8hc$Wܭ 8|t1@v58h~$;W M58h~$#W j#t 9!hVjD$ L 9H 9 tQPhVz$ \$$SWho% j6 j%#D$ L 9H 9 tQPhVz$ Vt$ho%j Pa81WW"W4$jCj"=Pa8SVh~$58R4$jCjo" ^_[Åu1t PU"=8t j  |$1=8P"=8t j  |$1=8P!=8tV 091j $,y h$`=y8t t 9jYVV=8t ju!jk!=y8t t 94$jQBVt$ho% t)Vt$ho% u=8 j =8{jklWVd}81VA595La8T 9rt suY=$4$dWPVHs Whe$Vs 8Iu1IPVQ9N jhe8z PhC$ju USWVD$=$}8pe80a8e8jjPlg <}88tL$jQjhPϨ e8<<=d}8w=l}8j=0}8=8u 0}8h{$Ɖ=0}8~&t = 8u!h,9h~#58 = 8tCt 9=$ 58h{$R h{$ ^1A =h}8=p}8=0}8=8u 0}8h{$>Ɖ=0}8~&t = 8u%h,9h~#58R = 8yt 9=tT$ wJ58h{$Q ?{$tgl}8h{$= 8 {$3{$t2p}8h{$~= 8{$PASV3Q LPSV3Q QEPSV3I1  $t 9=t${$ <$$T$$$VRQPWh+}$ha8衱 6}$$:$:$:$e8a8D$ffe8k=(}85<}8M <}8$}8=ā81e80a8u fe8<}8t PL e8jjPc <}8=ā8u(QT$ RQhP. <}8 e8Qhe8PJ 8tjD$ Pjh5<}8ݤ D$1e8e8e8e8e8e8e8D$Phe85<}8 OD$e8j5<}8jy h}$uZ=ā8" e8$t#/=d}8=l}8=h}8=p}81)L$ ׾e8󥀼$u DŽ$$j j $Qh$QPRX =0}8=8u 0}8$P$Pt$h}$Ɖ=0}8~&t = 8u.h,9h~#58 = 8+l}8 e8tPVe8 e8e85e8=e8e8SWVRQPh}$He8$e8$e8D$|e8D$xe8D$te8D$pe8D$le8D$he8D$de8D$`e8D$\-e8e8=e85e8e8 e8e8PQjRVWSUt$|$$$$$$$$$$jjh~$/X= 8[=ā8Nā81ۉh{$kW1A#hn}$h}$u ā81ɀ=e8D$jD$ Pjj5<}8 1Ƀ58h{$]K 1E=e8t 9=$ w58h.|$hD}$V5<}8G <}81AJā8;t 9=t+$ w!58h|$W58QJ 뗠e8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph|$ha89 , |$ |$|$1-e8-e8-e8-e8-e8-e8-e8fe8D$L$  ȋL$$ D$( ȣe8D$ $ fD$ L$$T$(t$\$VWRQPSh|$ha8i 1-e8-e8-e8-e8-e8-e8-e8fe8D$L$  ȋL$$ D$( ȣe8D$ $ fe8f e8;a8e8jPhe85<}8`1ɀ=e8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph|$ha8 \|$ |$|$1e8e8e8e8e8e8e8fe8Le8@uD$ $ ff e8jha8he8 58h|$58h|$58hU|$58h}$58h|$=(}8USWVX=$}8<}8tuP jjPKC ƃPj5<}8,C t$<}8D$fD$D$jPh8<D$T$ |$ Mbt$1PWgT$L$+T$ +L$(x@Biy1PjV>a u螪8t蔪8#thF~$uhg~$ 0a8t$4\$8VS5<}8B ǃu+E8t ;8#uoVS5<}8B t׉5<}8TB =<}8t$jWA ut:|$9uD$0jPjjW֚ V5<}8Eh~$P5<}8A <}81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ Åy膨8t|8#t )͋u|$HtaL}8 H}8; $D$|?8HQP;H~Q#D$4$D$D$Pj#c58sM T$9ѸD$ |щظD$ t$]y@Bȹ@B)QnW1PD$,PdL$(+L$8T$,T$E 8|j/u h 8t8 zt ;u t"E "} W%te%jPW%jP/].=d 9u+豣8 uhu _? =d 9t膣8 Q|$ 9tE99t jP[jSID 9@ 9t 9A=6t jjk[ jhe8 t~jhe8 u(hj+=8t$M t 9L}8=H}8j+u hz$I{|$t) L 9H 9 tQPhVz$ Ut;tSuho% uhk$ h{"mD$|$}t1uu *$<$t{D$ ] u hz$;h#u 觓tbE 8|ujj *D$E @hV"P $<$14}8,}8D$ (u h#fHT$\'314}8,}8$fxt$xD$`PWσt#D$h=t 14}8,}88;e8v+ e8tQ觛8e8PDCe8j!=X 9tP}8=4}8t D 9!1ǡ9Hs:|$> L 9H 9 )$fz$R|$0|$L 9 H 91PPPt$ i KL 9=H 9|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q P t u\$,ى;=H 9L 9|1jPPt$ \$0D$HQPD$~ Q Pm " t ]Pj TtiL}8 H}8;L$D$|T8HQP;H~0Q#58'wP}8L$D$L$Pj#̓H}8L}8D$HQPD$~ Q9 P蚚ǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 H}8L}8gPQۋ] L}8 H}8;L$D$}%8HQP ;HzQ#8HQPQ 1JjQPR蘅x~L$1HfytL$I$fzt$PW5T}85e85e8VԜ8 t hz$C1HL}8H}8vu hp$CE @Phg$4Pj D$@ @t$u8 t hz$vC1HL}8H}8$@ @tu htI#PCj|$ tD$ 4$Ѓ$t$1t$V9t$t*t$h{$58 58h7{$Q7 L}8 H}8|$| j%=,}8D$ =] jSwBT$DD$@!уk։1\$HPSAXs{ 1CSu j 758} D$@PK{P6DPWha{$VPj#Bhq$hz$h3h`z$QUSWV\$j/S t"W%9tjP/W%te%jPDžxxy8hShy8$U ƀy8.uey8G1dMt[G09tÉ؉jhy8Vx.0uO.u1GOtShz$A1^_[]58hK$Z5 SWVd|$t1F5}8j"jdh$SlT 8Iu1IPSQl/ W9Vhe8 SWV09 f$D$@=u1H$jjSPHt h$0@hh$509ؾ 509jq 09j Dž,y h$?=y8t t 9j9t+t&1ONthSP/ ju=t 9(u jju'hr$l =y8t t 9j8^_[V0}8j La80^USWVPLa8hj |$ 8te$e8|o81@K$|o8e818 8E 8 t9CthQP1R Et9 <a8a8<0a80a809<<0909@@099DD99HH98LL8` 9PP` 9d 9TTd 9h 9XXh 9l 9\\l 9`;x 9VQPP VWx 9PP q; 9VQPP VW 9PP p 9p 9; 9VQPP VW 9PxP 9VPSaP VU9POP 4$Vj=La8tLa8jփ^_[]}8j&=8t#8@=u1Hjh?"P* y819La8jhTa8, WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR1K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t58h$/ t 9Q 0911j1xt5V9 091Vh0$;t 9jR4^58h$[/ fUSWV(n1hl1#SH$@07 }8 }8%}8%}8h$W ΀$t }81@}8}8 }8$}8(}8,}80}84}88}8<}8@}8D}8L}8H}85P}8T}85X}8\}85`}8d}8h}8l}8p}8t}8x}8y}8hր$W tVPhy}8gM 9 I|8hּ"V >"t 8h$V hDo$PtFhd%VtJhJ[$Vt58h8! K=8th8h&$58 58x^jh@h8h'3'tEt W=8k|80t&ƅu'i$$58P! /h$~ t0i$= 8t 8j 6W@ |88|8058V =$8t'~t!8HQP;H~Q~ & PjDhj hj ^_Ã=8t8HQP~Q fPj eV58u<2t!2h!#P4tFuĥ$jA 58$tPhh83 8^SWV|$1t*2t!2WPȕt Cuމ^_[V58u<2t!2ho$P艕tFuh$j8A 58l1#tPhh8P3 8^V(88, 9,810 9 |8A85P5|8O:t8^USWV1|$- 2t}D$ 2111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hT$D$PZtt uu ^_[]c;9ơ8=8t#t]$Qh.$P 2t72 8ttPl#PV8 8uV-jV D$E3Vxtǃu&Vt$he$ Vt$h$58FE|$tw7j hxl$58#"j 7t$V< t$D$PjW Mr^_[]USWVP (8, 9$t!uL0 9t.u=0 9A(89!220 9 4 9A t tu 0 90 9tu$0 91B0 9 4 9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5, 9 (8;$, 9 (81tu 0 90 94 9^_[]WVt$ t82t2VPLtuVhƒ$j< G^_h$f=2u  28@=u1HP0! 1;2USWV}uCjh09;090909090909H 9 L 9 0909|$(jW;H 9H}8 L 9 L}8w+09509G1;09)ʉT$t$09909s?D$009D$(L$, 090909=09D$8D$"8ʃ|;D$L$y =4}8`E\$ |$tY1${ {{;{{WSWN ;{{{ {{|$$PS\$j|U$1ۉ___ __$PWjZ| 1@G ____SW|$ S\$#N =4}8fDŽ$ P 9t$Phk$hQ1FD 9 @ 9ƒ\$x|$|l$x Y&ݜ$݄$ X&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh$QP?8 99|ӡP 9tPL$ P5L$ )΅~DQ4))hl1#Sh>'Rh$QPƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4?'QPh$SWGL$(+ 09T$,09\$0+09x@BD$ډL$hT$ll$h|$@L}8 H}81G؃D$@5X&vqL$`\$dl$` Y&ݜ$ܼ$X&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4?'RSt$Dh$QP˛ D 9@ 9ȃL}8H}8D$u݄$|9s0;T$ D$r$|$\$|?؍<)h'$؍<)h$QP3 N+H 9 L 9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jhԁ8S VD$ B J1rrJVRVG $^Ã0D$4L$8T$ 1ɉJJJ JJQRPu x$1H0Vv0jv0^USWVh=0}8u=4}8u }t$XjVS3+09~=09N+ 09y@BD$HT$Ll$HL$$D$$5X&L}8 H}8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иl1#t%#|$d5T 9PRQhB$hW聗|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQl1#r%#+|$QRhU$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ 09HQP~ Q PgʍHr̃t"109HQP~ Q Pg\t"u509HQP~ QPNg19Gdu191G 09HQP~ Q Pg[~#\uE09HQP~%Q'H wr? t:,u3Pft%19Gdzhه$t 1N19=19i"%8?'h19P\tu :v2USWVՉh19Q{tDj.V;1ۅt6UP{u&)Wh19V& u1ۀ191C^_[]SWVD$= 8t5t9h$586 nD$t$hcQ$PV` uA 8}8 }8t}8t$~Vt. 89PQt 9^_[Pvt=8}8t"=0}8t58h:$58} 1G= 8 Shq%h9L# =9=9Sha$h9-# =9Sh+&h 9# =,9Sh?"h9" =9Sh %h09" P9= }81PPv h$jx% WVPh8!ơ8?snt$hZ$P芍 Ɔ8 8?)PRQh'35 x?t$|$ 81; |8 ^_Ph>$ ^h`$t$h $58 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=8tDt WahU$.$t Vvaho$PD$D$ L$PQRSm:4$uu|$l$ Ё88tQSh$PSh$P D$WjPUh'3tU5Ё8sƉ$t=8}8t`VS<WFWt$Pu Wh8($V! WSV ! $t P\`4$Vh^g$uD$uqhfg$ t66h"t$h $58t 9kt$VD$VJPjV>a D$Phqg$vƋ|$WPjWa u{D$ u?hyg$ tt$VD$ VPjV` D$ 8Phg$Ƌ|$ WPjW` 1ۃD$  ˀuPhg$贝u_4$91F=8uR 8,=89Sh{S$UOuh1$ٙ 1$tPx^$|$t.WPjW_ D$tPC^D$|$ t&WPjW_ D$ t P ^d^_[]h@hft$h8 |8058EWhh9~ u999V50}8=8u 0}8h k$1t>hk$h,9 r1ɀ,9.)h,9Php$58,jh$h,9h tfjhC'$h,9P tN=8x9t|9j h$h,9臆 uh58h$` S=8x9t|99j hb$h9g th9hb$58[ 1Hp9l9h9d9`9\9t}8hl$ݚ1Ƀu 1At9u ǀt9u \9t}850}8^Vt$t.3DH@tNFuh$VrtQjhm$V tDh$Vrt9h:%Vprt.h$V^ru'p9`9d9 h9l9^á09t PK[109 8x9|9=8u 8<}8l}8p}89t PZ9=8t8}8j=8t#8@=u1Hjh?"P jhԁ8β WV_0jk= 8tp09t1@=u1HjP 509EZ09<}8x#jPw 5<}8i <}8 8|$ j = 8tD09t1@=u1HjP 509Y09 81\ 9P8u ^0^_Wh$j D$tPi t h4$j hZ$j USWVt$ \$l$|$WSU荔 tUp| u;HDO 1 t$ t$fO gK9uX '3I '3~'3P'3h'3Y '3 tuÅt$g t^_[]Vt$VGt^VhÌ$j hh9x t9USWV=9}8t`= 8tW$twd59Phhd19F j hd19.d19tJd591PWd59h59tNjwth59h59t$h58V |0/thhW%V hhj$V Vߠ5$$PG  0}8L$0}8X 9$-4}81X 94}8$ t1=8PGt*V"1SSQPVhf$6#u8t 9d$$r t,9$ t1=8PND$0}8$X 9-4}8h{"Vcd59V赟d59t2$75d59Ud59Vhx$ h$ 1^_[]USWV,=}8t8l$@11 SjhUb tUhc$萐 ",^_[]<$tދD$0SS ,^_[]WVP50}8=8u 0}8|$=l9tft$h$艓uqj h,9+@j WP$  =.3LO@1 58jj(h$,ru=t 9u=l9u l91HtJ=8uA58h,9 8HQP~ Q Pj g1H‰50}8^_USWV450}8=8u 0}8\$L=t 9=`9!t$Hh$H+j h,9*t|$j.h,9*th,9,94$uY,9519 ,91f u>h,9h#$58~ f,920h,9h_$58} ,9t$1 U:Vhr$Ur- D$(VyA!у $ 0}858jj(h$*u=t 9u=`9u `9tj=8ua58h,9 8HQP~ Q 0Pj m# 8tUh$58| 4$|$50}8=t 91Hƒ4^_[]t$h$j2hl59+tl59h$j> USWV\$l$jW%hht#WhUhߊ$S, Džu&Uh$S+ DžuUh$S+ Vjg^_[]SWV950}8=8u 0}8=t 9h#艏9u_j h,9'tL8tGx"uAHt.1Ҁ"ux"u"@9ZHt@r1Ӎ950}8=t 9^_[SWV$h$V V% he%P5G1Fta\$SWn t?|$/uH$VUPVS 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRha7&PO ƅu 4$]O 1$^USWVHuI\$ $Cj j ShWuu > t "hVW j VS ȁ8]t/M I9Nt vuvvS 3 jjS ƃPjS} \$fD$=8~%|$@jWa8O$Cuu Sl VjP 1D$ PWh0" D$ PWh" $h=$ J81\$@jPPhSvv= thh"S J8Sh*$ -D$ PWhj$J8$\$=8~N1PD$PXT$@L$H+T$+L$x@BѺMbiy1fD$ PjSW u, J8tJ8#tj}udI8AuZku<FD$ t:D$L$ PQhhu: t\$ ۋEu Y ID$ PWhHq$ 1He^_[] t$a+ WV|$h#W6;t.ha7&W$;t!t$?tt$ h$& 1F1^_s th$j Vt$ Vt$ `s t^Vh$j USWVHE ML$8t$QPVF DUt$F|$DMA(1e^_[]ËE@,$DG(D8<$tC19#u‹F9~sWP!9tF~WuP ~ FUSWVP|$ Guh-GG1(,O _91G G1Fl$WVVU'tY\$GOQWG;Gu!,EUw\8tGo1F u$C G(1@1(u8,t<_tGO T$t$)9|JSPV _ ^_[]4?USWVPt$$\$ l$|$WSU tU| u2HDeO,1t$t$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWVl@h1"P3t+h1"V3th1"V3u5959u }hƍ$VW Hσ s У2߃c u159σdt ltntF59뵈5959맃t Vu% !39u=59D4$9-u yt$$PQ1ۅtz<$ua59tX@8uNWƃP*MVWPv 3.gz$PS^߉ޅu4$hR$^$%=t0=@Vha$=59G559=59jVN DžND$PW"$$P Vh$D$Vhs$!t$$t SM:NvB11BW%jV $=59$uXh$Vh{5%PWa9r DŽ$.gz=59uhh WA ) $D$D$P D$ T$4$ =59u@D$ #D$Vh"$Vh" t$ u hߐ$RV߂D$ !=t D$D$pD$559hVW W;|<ǍWh$/tI=59uC59u:Vh$H$Wh$h'38jD$P|$W t $Vh$b1PPPW%=59$uL=59uLhh Ww ƒu 1@Pd D$ 1@P4 T$=59u:4$T$WjVVhh$F$P t$ $T$ V1PPPGD$T$4$ t hʐ$uD$ tP t hߐ$RL$#L$59tGujjW tV$PQL$tNWh0$4$:u W肀Vh$aWh"jWh $ $l$pT$ 3T$ϋD$1 u V,4$ $Qt$Pt$hU$4$ $Wh E" $1B1P 559Uh?'h~#h'3` jUV'3h?'h~#V` m9Ph$V` jUUWVD$Pj]x2=59t0#D$1=uT$l1h֍$jKh}"<|$VWj{ tt)u1)tu4hލ$6e^_]ÍD$t$1B1h֍$PjVh$PD$L$ $QP =59u 59XUSWV׉ˀ=59u hߑ$ t$59jjjS!!ƒt7jPS tuh$ql$h$11PUVWh)$\؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph8$jVZL0L0D0.Vh?$h\'3Y^ Wh2@#[^_[]PD$L$ $QPPp =59u 59XUSWVpT$hL$lh}"}hf"D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$tR t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$p?'1@ɽ9jD$0PtŃ|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $?'Cىt KDP@uD$ .3|$1 ,,C t ^DH@ujGt-Ê .3DA@CCu 1OD$" 8.3L$C CDP@uʃ;K}/ K>C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _EH9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$?9$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  Êt.3DH@tKCu$ D$VVD$PV6z Ǎ$$ D$ VVD$PVy6T 94$ =,,31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$?9L$ QhP ?911 |$ 1 $RO5t1BuڋD$8L$ Qj P!5 Ǎ$Pj t$5 ^ŃuuD$ L$ }D$HPQ4xWt$ P $(4$hUt$P L$l$ ȉD$<9 ɽ|$X.3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't .3DQ@tVFu$$  Qσ s[%j $( PSkU q%8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A .3CDP@t Cu;|kw.3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V E =G9 hh VX EKCDH@uٺ$yG=G9 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@u$%ƋD$pWt@1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,=9t!9}uEpV*mj =9xt$p@ =9>GWVZt$F1Ejhh592 Å1|$څ,5H95H9h/$|$t5H95H9h$59 5911<=9t6 uGp5H95H9h$V W}߅uFuTP9t@PEXP9|P9P,P9(^_[]R5H95H9h`$j 5H95H9hF$5H95H9ho$VQR5H95H9h$$P5H95H9h$$P5H95H9h4$jjUj) 5H95H9h$lV5H95H9h͔$UP5H95H9h$>5H95H9h$(5H95H9hS$Q5H95H9h$5H95H9h$5H95H9hʖ$jj 5H95H9h$5H95H9h$5H95H9h@$5H95H9hn$n5H95H9h$X5H95H9h$B5H95H9h$,$P5H95H9hҒ$Shk$95H95H9h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@uTP9_NSFJ1<=9tJ9ouwvSot?G $pS0|$698^_[]Ë$@S5H95H9h$j SWV׉HЃ s%j SVL G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ SK. uC9|P9s|P9؃^_[]Ë5H9=H9SP PWVhu$j USWVP׉΋$1m~ w]$@' 1at*dt+fuC j   j j t C$1E^_[]USWVPӉ΋|$)MQ1?t@$M7Et*j @x 22>u)jH1҉P52 25ojnH@28 2>u j559h\'3Yu G9P%0h 9"j PPh$h'3;j/USWV\$|$t$ G91EtB5G9WVFK  H9 H95G91 H9H9Ht8h{"p:G9 H9I H9Kph9#jhG9_6rfH9"H9 ...H9G9 H9@G9 G9 =H9uG98#uxnu G9  G9W1 t,E-G9@J}G9 H9R)ʉ1ɉ H99‹\$kH91m1 H9QH9u>#u~nu G9tG91B C1ɾ8f H9@G91ɋ\$uH9\$t1A ^_[]ÉbQhk$j USWV|$H9uN (H919u:=G9u$H9'3'3H9b$,H9\'30H9 9" H91NHQPP}$H9='3P =4H9tC4H9SVS5H9 th4H95H9v o4H9=4L9tM,H9t=\'3tP V,H95H9h4L9 4L90H9= H9t H9(H9 (H9@(H9H9=G9QP苑rf|$G98t0W5H94H9V W5G9VF =<W5H9$Vt W5H9$U] Vd U PWVh$Wh4L9g29h4L9T,H9޻t=\'3t P" hV"h4L9`6,H9rH9tt$t$P ,H9H9tȋL$!QP 0H94L9=G9uH9H9,H9\'30H9 9"h{"P5$H95H9hk$u G9$H9$@1Q5$H9Pi 5$H9hH9hH9 ƅttbH9|0 uNt$@ $@ $QV5H9PH91@|^_[]5H9hk$jL 5H9hU#h$hx$5H9hn$j h\$h\$b =4L9uhe$J h4L9Rj(h8$벡$H9@ u:HQP~ QP2 t5$H9Ph 1=G9t G9t SWV(H9X1t^h{"33t&Nj@HOW uW^[뾋HWPh W<1F^_[Vt$Vt^Vh<$j Vt$ D$tVPEuVhH$j V^WV|$t$ WVt^_WVhU$j SWVP\$|$4P9t PyD$jPSWw PL4P9VPSW[ 4P9^_[USWVH9jh8P991FD$@P959\P9JBtOz T$R uW|$+;A 8P9~ VjVWQPA1FT$1P9=P91ۉ__ WjWSQPXAT$t tCsBtt$u H9;Hr\P9xt$tH91BtȉÅQJA7$B'=@P95 5,H9j c> 1-RL$ tKQD$ ;2r5,H9jjhl=%15,H9WjSt$ tsQQtejPhC' tQF;2r5,H9jjhl=%t1C')$Ph$5,H9+ Z;2r5,H9jjhl=%'1t$ D$13Ph$5,H9* F9ut$ t$L$)42F9r5,H9jjhl=%5,H9j$< 5,H9j < ,H9@ @9  ֡G9 @P9u55,H95F@+6vFt P^ uF6^_ËFp vhk$j貴 USWV ՉL$P9P9щT$Љ$ .3P9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B P99r7 P9P5P9P9P9P9$P90D$SPt$V莜 it}ŋ4$L$]\4$L$t&uE\P99r+P9P5P9ƣP9P95P9F1C4$P9P9\$D$ P99ȋ$r+ P9Q5P9;P9P9P9 ^_[]USWV`}$111D$h$u WN uu5D<>ut0GtgD<;uD<$8u !3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%S# t+8ttDGh$j讱 1E L$3 the%t u3hk$j螱 tD$PW uh$ۃ|$ tt$ uh$뼅tt$ uh G$렋Cu/ho#Է i$tjh$VVX VeSPu- QVh$ Ph$h'3 j UVQ t@t $e^]Vh $ja WVP։1ɉQPW׋ V?t$8t1H^_8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pV7 Cf{~a11C403t?L$qPdt+{|7u!47_3L$1qP D7EC9|^_[]Vt$FtKP F tvPJv zF v]vyF^USWVP1k<2~42$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùm mUSWVPk<22$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)oh'3jjChc$jY V1=P9TJPt*jjjI  V{ V2|5xj<TP95xj<QP9j5xj<\@P9jPP9t#1ɺ2A<.uP91 1@^USWV D$0f 9P9Z P9,I fEE!f ufE(Mt!U1f~ t @9ufE,$StE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? .3DAh'3je" WL@$C'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$ D'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuL2N =m$ 5tj<™5tj<™1QQPSt$V5tj<5xj<\1U)19}1ۋ$p$)ŊEt9}1< ˊEE5xj<Uh֝$1VV5xj<~UVj5xj< ~Vj5xj<  5xj<5xj<+= |.3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h'3jd bxu+=P9 P9σqt$V\[V賶VJo5xj<Ih'3j ,$,$fUuE 9|)BfUh'3j ,$T$4xut EfEuGza|1x(| E9}ED ufMh'3j@ !}Eu)u6E t uPsu蘵f;}]D; jtKD; tt$4UЃF4; ~ttt$4WZuE tuPֱu mE uu~mEP9,Et)u9E t uPvu蛴EtP|EEf~3M1tRRMEGЃ9|׋E4t t$4UЃulEE tPlE ^_[]It$5P9t$t$hE$h'3 ZsI$@ t$St$t$ t$UPhu$'MI $A It$U5P9t$SQPhߜ$h'3q $jg USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P7)1Ƀ QWl$ U|$ WD$pxtS;tNt$Cj S)؃ QSVWD$pxt G}uo $ $l$Atl$|$q豓KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCA G΋<$9Ƌt$ufth$VSwYw|$Gu1PPw|$ GL$G)VQw w ^_[]D$L$P9 fAËL$1x9 P9~P9USWVl$0.P99}=P9DP5P9Ǎ PjQ =P9ۉP9t @tFj3W1 P91^_[WVt$ w?=3t-t)95P9r!P1 t;P9slj42^_5P9P9P95P9pg5P9gVt$5P9MP9P9VLPhk$^PT$D$ $1APYXWVPt$|$5P9P9P9D$$WVP1A4$^_USWVt$R5P95P9 >-P9E.3\Jك@to@uwt uDZ@t< ty< =P9u =P9tI5P9mtj 5P9=P9uj 5P9P9P9P9P9?=P9u"5P9Pmtj 5P9<j 5P9,1P9P9P9P9P9 P9f)P91ۈD$uP9C5P9lt$L$4 5P9l9Ƌt$|25P9lVUUU9}j 5P9x|$uCj 5P9^KVW5P9xT E߃ @ ȢP9P9=P9uW5P9lt7j 5P9%5P95P9OP9P9P9P95P9 ^_[]t$Phk$VPt$D$ L$ $PVP1A4$^hl1#t$t$t$t$USWVP|$ \$$l$(t$5P9xP9P9D$,$VpUP 1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWڣj5P9ڴ1ɉV,$E|$@t[D$@8tRD$u:h;%5P9,Nt$@5P9Nh#5P9NWt$Dt$s h.4%5P9M4$&r5P9iD$ 5P9i5P9i‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5P9M5P9`ithZ%US5P9N/)PS5P9 5P95P9Ã~0L$ZD$  я L$X1)<(x1 .3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP;] QtRD$(υ~] $9I\$)RPQ\ KOuLuH|$@tAt$t$D|$Wp Wnoh'3jf D$z19Dzf tN;L$$} .3DXuh'3j  $9A)RPQ5\ $8GED$t+)j Pt$5P9$ L$P9P9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$Po 4$0^_[]hl1#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5P9f5P9e$tKۋ|$,;Sm|$0L$Dȃ19AD$LD$Ut$HPo1t$PQQ Źt3;|$,t.D$DE9}STmŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P诅tC@j P虅uL$$)݃} 9WUQS5P9~ƅ|$ 葋VvƅtV5tj<4$5P9PW5P99DPW_@1PPWb W D$E|$ GWUPS5P9}Pŋ=P9VPW=P9VCPW?5P9輶P9P9#WUt$ Sh %5P9肥1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV94$tWVx~V?:W薁UP$:W:^_[]hl1#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP^1B4$SWV]^_[]hl1#t$t$t$t$USWVP|$ \$$l$(t$5P9IP9P9D$,$VAUP14$SWt$(^_[]hl1#t$VPt$D$ L$ $PVP1ɉ4$ ^V5P9Aa5P9Qa^fUSWV $$$ 915Ȳ959؞9&%5в9W;9WVP E'Ft(=89tvvP{j vh89B>vuɸH9 9IJ9ز9ܲ9hU%s $|$ hk%SUx e~o~1pMrtoCID$9붃fi5D<h{"V2 PhW) \$h8B#W_ D jPhѲ#؈ t \$Sh|$W u4 %E'WgPWV t }u몋}tED$th8B#S <=u̍4@h8B#P Fh%Vg 0t$VWh F9hܲ9hز9hv%5D< `S蠨$$$ DmD<$.61Wh%V-u#D$=uD$h|$d}Yh%wI t41Wd t@ < uFrWA WA jh#h$ ZB5xj<^ǃ5xj<]1FVVPWKs,96t5ز95ܲ9K5,9hY OVj聩Vjvhwjg5xj< A{hh9B,D$D$@VBljD$ V3D$1Åj9PZ $t|$ o u*t$ e%n ut$ %n j|rjU`tc1L$ <:B >@9u1PPPPPjPPj jUVP4t(j t$WJW^11V败|$ t$~14蛥4营C9uW肥VyjtPjjVh #譢 Z9jԲ9j"(9uٸ=9t j jjp.P91 ^_[]Ét$ hh1GQWP Ph~#h'3 V蕤W =h'3jj,h>%|ji h'3Vjh|%|VI V1Fh'3VhEh%p|V' UWVVP h #m P| 6|[=ܞ9t>V葙PhH%W 5ܞ9Z5ܞ9̣ܞ9=09t>VIPhZ%W 509509脣09=P9uh'3jjhq%{{e^_]Ã=49tá̲9tt$PTu j j h #l tP{ t hW%{ ZjhBw h,j"USWVB L$QC  P^ Ń j h%U ~ uF t$|$ W W`fD/UWhL Wjŋ>7Ptn,$n ;nu:FUW%t^FPv tFljFn ~D$PU4$UUV S] ŅSP; ^_[]ËD$L$I41@fUSWV1t$9j9V“t$t$ t$t$4$j~VP;=9P覝t$Vj >hj]jYj߄{jVfʁV2Vjj^4?159totL9VPX~BjhyL9jPWyjhx=$9V/Vbu%L9ǀ$jhxupǨsL9Phk$jX jtOL9)tTPCu2PKu#PuajhxP迚^_[]Ë$l$ D$jPtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uV譝fV蟝fSWV1t$t$t$ t$t$4$59jV$jr4PVf8 L9$*tKuKt!PуtL9$PL9L$$Q4 tXD$t$VSVx)VOu%u%t*VC^_[À)ujhasu Vt5tj<p1WW5xj<K 5xj<譥5xj<pSj 聲9;xhj_jZjC]jVkJ%%!}E'USWVο$WQSv[ Wh%S\ WSUZ[ Wh@%U[ S1tGUt0VVVVVVVVVVVhܰ"h41PP/t US^_[]SWV$SQVZ Sh%Vi[ SVWZ Sh@%WM[ Wit VW^_[WV1t$t$t$ t$t$4$59jVtkjo4PV[5xGL9*tD$$tL$PQ_t$ViLtV諕^_ÉWj M?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QWD$l$1@$4VW9D$pPt$VK Z$DaD$|$ $%t um.3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5.3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u.3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04V Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWB 5ܞ9t@WPhH%V/ 5ܞ9s5ܞ93ܞ9sh6#h%e ܞ9t*W蛋Ph%V 5ܞ9ds.5,90tPh#h{5%j[1e^_]Ph%h'3x jn UWVVA =09t>V1PhZ%V݄ 509r509<509whV"h%r 09t81h%W莄V蚊Ph%Wv 509cr$0Ph%h{5%j[$1e^_]V1hhPhtPjjPj jjh3h4xjPѪV^h'3jjh%qlܞ9tPjjh%Vlj SWVD$x1|$ܞ9t09P1; PqPVh"W;^_[USWV$$$L$$QPhV} $h{"V $D$W辂1K4$Vo 1G9r6|$  WUYŋ$(\5F4$n ÃugD$ PVuH|$dh{"V $t:|$G=ܞ9tVhS%h<%Pi 1KS1D5$$t 4$ 4$Nuܞ9tVhS%h[%P 1ۉ؁Ĉ^_[]U$$$1K @ USWVu ED$l|$(PVWx  ED$8D$1ۉΊ<'t  j Fj'Vhu VOljt$ t$PS請 D$ t$ )VPh "L$QT h%VF t+9s'T%u@u @Qj*PG ;'uC|${*1\$$|$D$8j/W tW2 É@/ W1 É|$PD$NSL ND$+D$D$ .t Vt$WB tSL Džu]D$T$L$;ȉD$Pt$ SSD$L$Wt$t$ h%P 뒋D$L$T$;t R褏S) |$\$$hd?%ST G|$\$1\$L$9}P7D$hPu"7h?3]|$u9Mx{;5xj<tV>jP]|$ۋ|$t h?""h+P!\'3H '3~'3#h'39Nj|$t\j ;5xj<t V|$ t E%u15xj<蕑5xj<j5xj<WN/\t$(ׇtwPŇuW資D$td$8u-e^_[]D$t$ h%jkJ Vhn%Pm 1S$ 1FV$ Sjh-#%# VS_ t$$ $ D$pL$|PSt$(T t$ Wܞ9t*t$h4%Pݱ 5ܞ9ܞ909t*t$h~#P誱 509輆09h &D$ 0}u.hC%D$ p}ut$vm t$e s h9REtt8tjP& u%t$V6g 6hX%82 jΉ3L$1PhF%2 USWV։5xj<P1@P5xj<L5xj<PYh41PSU,  3hP)4hPS1CS y3Whk$|3h$FPU^~VY5xj<;@)VUPRQ5xj<OUtcjP^|薟t05xj<PV5xj<PVE1PPV訯 VX^_[]h'3Sj+h%\SZ fUSWV-1@=P9$h!%Pjq hsD$1D$ $ $?$VRB9$VWyB PWt$ 蛀 VW^B G|$#"%dG'.3D$WAPWt$ K6 uD$L$DAu >uD$ |$O 4$ ))ht$PC FD$ |$$ ))Ƅt$$т8 }? jS{ ƃ $NfFd6Ju1ҹhtRRRRQRRQjSD$DPju4D$D$D$ D$ jtgD$ Pt$袘D$ p P9 )) hPhP9A 14G'jVhP94 t1GuD$(Vh"%j@$S¨ 1PPD$0PD$XPS" t|$Lub4G'hP9h{5%h,jSj"D$L1QD$PPQQS4" Sh#%s1=P9su=P9lu.3 P9DH$D$$PhW%8 u5$nfsu( $D$1@D$ |$$tD$$D$$i jv~h1Wt$TV要 j!W|$0W薁 iW&]hh#%QChPX9PPj}=PX9 hPZ9PPhh6#h$% Ph#%j+o h#%Woh|#%Woh#%Woh#%WnhPX9h$%Wn =PZ9t!hPZ9h$%Wn $9h$%Wnh*$%Wnh8$%WnW~hs%jtnhP9h;$%h DŽ$hSU9VVj~/j h%V? SU9defa1ȋ WU9ult1 j h$%hSU9 SU9manu1ȋ VU9ual1 SU91 SU9none1 WU9 tlf=SU9 tb=SU9t`hSU9hP9h$%jtChP9h$%Sj~$${}SU9Q9hh$%HOh!IfhP9h$%h$%hL [ 8 Q9h%D$ Pj3 ~ht$ hQ9< t$|j hQ9Sth %D$ Pj ~ht$ hn9m< t$r|j hn9St=n9t Q9h%D$ Pj ~ht$ hR9 < t$|=R9u:h%D$ Pj@ ~ht$ hR9; t${j hR9Rt=R9t Q9hhS90u=S9t Q9D$1@$" hOY9S$WD; VS9PPjxVR9PPjw SWt<91ɀ=9/9QPh@%hh09ƕ 1^ËL$1Bh,9WVt$=P9u jG7Wj DŽu1@l95IJ9o1ɀ=9/9@%QPVWh9+ =1ɀ=9/9QPVWh$9 1^_Vt$V dЉh9$^WV D$Ph9 u:$nfsu-Vh9h9V- Vh9h$9C- tWj 轃1F?t[h9h*9ht %jPu>9 %h9VWh9! h9VWh$9 1 ^_SWV=P9hUQ9u(he%Q\u9hOY9h %U=n9t h%˵=PX9t h$%赵|$hP9h %hW\ hV"WƅVWPh %j[h#V[=SU9thSU9h %Vy[ hs%jj[Q9uGWPh %jK[=SU9tDhSU9h5U9hT9h %V%[=Q9tChL!%ThP9hX!%h5U9hT9h %VZhs%jZh6#h!%XPh!%jZ #%SWZh|#%WZSWZ=R9thR9h#%WcZ hT9h#%WPZ =R9tPhOY9h&$W/Z hS9h~#WZ Wjhs%jZh,!%ZuhQ9h9!%nS=PX9tho!%XShP9h!%FSt V'jjG^_[USWV։ϸjPPz tCËl$hjW/k ojhP9W) WVSW S 1H^_[]USWV$΋$Ph%`u tWl1#V ^l$PSU 9<$u9PVUWhe#%hC1Ʌȁ^_[]ÿa#%fT$L$t$f1"u/Átu22$Ãt6u8h6h/u uh,%!wG'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjhH'!t{4$W1ۅtjSSWPjhH'!tEhd?%V t&|$\$PS׃thd?%j uVg Vg1ۉ؃^_[USWV@%%H'\$|$jSP ƅt Eu$wS7A' wh6#7' G^_[]WVtH'|$uH't%|$ jWQE t u1^_ËL$34USWV1td։σS.%PSW t u6P1PhPPj D$PU D$t΀8uɃ<$uð1^_[]ËL$$3w4USWVl$\$1}$hlW6StOD$SWPHDWWRt.ljFt(V$'EL%%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ f $V1VP f 959D$40$X@h P@tt$45xj<8h'3> 5xj<9r 9ɉt$ =1MD$Ni8D$$11t=i8,4в9tǍXUSZN݉|$|$l$$9L9ƀyH1ۉLPTXVUQ\# L9" .hQPB# VUh93# ,L9L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPL9$()1HD,048Ƃ(1 9<59^Wв9|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً 9ɋD$L$ӾV Wl1#QSPSl$GU L9$H@ VWl1#RPQSD$BP ܞ9t% L9QUHDRh%%Pɋ =L9$0TơL9$p:L$*QUPVWjj:WD$ D$D$ PjvD$ t.-9L$QP5L9 u<5L9h^R$Pdž$l$L9()8 9 в9V!O9VjPa L$ D$@D$9 9yuƇy$u4P4 44S$똋D$L9$H@HD48D$L$$<uujj7mi$t+D$xfDŽ$DŽ$d6D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4d6El$L$),$|4xfDŽ4DŽ4d6T4E,$DB8t$ 9zt$D$tj$DxYfDŽDŽd6D4B=QD$BP4D$ .D$D$$|$y+DxWfDŽDŽd6D4B1ɸhQQQQPQQPjR$Pj蠁4$1K|$$8hk$jh D$Wt$KsD$tvl4u^u3h1QQQQPQQPjt$,$Pj4ÃtCD$WSrD$lxS1H$^_[]1M4$́$<t4u/h転hPh~3 L9\31@멃=9yu99s19dL$w BsÁt1USWVD$$L9*t1G.$ )$Ph%%hV\ C/%jt(heMVh%%h" j$ fW%W赢L9$PhD%hV݁ WVh&%虥 ]hW%Vjj\Q1PP3Ah jl1q $ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S3t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$G'h&%D$P耸 &%D$&%X3|$0tPh&%hW& Wh &%D$P# C/%D$&%zh&%D$P &%D$&%i3|$0tPh(&%hW D3t#Ph/&%j\$S S\$W D3t#Ph6&%j\$S] S\$W L3ۋ"t#$tWRh=&%D$ P, D3@&%tV&%D$C/%D3|$0tL3tQhc&%hW~ Whi&%D$PͶ {0%D$|&%Q|3&%t&%PD$P蝶 &%D$&%!h&%D$Pz &%D$&%D3 $t!t$PQho%h4t)$j4$VtQVd3U$ 7=9t$ $QD3$t<|$t4øSWS$PW[$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRhS+%U5 EtjPC t4$U؁ ^_[]Ê$ hC/%WL$D$jV(ù D$jQQPSS 9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uhm+%SPVUh+%S@$ Pu1Vt$ha+%P4$T$ l$Shn1#U hKUWVjPK1PQG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQRK^_[9rwًz89y8rw19HUSWV L91G*ZƄ$h'%輛hV"h+#茞Ph '%jSC 5ܞ9t L9QPh$'%V~ 5h['%SCL9)\$J$WPZx$L$@PQr $d$ PVr D$@Ph'%SB D$0PV]Y"D$0L$8L$D$hFj"PIw\$D$H$194$hFj"WIFuށǐW$WXq S`R;t$$ *hoܞ9tPjjh?'%a*1PP.+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7q#tl1#$'%\$t7ȉL$7 T$wX&%D$ C/%D$$G'l1#$uht$$P '%Pt$h'%t=uD7L7qQPh'(%u$$q#d#Dq#t $D$ {0% $T$hW%RGT$ D$L$ 1@D$hN(%OT$&%D$L$ hW%RgGuD7q#t$$D7l1#@t}(%l1#y(%l1#t(%T$(l1#t(%T$ |$$l1#t(%L$,l1#t(%l1#t(% l1#t(%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hU(%t$D?@غRPh'%t$>ClE;F{Pp\$CPWn S%Ot$0|$4hg赕L$0QjP4. P7WNtVh'%t$v> SN=89u#D$@89@@hPfh(%\$ S->h(%S>h(%S>=89th89h )%S= $ 1|$@VVPWhF+%< ;wl1#rđ#tđ#Qh+)%S= hX)%֕h^)%ɕhd)%輕=89t hm)%覕ht)%處1hs%WI=SMW2+e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ H'h})%U Ubuh&%h})%U U;FjV9F1Ktljt$"h)%Gc$GC/%G _w"Gh)%G c${$C/%C(s4C8H'h)%C<{@C/%CDsP$sTH'Sh})%U UptlSh)%U "UEFc$F^ _FSh)%U FH'UF c$F$^(_F48ih&%h})%U Utl&%Wh)%Uj "U Fc$F~ v^Wh)%U6 FH'Uv F c$F$~(^48+4$iƷm۶|$9R9h'%讙tzh+#肙tiD$h+#Pj裘 SWl$UVt$t$J6JOu4$JL9Phk$h 1PPx#L9)t5PhD%hUeq 鋔$ 1$ 91APuDFl9Ɖr:L9Phk$hJ 1PP"999ƻsRAklT421GWWjjhUt8RVx L$ $ g|$8jhah=*%h1*%hh)%GL$T$jt$oËL$T$jt$XWV׉κC/%jujWZhl1#Vhz"蘔 ^_VP[91ɾ 9r^^VD$P[9tU@8xtlIuAH1FVVjjhhP[90QRx tjhP[9j^ tP[9^À=P[9tjhP[9j7 P[9USWV 1WWj &iP_7SPj  t$ %á.3D$1/dev4$D$iƋ1N/ u1FSt$$P%q/dev uDL$DAt|tER|$$t.jVj? t .3L$Nj4$D$/devG4$D$M[1O4$1O1VF ^_[]USWVPD$tPpP11OFtFhW%P=t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|Tc*%wp*%Phn"h@%V] ^_[]Vt$D$QPbLt(D$t%t!hhPQD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5в9.@ujP`>D$1҅D$t 9tL$BuT$ЋT$P]1hPPhhjjAPjQQh,3w 6i4WP[w DM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP<D$1҅ӅtwU:t\P,40Ut5L${|$P=$tL$ST$Dځ8Nut/$E t$BЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W:ŅjW:{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ ,D$$@$;E tL$ A;L$tI1۸hSSh,ShjD$G e^_[]WV|$ tt$F fG ^_R^_SWV|$D$Xh+Ƌ1ɀxQPVh"S6^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6=^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVh}*%h:1^_[USWVu @%%xH'jVP uh8j}w> jVw 3O$3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$ QVPh*%hSb Z@8^@8PG@$QP"B'$@ffsWBD$Bjh*%1ۃt$D$`Yh*%h*%WW= Vh*%SH= Sh*%W) Su$Ph}Dt$VW%/W}uVۻ$Ph*%$U2 1ۄ$h+%$Yh+%PCL$DQhb&P; t$,04t$jj hl1#RPjVy |$DW,.3r \DZ@uWQVt$h+%ht$ ` 1C}$t.1ۿP_9PSW: t$D^^^F~ FFVhQt$ ? t |$\JSjVg: $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj hl1#RPjV VShP$ht$n_ }G8@É؍e^_[]P_9=}t'fy"_9 _9NuEt FuXt1€1ɾ_9( Ӏu A'w'_9 ' Àu A&r  uȃsƄ\$,04t$jj hl1#RPjV $PVSh++%ht$yD$L$a!jPD$T$AjP{D$d$jP`t$,04ڍ\$jj hl1#RPjSA W$ePSVh7+%ht$ ] -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h(%q\ Y|$hW%u u,DžtohH'6`,tkDŽ$v/rDŽ$/dev,$$VuP D$/devf@/VuP Q踃낋E\tu xt@@AED$5в9$ttt$PуuNL9덬$WPU t$/devfF/L9WPV [S\asxa9aO$CQPUw {PWVL9$t(tt$Pуt Nj5L9,$1D$0$h@h P5tt$GL9PUg*tTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jWÅT$-t WVS $WD$pV l$ Uh%V) ǰD$h]"W)hѽ#W)tyhw#W(tgh^$W(tUh'%W(tChnf"W(t1%D$t+%tD$VPS VWS Uh%jV( DžED$4$v PS} t"vhk$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=9SWt$t$&$1PWt$t$%|$a9a9]SWVh$whw1WWM ƻ$$StSuh3,%W#V V,^_[WVt$D$D$PVW茋 t$L$QQPhh,%jӚ4$, ^_VhG,%jr SWVPVjB>u1@G9m1s9@%VPWSh9eS wsVPWSh$9OS 1^_[USWV |$ faa@D$$1Cl1#=9th.%j9VrPWh{5%hNvD$PUBD$hV95؞9h>1%j訙x9rW!9u9QWh9Vt$D$PWh\1%SR$'D$D$ =mdt2Vh9h9 Vh9h$9 1$hVS* t$t$t$D$ a9jVVIn ~;Ƹ PV"D$i jQPn e9]D$|$hZWw)o ~#u4ha9h89G 21ji p89ލ$a9Hf@d6tJu1SSSSSjSSjjUVjl M4jmoPV>VMkta9Ph897G u`~*=9t!h.%jU19Pjn)D$Wj|>\$tt21ۅ1C؁ļ^_[]h1%h1%h'h0%e&USWV|1ۀ=89t}h89h1%jŕ ue9V1%@%9h9VWSUN h9VWSh$9zN VU^#N@1 É؃|^_[]ËD$L$I1@Ã=9th.%j(9Vt$ D$t PnVjH=m5,9&^USWVPWj=1F?tih9h 9h,%j讔uL99V1%,%h9VWSUh9sM h9VWSUh$9]M 1^_[]SWVPVj<>u1@;9,%h9VWSh9 M h9VWSh$9L 1^_[ù1@t ua9It1ùtA_a9t 1ùD$_a9AuTa9ËD$Ta9SWVhzlhy1$hWV& 3WSChWWhL9Wj65a9WjWPVWI4SP^;VrJİ^_[USWV|$1i/t\1tWTa9tI1r rr2]0u&1q1ur1ۃ0݃\]r @뜃|$tB ]BB^^_[]USWV|$D$L$BJ 0uQ=a91۾&-a9B0t#1urFTa9tua99u'Cϸa99t0Ta9a9ta90 5a9|$QAjVPh*,%W ^_[]WV|$t$ Nt tuh,%Ck,%,%2tW%jjPWV^_USWV|$=9t h9j;WWH9u9l$}QWVht#%hUJ 1PPC ơ9t3Ѓ<PU迧uu#D$=ueߋ$$$t|9P{jۉt{uh,%jz$t]PUh,%h[Z$t9hhSjP2 jP W!V!jUh-%h V V!tP$t9Uhk$hi jj8uh5,91@|^_[]Ã=9t=Ȳ9tUh6-%ju CTa91$t9Vt$h$V1tV9t $909^t$.9u9USWVt$,V*D$j$t$Vto1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44L$|$)L$OGj$WzDžuD$@PDžj$t$0N|$1<$t$]D$PVhVVj D$PS' NjD$VtuK;|$0sED$ )UPt$V 1D$44U> D$44$D$D$ j$SŅm<$t$ >tV\$S<> V$|$);\$u ^_[]h1%h1%h h0%SV531/t.T$ 39u9t Ta9t q/u^[V1ɍt$QQPVh<-%跿 y1t1^USWV|$(1$PPWVh<-%t $D$(1PPWVh<-%; Z$LF1d$Pj%s4$>$H'h|e$U3eh}Bhh1%eh~(hUeW轣5,9D$h调jU5,9H I'PPqhVjU5,9, Vt PVW褦 蜃WD$ PSt$5,9H 5,9`$5,9RSjh2%b j D$ PUȷ Uhe%c D$(SSWVh<-%菽 $j he%fMuQ1AtCjVJ u4Vh2%"1ɉtjVjJ uVh2%j) D$(SSWVh<-% u$~hP-%jTȁĐ^_[]1USWVhhV1%09tPjjhk-%19999|9x93/u D$83ڃ9tTa9u@x9Q/uD$/u.9x919hbjb 31@|$>ZTa9M |9L$ 9L$j5tj<5xj<$5xj<=9th.%j聈9996P5x9h-%jaa9Wj 0D$ttRN1ҋ0t1t /u oBrgTa9uƃTa991Ta9uAuVD$u,D$ |9D$91@Ta99^/ 9Fx99QR5|95959Ph-%h` jj/_5,9c]1ca9tvh-%hu>h+_t$FVj/~th-%j軆h.%j謆h/.%j蝆1G`a9`a9thK.%jfhW%_L$QP8u{hd.%_$QPuYD$3$L$3$ t?hi.%h.%Mft!h.%jޅh.%h.%a迪1=9th.%j訅9]$1L$VVPQh<-%T }t|$ thP-%jTGjS"e^_[]1F]VD$FVjX-F^SWVPD$$h6#h /%{at@Ƌ|$]1Ph/%S9 4$WV Vhs%S^_[USWV-< 3ta1F8 3t&U7Jd1tUhk$h] 111Fo u1tjh1@1^_[]Vhc/%]t$hPV hhh9V x(h9ƀh9hv/%Q< j/P@r/%9^SWVh/%&]i9hPVA Vj9K59P j9j9PVh{5%hWA< jWhm"a hJVIj< 1hh/%WWh)JjHj j j jVWWM94ƣ 3WP+ 3V':W jjt$5j9h/%WV; hc/% \$WPS) S^SVvj- jjq1@^_[UWVj\ WW< W |$ hPW j WtZ9 j9tV("RWQPh%hhe^_]1PPjvY0f!PVWh0%h'3 5 0%^_WVt$ 0PpPGt$>FFVj< F^_SWV=3/t/t$3GtPVt /u?É^_[USWVj$t$ 1ۅtKƉ|$\$FUShSSj WV脿 $Vtu;D$ rj$VWƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUtMƅtPt$V SFOVUP tP׃SVx^_[]VPT$ D$t$4$ VPv ^À=k9uak90"p9*1%941%t9$9$90"9SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlWq$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWUŵ uD5<w |5L Ku1PPD$PR )ƍD$Phd@V |$D$|PhedAV V۟f$1 GaD$P$,h1%t$Vϳ 1PPV肞 $C]su PUhhk9t$Jt.k9CD001 k91 u=k9tZF9|4$ja$,hE;%$0u EPP- jOh l9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$Tt$$,hE;%u虲 EVPhP$P胲 EtE @E w-G$9@  V؁^_[]1D$L$I@PTa9wʀu_a9AuTa9 Ta91USWV$$1$hWVg E jShWWhL9Wh5a9Wj jPVWL$4SP)V=%1Ĭ^_[]ËD$1ɋ0t1urTa9A1ËD$1ɋ0t1urTa9A1USWV ։D$ $E1$ 荳 D$$ ,$D$%2%貰 $F?2%u[2%D$$42%N2%u2%F\$$9 \$\$$&HD$\$$)|$=9= 9=9$ <$D$D$2%<$q|$4$D$ 9D$@%蟯 |$D$ 9D$ 9D$2%=P9u$AyD$1Ƀ 3\$ 3C|$D$$$$D\$$({|$!<$D$9D$ 3z=3l1#|$l$ D$D$2%$kljl$4$ K=P9u $exD$|$D$$.$$C\$$'|$u1=*9=9=9$ <$D$D$2%M<$t|$4$D$ 9D$@%խ |$D$ 9D$*9D$2%$juLl$ t$<$D$K5%i$ \$<$D$5%i$9 l$4$} > ^_[]Á=3ftp]a#%=3PFSWV|$tyj9GO4VSPtRVC t{S5j9j9Vhi95j9h%hS" jShm": fG 3~"P8ptV]tV1^_[ËD$ j9Ɓi9 t9fH t9fH1SWVt$j9i9V~)S4:Q4 Ft9Ft9F1^_[ËD$L$011ÐSWV1ۉShPS$ tD$$P= t V/8V81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u6C1^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW(3VIy 81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=91SWt$ t$L$ T$D$T$SWt$ t$D$ ׋(9t$ t$(23%L$\PSWt$t$,t$RPPQ* $91WSt$t$D$T$WSVt$qÉ֋=(9t$Ht$H迍$PWVSt$t$3%PPPQ $VD$`Pjhr1@USWV u C(D$|$8hjW wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ0I'|$D$u$|I'B xI'BtI'BpI'QP׾I'B@ tu ǾI'pЋ$+L$L$8L$9ǾI'HQQQQRPRPjD$ tj.31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ *L$ tEH/uj#EH@EH`L1^_[]/EHjSP趭 EHHLSWV t$ vDh&WS 1WSSPPjjh= S9FDNHA`1 ^_[ËL$Ahh1USWVL$Ayt&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F5Բ9me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPwGX FPvt~C $i)ىQRP蟍 1D7D77pfD7 D7 4$~Efn'  V)RQPO fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPpL$ A$W t׉\$ A gOu\$ t9fA |$tApfAA 1AA tAfAA A AtfAA) 91jEVVhшhhrjJVjVQPh`t94C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*ChW%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0&ƋEp&PVjWPUCƃu4UtU&ƃuEtDjUуƃu:C(C,SPs{,1s$C$10s$C$s(JC(1ۅÉ؃^_[]hc3%hN3%hlh3%*USWVt$ kFllPvNj\$FFi )tkllklPRQى ,$kl11CPsjNj$ /L$s)RQt$ w 1/D/D/D/ g{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh-- WP1^_USWVL9t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$1K&L$t$ 1L$t$ QVM؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VWl1#Vl1#RPPQM EHemL$ U UWRPVQM tD$8h^L$8jPPQ蘖 $l$P tR/L$8jPPQ Y0ƋpǸl1#<$u hL$8T$ RUQPWVSjjA$$jBP$ L$+5(9PWVQ( jCL$5(9PWVQ j-tL$5(9PWVQ jDThEVŃw-49Wã89~$Uj-P ň$E Eۉ4$~Sj-P +@$t9Phr4%jPS< -49589j.SPWVt$UD$)PD$:PD$KPh4%hh`t9 0h$F)^_[]USWVUu @(D$=<9uj%<9]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;`t9D$0BD0 Cfd0 j59t4yLdI9LhD$$r1CExhIPSt$t$h4%W MA9`t9D0 tfMCfL0 L$ D$$91RSD$PL$QD$T$t$,|$(1PSVWD$T$ t!|$ t$jSVWT$ D$1L$0]D$ uuut$@t$@ij2j3j4CNj $Ut$TBDL|$D$uCD$0 ttt$ Vh3%D$DP( D$8D$ D$8t$XjVt$(1IQjFj QPg D$89D$ t PDV$PR |$YtZVzA MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ9}] aVt$ t$ ؉e^_[]USWV D$ 8t$8L$j QPez $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋91щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VS輺D$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h5$jV C `L$rL$DPh3%uL$DPh3%jQ D$D---D$D$s(9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh3%P# SVh3%P# VWS9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h5$j$PH t"?tt$ Wh3%D$LP8" D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PWɹ{{ t|$uuxD$tF ~,1t\tW pJ' D ޟ{u6H L> HL>@D> >jhEV> wE%rhD ޟ$uR1jPPPhɠhPj jjj%VjMo4x!t$PEWYV赾1@^_[]h3%h3%hh3%@WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ PJ'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; pJ'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vht#jS t$]EufEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=\9t@u.1}h[ju tEx 6%rt6%t6%M u@=Uu,>t'D$ L$L9;\M`|ˀuK(Ѓt tu tPjbjWBƍD$(PV $1 $$QPVDB $VXC9$ul$`=u]tP$PS辄 $5fǃU'VBWhk$h6% uRe^_[]SWV0\$@1҉1 F FFF =X9tjP4D$VjRRS/<^_[USWVL9(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h6%jkt1e^]USWV8=X9EM 0~klP1`ËE E8؃lklQSPO ߾J'L9$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS O F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h;%h;%hehJ;%NUSWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$9u dj9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$K'd$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uthzm1Ot1L$D1 L$8ɋT$]t"9tjQP{K T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(9u h9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$K't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nhz11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQI |$ƄE C ^_[]WVt$ hjP車 ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut;%1^_[]Ãt ux(tth}ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVF >uD$ D$iousD$fictO4uQG4 t51ҋ5.3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD: l$(Ph<%U7 hV"UY [Ɖ$Uh =%jqu D$Ph=%V^u wXw\w`h<=%VGuPwdhS=%V)uwThd=%Vu f1ۍ{aE4L'WuWuWho=%Vt E< t<uEMPWQWh=%Vt$<Il=%9|?"PVtC9z1hs%WltVބ D$PD$Pt$\$4Sh=%h=%WS] 1(^_[]hp<%hX<%hBh<%hX<%h1h<%hX<%h h<%hX<%hh<%hX<%hhJ;%ɂUSWVhj>}{1O1ۍD$ShPS$4t9+ōF,PhedAU!q l$$4$0$($<$8у|1҉$$t7 F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$ıt98t4 .jPL$QiB D 9D$ u D$4$P,$F n$9Љ} 1F$F )ЃF n$,$G9t$y$$h=%jP& r=t31>t9>u 9>t0uk9uV蚁V蒁OV芁U1@19$,|;ЃVMt$؁^_[]USWV@D$1PuRhj5z;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dK'uo4 FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hp<%h=%jg6h<%h=%jh(h<%h=%jih<%h=%jj h<%h=%jkhJ;%}D$T$ L$DrRQP> ËD$Djt$ PV USWVl$j/Uu 1NtbNj\$)CDWPUQ1 uHD/t(t+t!u GF "u^_[USWVPӉ΃=9ui"sv<9 99tx(9w4Ju1AQPiwã99H 9k4+$1 4+Vh&jR 1D+ <+ hrDVPh8;%jW躣 1D+'<+(D+($D+,t+0^_[]V΃=9un9) 1t(@"u9t 99t 4Hu1^USWV|$4L$0Rt$`VQW9 ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=9u U9~V19|(1@@89|~@w1A^_[USWVP=9|$(L$111=K'"\$uӀt0t u@tӋ;L'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hK't$(t$(t$(PPt$0L' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWV]nhhK'h,9U ,9jܛ911KjeƃwDݐM'DtGCuޅtH=9Pe9t)1ɀ<t ͌M'AuVv^_[1V 9t(91t ҡ9 9F9r9Pu^fUSWVPt$L1h;4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h{5%jQQWRjjh>%T,1^_[]USWVhu}WWPHD$T$L9L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhvL9@u ǀ@>1t$(F F>D$,Vt$}|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP3|$4r!1FD$0P2F;t$4rD$0=0ԷD$p÷D$6起D$v覷D$  l1#1ۺL$#PWVSh0RQt$kPWl1#PShPVYL9VL$'Qt$t$t$ t$PPhyg$h$L9$0$L9$pضFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C CfCC=9rC fC*C,G1ۍD$(htSSSSSSSjjWPh48Pē@,%Fhd>%hS>%hh>%`lUSWVXT$1HD$D$D$1D$D$9A D$ |$ 1ۋWSVPL tED$0t=L$49u4D$ |$y) t$D$ L$$D$L$L$D$(L$,L$D$C;^ rD$ tR|3|$y,|$tHt%l$%h>%hh>%fD$L$I1@ËD$@1ËD$@1ËD$@1ËD$@1USWV։ϋQP\Ëo tEjW`t9\$t$t6t/1FfA A 9s^9։r 11uqfA t$T$9fA tApfAA A )A1AAA tfA*A,)0|9u >^_[]h>%h>%hyh>%eUSWV$(E]0ƋEpجljl$E@ t P迬l1#PWVSjh]1U59|$ ww[4%t$R5(9RPSQV U59w$w V[l$45(9RPSPUŒ G\$skhSjPD PVWe9j!h.?%VaD V#hϫ%L$5(9PRUQ9 h被$5(9P%PUS hwPSD$PhO?%hh9 1҃9Q9A \߉$4-PWh9#j$W螋 hWh9$ Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,Ŵ9$EBL$ ;QU9Vha?%W$ Vh9Ws$ h$Rİ^_[]USWVX] E81hl1#PPPPhf?%PP轊 9_ vSL$QSWPL t@D$ tWD$8uN $9uh $9D$9H*hl1#Vh:#Ep[+D$8u RPt QPVW҃91VSt$t$XD$$VSt$t$iXL$8QRPt$ t$hf?%Ep[D$V9p1h$YQVu WPTtY$UtOwGD$VP )vVQj Pc W@ )Q$YQP" H LCF;puD$VPhk$EpjZ e^_[]USWVLt$`T$d\$1*kvs0C41GPjh3  9u vEL$QVUPL 1hPPheh]hj6Pjjt$(SP4ōt$ VPwUƆS"a~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59`|$.9L$`ʉAfAD$ 1Ƀx fJ1O S`1L^_[]USWVpU t$01^F4jjY1AǾM'D$ǃ@N'SPHD$ $L9L1OًP|T$|$`1 |$0jP4D$DD$ 9|$ 9ϋ$|$1HPPVt$t$WRQjD$9P;9~9h9P;9~9h9P;9~9hƞ9P;9~9h螞 9PZ 99~9x$t911@(4cP$ 99~9E ;h$r˃ 9$F89~.wy$M'C 99v-v*)NjVl$hURWv4PQd[=9@( I4踝UPWh 4%SO{9-9j59vv{9-9j59vv ZL5(9RPU<{9FF NN59j59QPL5(9RPVSh4%WNDC 9 9~?u 9F u 97#VRQh 4%PN^_[]USWV$$x+~8P(TjsNVUl$URWv4QPd@(1ɺRUUQQjj4讥 UWv4PQpu Wv4QPh 1^_[]SWV\$P,ǃjPNƃt Iu1PPPhp PhjPj j WVPy4ǃtSWkC=WzVT1H^_[USWV8] C4t VPQRL u s ss3r SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3'SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQ D$\$1hSSVVjjpw ;tUSP@u54$1hSSVVjjp7 |$u^WVD$ t$tL$ HPQ0vtpvhhyPhk$VDK ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV h/@%1jx$8@%xtD$PV= H$C@%KtD$PW 1yohC@%螙hPW D$PW` 1u!hU@%nPWhI@%jϿ1EWh_@%j.A hW h>@%W͘$hPSG D$PS u"hi@%W藘PShI@%jY1Ehr@%טhPW Wh5%j* 0l$Shr@%h|@%j t D$0@%PV$SPW h@%VI@%1PWQU豾h@%VЗSPWU h@%V跗PWI@%PUy0@%PV藗Ph@%U[ ah'%VrPh@%j5 ;h@%讗hPW h@%V0PWhI@%jh/@%khPW h0@%V1BP$h@%VΖPh@%j葽 h@% hPW* h@%V茖ƻ$3Wh@%hU4v 1tVUhI@%juŃ|$tjh*'$Ą ^_[]USWV ։Q 1Ht L$ L$$W $f} r= jh@%U u&USh@%D$Pl uhm#Z W Ņu>L$4t&t u$Ut$ t$ h@%j t$MW $ ^_[]USWVՉfD$/D$jhe%D$5Ĕt&軔8t豔SPh@%hUt VSU3 991j/UC t5ÍD$9tK9vH8/t@P% CߍD$ PW D$%= h$PW FƄ$/u&Г$QPh{5%hUs /h$PUB hhe%U* e=@uW% x*|$VW$P 9r>*Q?Q0|$W WJQ01Ĉ^_[]hUvl t}/u }$$tcD$U W Ɓ`|$tVhW%U 9=VWU 9%|$W x(W}70P>1F1SP0jh)#jj SWVύD$ PQ 1xVD$)tOjW+x@ljj PW W u $=rɁ uƉĜ^_[USWV hڐljPhW@j7 \$hjSsK jh@%D$ƍD$ PhW@VC7 t$1hUS&K ,$,N'tWP@u-(9D$C zE,$ !u1L$PPPPhjPPjjj!Qhm4t$t%jit$VW_Wn6V ^_[]VD$@t(L$ 4@$N'VhW1L6 F,91@^ËD$ (9fH ,9tPPQQQh@%j϶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj ^>D$48T$y:D$ػ˺$:$L$~D$<P t3l1#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$l1#t$DRQPh[C%jV|m D$ T$Bj59QP;l1#tZ%t$DQRPh[C%jV8m D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5(9t$h{5%jt$hVD$XP1WWjjj0ߕ,9|$4D$0L9L$QW<W,D$DPVs~ljӍD$DPV{<|$߉څu D$$H؋Pٸ"D$<h,%t$:<|$,] {t+[1hW%S<t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$h{5%jt$hVD$XP1PPjjj0k,j D$DPV D$׋D$@t.3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWp )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j59PQ |$ RPh5$jWi ;(9CVpSjP jPPh/9 VA(^_[WVt$ 5xj<K5xj<~$uFjP:F$1O~(1h/9QQhhhRjFj WjPv$h09e4F(x;F,VPWv(fv$@F(F$~,v$@F$1^_USWV4ˋA@Pjq$B C{$t%K0 u G fG lJuO'fG G5G*G G,I,G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPd+{$4^_[]V$j)ÆNv811Fu >tlIut5t.j+j,L$PVh}U%jPQ\f 'u tEj,j+蹅L$jPPQ h?"cj*蒅L$QjPm6 h$<j-kt$R5(9PhP$jFVe j.FhO'PVhbC%hh09e İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j59RQ3L$RPhuF$jQ9e G<(\(|(Pu#]j#艄L$>PSWh4%j&Q%j59SWh3L$t$>QRPh[C%j&Vd $F|(,u)|$hf)PhC%j(Wd <$1e<(Ou*?D(Ltۍt$hPWh~C%t$t(Tt(P/PWhP$j(V=d 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhC%v:5t 4$<|$|$upd^_[]1؍L$>PWhwC%j&Qc  $L(4RttD(8tPQ҃lj$uFt(Tt(P6lj$FD(Lt&h谂t$PWh~C%j(V$c 4$h节VjP  lj|$D(dphYPVhC%j(Wb *USWVL9$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPváL9H1WjHDWWQZơL9$1$ L9@u <@TX uDHXT=9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wl1#WRPPQf1ҍD$*W Ql1#QRhQP9D$$W Ql1#Q1Qh0QP&)ߋL90D$pL$$QL$.QL$QPt$SPW0 L90NjpL$$QL$.QL$QPWSSj'[0 h$F0W|$pDG$DŽ$$T$0<$tT$@BfBB.ffJ B .BfJB.B fJ*B,.=9r~(uB0fB:B<.@1L$0htWWWWWWWjjPQhZ\4t8P/\@,|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!P L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,OhW%D$ P#t5h,%t$ j#u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$VfGT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0x9)ދ|9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ- tt0\$4S tt<1^_[USWVGD$5в9l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 199ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDXd6AL$D$~@ 1ø11OT$LhtQQQQjj PWWSRh649tBƍ|$WP[(Vo7x#9}9k<4LE1UЍe^_[]USWV19T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=t9t*=H911M<t9\@u 9DDMHEr=p9tO$9D$PP1ipt$1t9 :ut$P9t:,@uލEpr=99J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@H9D WVu)y8u.q$t"y8uqxu Hu^h#h_E%hm hE%D$x8u@h#h_E%hm hE%V 9; L9tDв9t99t‹9u€в92t в9^WV΋$tRttyu)в99tЋ9uв90u1H|$5в9,1C1҉T TTCD ~k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D ~$kt$$t$$OƋD$&$4WVPhE%hSD M$4jt$t$8u"DH $4jj hl1#QPjSsnSW"?D$5$4whtiD$Pt>ShI%h>T$\$ 9$DL$4L$090|]t$V豳Ph@%WS 9( ( PQVhH%WSt$\$ CCa59.> >,>(>$> D$)Pt>ShH%h,S$$(t$,t$(r ܞ9t P[ 91`ܞ9tWWh1F%CAOWhF%h'3 ܞ9t8WhF%Pi ܞ91NtjhGF%PM ^_[]1N=9tt$hD%jPMR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ L9V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$萷$ytP-ptYWtDžtFE tWPV u WVDjVSe E t VPwVq1HPPS| ƃx90^_[]h#h_E%hm hE%< USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4S'jP8 D$$tI UVS3 ,OuShk$$p yh"!v$|yh# v gyh$ vRyh% v=yh& v(yh' vyh( v PhE%WJ^_[]USWV$t$8$03u*11IhtPPPPjj PQQjh3P403N wT$<+$R'91N9RP/׉Vj 1G$h)j$~,"-. / |$4hn1#PW 1PWWVVjjU( WP xL$<1$^_[]USWV4T$H1z$X11D:tL\$St:PQL t2L$ D$; $…u $;Չډ $ڃ,ut B$Hrt)u.$CM$։$B(r,JֺK$h9^~x14^_[]ËD$1A1҉PPP PP@ HH $hLRP USWV l$8fD$-59u61ۿS'P| 9މuڃ59J\$<|$4$R'h3p SPVh65%Woh4MǸsu8j59  L$RPh5$jQ 59h5oh61PPWVh65%U4du31PL$Phk$jQ 59h7t)u D$ hn1#jP 59h8t)u D$$hn1#jPz 59h9zt)u D$(hn1#jP< 59h:<t)u D$,hn1#jP 59h;\L$QPVh65%W! ^_[]USWV$@1K $ $S'_ 1hSSVVjjh<\$  /t$l$ WSU! Uh %WSQ S舒 |/D1l1_L9, 1=WV<VH /11 11$> t1$?$J1$@( 1tiu`$A,\$ D$4hn1#US 1USSVVjjt$" SJ xL$1^_[]WV|$ 1uOG Pǐ t/1; }O"h9x 71^_WVt$ F1hWP_ dž dž dž$dž(dž,P40^_USWV$h]t$hPVU $$$(S'D$@{tUhd?%V USV赑 8Ouڋ$xhKuhLSPhE%V}C(~Phn1#hV }hMHC,~Phn1#hV }hN#C0~PhE%hV }hOVPhE%W^_[]USWV$T3u*11IhtPPPPjj PQQjh43P4T3Nw'$Q($܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP 赊Qkd)QhE%V1 ^_USWV$h]|$hPW $$$TS'{hU VPhE%{hVvvPhE%WK[hW\1~,t[hX?1~0W[hY"ǃ4Vދ uh]V0FT~Ph#hWj shZ[h]1~`{h[vXPhE%WF\~PhE%hW sh\mFd~Phn1#hW sh^HFh~Phn1#hW sh_#Fl~Ph#hW sh`WPhE%V/[ha1~pPPWhE%S^_[]USWV$@1N R$eT$S' 1jWWVVjjhb|Gl=OlL9,1۹cWS<S1,G,10G041jWWVVjjhdI 1`G`fX"g\hd ihD$4hn1#QP 1PD$PPVVjjU D$PC x1pGp1^_[]1wwVt$F~|F PԈ t1@1FF^SWVT$1ۉZBr 1Bl@ZpLQkd)QhE%V{ ^_[V=9=9 á9thi(9Vt$9uhi~(99w1 k<9^Vt$=9u hiK(1t*u9 9t992tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hI%hzI%hhI%8 SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F$V'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$9uh)9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IQ sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW? .Qw$$$S'@21^_[Ã!t*Wp1@<QcWPV} rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$PhJ%Qb D$D$uPhJ%j_t1ۉ؁^_[]E@USWVt$ $=9$WhUL%jP 1t t^_[]Ë 9 ÍD$TWhgL%Pj1~jDj¨tD$$?"Vt$X}ZVjrZD$(D$`C\$\C D$XD$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h8B#W ƀ8tt1tCuVL$ D$ j jV+_ É$qj jV_ t#D$Zj jV_ D$T$C\$ \$D$|$u\$uthhd?%Sn hVSn \$E61ۉSt$,j SV^ É$ tbD$ ʉ $tQD$ D$tGjh$t$}VH tOjh$V4 tdjh}$V te|$ush?"jVXD$(krT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h{V'l$}U hj$tJ@j`PQT$l T$ $B0Z,D$B8D$B4D$Du0|$\t)Ѓt$XPg T$uD$DЋL$Ht D$ D$,D$ T$HD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPvHƧW跧߅uv覧^_[雧hL%hL%hhI%1 D$phL%j iSWV=959t^sI3?t#$t$j(PVd 4$_u9hr|$0VPhP$jxW WVV &t Ĩ^_h %hcI%hhI%C USWVσ=9u hi 1t0?t+9t!-9E WPr tt/|$thh%S_ !hvS_ u4$$$$$St$hK%j ^_[]SWVD$Qt$RhK%Pj h?"t$I$jhhV'P@j`WV\ -j(Ws tj)Ps t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU蛍 |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3hn1#WU^ WUUjUx H>wѻPD$x0hn1#SU& SUUjU@ H=wˉL9DD$H1Ƀ|1M1҉$PVRUC 1Q\$ SRP1 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á9tp.9Vt$ 9u V. 919vFt=N9wu1w\9@9^ËD$Hs-s ['.h#hM%hhgM% Vt$ =9u-(t;u2L$ rȃs['$tu(91 @9 :^WVP|$t$=9uH-j PV =v1t-h[t `9t4\9^_Ë $9u։^_-=X9tT9ù^-D$1ËL$T$t$ h24.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh?-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh9,^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Whg,^_USWVP} uD$Ph2e,D$PhG,1\$}UM;t;Gs} ShD%q} ~ShH%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWǒ L$D$ T$VQPRt$VhI%h$P@ $L1QhPjV貁x`WhydPM~ D$V@.|$t;jWSP \$;MU}hM%hM%h hgM%; 1e^_[]RSQiP Sh%%RQ藷 ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS/x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSރ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H\9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSVB )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt O%t؃^_[USWVP]}tG,t Pw,|U w0D$PQ#tC\$t$hK'wSVt$t$wL'G,x(t$1U1t$4t$0t$,t$(t$$t$ t$t$;M ӻ|M 1JRRRRVPSQjD$\PW,D$8L$SUl @$\Cǃ1:k0hWV>x D$4WhPW$XsgD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(tÉ|$Ue#D$0jPUQt$(1 Ⱦu#\$,hPt$ T Wu|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P' PʢD$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjktFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14HrFuU9rt$D$l$x Ptn{ C K$;}sL$4QjSPL t_D$HtW\9)1ɉAw Puu2S"j@jPs fdžUSq1ۉ؁4^_[]hAL%h"P%hhgM%p USWV,D$D D$HhjrjƋl$P\$L|$@Z'W2% F|11Kn^؃N$F Fdž?džjh>USff @džPWwt%D$ D$D$D$F11,^_[]hAL%hiP%hhgM%n USWVhED$$11@D$|$ t&1ɀ8>@,19QzvPW! D$vP6! 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[hQP%h5P%hxhgM%W USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]fUSWV0$H$D715d:5`:5h:D$D$ D$1D$hP%WUp& pu D<h:e~ft$lt*zD$ƒbtCeubD$벡D<D$ ChjVV5D<hP%d:`:zVhVV5D<h0J$D$Vu=!39}4D$$D$l$ t%1PPU D$yUhk$IL$ tHt$(UhP%V) h{"6uRhP%fD$0Pt$> #D$8=$$ d:`:jÍt$0ShV u UPVD UjD$0D d:`:Sy hP%t$(V1|$P/y hP% y hP%vuWjt$.1St${.4$ t$Q%Sh(e#PPt1hP%t$t$1.4$t$5t:5p:x:\'3|$t'3|:j'3t'3=l$u1HL$(Qhht@PnB PtL$* :t$[Duh Q%lʼnP-yhkQ%TR D$ yh"Q%@$uBL$$4jPO-4$t$V6͓6h7Q%jLPh j V j|$WUt${ x>tq1.SPt$  y4Y 19u2p:t:)uY 8t1FVhIQ%1FVShWQ%Vt$D$D$L$D$ L$ D$|$tvD$ P1ƋT$ уƉǃtωÁtt؉D$ u gX 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj RU URL$ɋD$tPr VV P4 hl1#PVhwQ%h'3} jr V jVT jR VPJ^Ð=X3u 6X3|:@=u1HPx1;X3USWV}uCjh:6 ::::::: : ::|$(jW 5:5p::t:?X+=::@1;:)ω|$$\$ :95:T$s;D$0:D$(L$, :::D$:D$$D$ =x:EtQ1$w ww7wwVWV' 7www ww$PWjU M$1~~~ ~~$PVjT 1@F ~~~~WVW& =x:B5fDŽ$ h:t$Phk$hQow 1Fd: `:ƒ\$\$xT$T$|l$x Y&ݜ$݄$ X&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh$QPv :9|ӡh:tPL$ L$)΅~DQ4))hl1#Sh4\'Rh$QP@v Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4]'QPh$SWu L$(+ :T$,:NjD$0+:x@B‰L$hT$ll$h\$@t: p:1F؃D$@5X&|$vqL$`\$dl$` Y&ݜ$ܼ$X&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4]'RSt$Dh$QPIt  d:`:ȃ||=t:p:݄$|=s4;T$D$r(|$$\$ ؍4)h'$؍4)h$QPs ƃ}u 4)h?"QPs ơ|:@=u1H$VQPH e^_[]+: :T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$PpL"u%hQ%SK 8tK 8#u$SjV% tGtV $1E48FB$)Ex t$7@[hQ%h R%,K hQ%hQ%J 7hQ%hQ%ES^_[]$Vj$ 5t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjP{EuhX%hR%[RÉhPKt4Vh jP-EuhX%hR% R1H^_[USWVp $$$!19L$PVW1Hl$U ƃU VD$PW0 tb$UtM$dtj $dPU t$jW+ tu)$-j4'WUq 1Hp^_[]Ë$j-UPr D$L$PjD$L$PjSVt$ t P닆t>PDudžW1ۃ1ۋt9PLD*dž- t^[VG VR 1uG 19^SWVlT$|$$VPC1Nt/ǍD$P PSWi t Wwl^_[USWVӉjh0jWQ ǃt{jjjVAC L$ F#tl1##tŃ]R%l1#l1#t UR%؉l1#te%|$ul1#SQRPheR%jhVh ^_[]USWV$=~lF 71Ha~B11ۋ$4V <(Gs@ ,PVQ C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)E jj9ƅuƋNtHNO N uFF9sSP:tVF^ St$P; ^GNON1wOWhPw [@v?V?1H^_[SWV$uShR%h)R%%M $%~GuG$O1@G$GD$GD$ JPRv $ tOt;HO6FD 8 8D 89hR%hR%gLNF G8~ ~u3FVhjv 3?uhR%hR%Lt6hWv  t%uhR%KPWVu  s V^_[WVp׉$ftPhER%h)R%K jL$PQW jjP PjW tnjjW t\PjW tHD$|PWV t2Phjp =u6hER%hR%J"hER%JW hER%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Seڃs tAt1t% t&%SB su^_[]USWVt$48`ځ% t0ty@ !ȉف tVeBt !ف tV-dt ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW/jW$5^_WVPt$4%5@u^t8tW%Vi$%8Vh#j>#45@u`V,<jP, u hR%G,dž,shR%\Gj>3 t1t3u5i$0AR$ i$1PhY%F AR$ i$1PWhY%F^_WVt$ hG"PG4r%t8t7 uhY%W諮㋎8 84^_j+>^_USWVD\$\t$XFpt+NMT$PQhj@Rxuh S%FD$n D$SPU6rVt)ǍFtۉ,$t1j@SP SUh2S%E SUh S%E 1KNދl$Xu^1Ct'D@Wt$ P+a ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFD~ uC t<6@u,uVr'F@ ȉC dt7`1Ҿ<1uCD1`1dB9r ~ jr&`ǃdf@K`1ɉHHH HrF>rD&>C5F $P w_ǍCWt$P ;)QjP7 hY%Cbu^_[]ËFUSWV |$8t$4l$>Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhrZ%N> SWVt$~ t^_[ËD$|$F @PWD[( ~ t͉^_[gV6uYhZ%Qk~LtV7At(t NHtU<#t[S%PV"^WVt$ >~Hxw16tЄuOF$uItV@u hZ%=jjAV? u hZ%<^_vF$ljjV? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC PhAT%;G$C$G>C>>-ك**PWQ WtgAt[ƃx t Ph T%Z;!T%KFNtTHNUh*T%;j3 1OW3 1OOWt#QWtJV<1V\$ GtIO9tA t1UhWT%:@1ۉSSDo% 1G|$ ~UVt$$y? { t S^\$ HPtQPV P;uV--US@^_[]USWV׉΋A PhZ% :11BUY%tPVVUU0n 6ujX1^_[]USWV $ D$PQhh" t$hzT%hkT%9$1PhT%91F\$ MbihS$(8 EuVhT%)9u0 87t 0 8 uF띃tVhT%8D$$ \XPW?&Ƌt8t* SV/>uSj$( ҋ>$ 1GOtHONG Pt=K3uFGGtIO9tA t3@UUD" 3WQjjs.>jV*ta<t$VtSs< t[=VS>= hzT%7 ^_[]Vt$N Qt<tNH9HHu^v$QP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/. 7 VhT%h"7T$1|$`F(f9t(~ tωӍV QPRhT%u6ڋL$tf~(^>8u(F*4$QPωR ~ tcF D$F*|$ <UWSPωT$sP\$Sh)U%5 <PUt$WLPShFU%5T$ V>t*4$QV H^_[]WVt$4rDD$ tN8tCt;D$ jP,b u!hcU%hR%5 j,^_Ã~+ajjj蟕 ̓khU%hU%htU%4 1m9hU%hU%htU%4 <5RhU%4@hU%hU%htU%x4 111dhȒ%hU%htU%Y4 @+X1BWDPU hU%hU%htU%4 11G1=::6u PW+:zhU%hU%htU%3 t0SvPhU%34WV11PPPVCD@PjVN48@t @ sfyt ‰48WVK^_USWVP$t8D$ \$9}$w ŋD$4V tE9u݋D$ 9t9 uZ<$hZ%WN1PPt$$ UVW WݖW;9t>G 1PPt$$ qWD$$ W4D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1,G@8u^_[]USWV \$@l$8;hV%W4 .h*V%W !h:V%W D$$D$hJV%W |$t$<t$ ǃt1Fl$<4 GF9uW$t$<l$U WUD$P E t=1FߋD$@D$Pu Wt$U EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]$ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWC tFt$9t$VЃ с u VZV[}^USWV$ 1t$t$,$|/xhgV%W hV%W  \$0hVS> jǃ0V%\31O$(0@4jVc9u1 1@PPKu1Ajj2 $$ uL$ D$l$,D$D$D$$hV%tV%Uh_'PSVx?u$hulM44tN6uD$륍HvH w<$\]'D<$`$8]'D$U%D$dD$YxPD$U%D$; $hd$ 'd$ 1@D$D$D$$l5D< $lD$U%D$D$U%1@D$D$ x D$ %D$ D$D$FD$ 9!3t$ft$ n($lz($t$p!3)$$ݍ\$0Sw1VVVSC7$U$ PjSeB\$h \%y D$ 9!3$ 4$|$4Wa?!31VV4W6I$ $ Pjl$@UAdD$D$hs\%x 1hs\%$hu($huhs\%Ux $dL$ 9 !3%$0gV U#|$tl1##|$l$0$the%QVhV%j+Uu? $hh]'hnV%@ hK\%w 1l1#PPPhV%j+l$DU'?  $d$h$d !3|$$tD$9tD$U$w <$Z$d$ht@4$  t% Љ$h$d tD$ @P%$d@gl$0$hW%<$uhI"hV%u$e$jj > $Uh4jh]'vVv|$t`U芹HrFPt$h,W%# \$SV@a 8$$zU` $d$h$d$h!3T$QR$4 $ $dhI"hW%l$0<$sD$t<t,<ulh:\%u |xU uDh\%t ULN h)\%t Ut D$1DY Vh""4$hI"hW%|"D$1Cl$0$fu UuhI"hY%?"D$PU'$tCt)QqtrqpQI#$PxDŽ$WUZ:$ t Pn $@$1U$s$U# U,C$;\3t P$hP@1uhY% $ht3$\t'L$jQP议 uhI"hR% $d+"$le$V$h ؁^_[]Ë$ r,u'!3Qj$4 $ u*$d1PQQ $  $g@u hcW%$ SUQ hW%$dB $h$d$hUh?Xjj$%t'UhcXj$,$hI"hW% hI"hW%VhHW% U$-h#3 8thI"hW%#$d L$ v 8 h$d$h$hl$0$hhW%莖 u!Q 8thW%hI"hW% hhW%V u! 8thW%hI"hW%G UtUhI"hX%UhBX%1]$dr;$h@ щ$d$hU觴tePhI"hX%KD$$Pjh0j0-ʳ h"}UPhX% :$d$h҃ ց uڻ$d$hr>1r!3$ L$QPUV [$d$hX%r !3$ l1#l1#tX% tX%VQRh%qUHt$01D$[hPMu hX%lVhTj$$WuhI"hR%7$u($dr$h$h$dL$$PQV!$&$1l$0~O$4P!t x uY%X%$4PF$$9|t$t׃z  Ru$hhAY%PHD$0P`$fh[Y%/h%D$$L$($\PUhTj$h$ uhI"hR%Ű $hhdX%n$hD$$L$($\QJUhTj$h$< uhI"hR%V$D$xhI"hY%jihW%hI"hX%ChI"hYX%4hI"hX%hI"hX%$4 PhoX%$di$8l$0t+1 tVV$ uދ$|$WPt$8V WVD$$f@t D$0P&$1t*1G{ tSJu΋[uً$d<$r0$1Ʌt z uRl$0<$l$0<$u@u0$h@hY%PAD$0PY't#%@tD$0Ph#Qj$[WD$4Pq0$01~ tVh}-jj$vS WVjh-#%蹦t*VPuVhZ%DWlh-#%h#'^_Vt$VǬt$pApdr$PhZ%EjjkVhSjdjw ^WVPt$D$uPhX[%h)R% jP,蜥 tuIhX[%h8uM, ,ydž,>wt=D$|$ffN(ffOfujp ȉG_1_F*N>QPS F>)^_[USWV$lt pvh7`%PWe t=wM$lD 8th7`%hk$h$u)he`%h7`%hhK`% $$l~>1ɀhL QSP ƍl$hUPt$ UU4 =wfD @PUhh7`%W8udhe`%h`%htI{>tA,$fEC(ffEEK*S>RQPp C>4() P:1pČ^_[]ÍF Phn`%n tt {>u[[ht h`%? ~>t$fF(ffCCN*V>RQP F>4)mC Ph`% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#> 1HXjzu V >8t~L$ T$pFhf@H X@fPFM1^_[]h=a%hR%hGhKa%hR%hHh`%, D$tFL$tt 9Jt   z 1HBH@M1@h=a%hha%hh`% USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jrDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h=a%ha%h ha%ha%hha%ha%hh`% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h=a%h{a%h|h`% D$t L$HH@Lh=a%ha%hh`% D$t@Lh=a%ha%hh`% 11WVD$ t!L$T$t$|$x0p4P8H<1^_h=a%ha%hh`%F USWV(l$<\$߾]'1|$ |$|$<$E4t.1FM0 I?ru E4  G9rՉt$@Pj荕 1Nt91D$ D$D$D$9E4t$1E0jS4 t G;}4r1(^_[]h=a%hW%hYh`%f :tD$ :Q::WVjPj1tMƃPj0 t/1vN F NN F N$(F(N,FH V4^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t P-NSv@1F@FDFMF t@PtQPV Ps؋PtQPV$ PRF uPtQPV, P*F(uFN^_[jt$USWVu-~L =:t':H ::N8tv|x| @t,'\$$'3SVUC# Uj H1 `3 s SVWV  ^_[]PL$T$ D$$PXUSWV։ $VhU_ S PUh"Wn ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXád3ËD$d3 SWVhS$ k 1OtFƃ ||t - +D$HPh3Phk$Q] h3^_[á`3ËD$`3@P V hjh`3h'35`3- jVP |$t V1H1@^Vt$tNVV VLfV0jVVQ6^^SVt$ V(1Kt=jhjb t!jhjF 1ۃۉ^[) Vt$t'PύdžtP豍dž^鵆D$t$t$t$ WV$hjWa F jPWү Whi< t D$F$11HĐ^_SWV$hjW C jPWn Whi 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyHutUSWVTt$h^>tv 7 V1H11Ʌtd< $BD<IG9uލ|$$ ^ F>L$jPWV) uF>*PWVJ 1T^_[]VD$0tVjVf"v^USWVD$8t$\$ 1wG oHt/usOWtjURQPwVjS$IOXxuP uf@ wQ|jUPSVt$,Vj\$0S ?O^_[]ËL$1t$ËD$t 05[ VD$0tVV!v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV Fjŋ$@VT $1WT$ȍD$l$C txuD$ Psqt uCutF L$0QP tًv\$~;1$D$0Pt tF9u19D$$"$8ЃD$P1~11TjT$4R4U t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4Ŝ t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$uVh!b%t$ 0|$w$H5D$hj QNj$G jVP蛩 CG$C D$ t$jVt$dVr C yQPD$|P D$lD$ @D$pVhi$ D$m@L$ AGA<<y4$<$4$D$0P$0 X`~,$d1D$0P4 nE9uD$t$0V$.l$wVhMb%2$]4$w ɺ@r <t.<5L$ 1@ut$hMb%11@fG(t$ FG>W*$VTPRt$ $6@utW|t^WZfG@GȉGDWt GLGDw sWkGHGMO9Et$hb%W$AD$l$t$0<4$t t)|$ jVW3 w_ jVS rR 1N^_[]j:SG t/@1UQhQQj QP7 G8mt (G8GjSP詥 O t .3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4USWVP~!D : : ::hle%F: : $<  O+hQP֠ =v1 LJ\$ I;<j,jxt ǃ| hDe%j,jt ǃ hDe%j,jt ǃ hDe%t$$WhDg'V D$9rhDe%hPe%Y$|$ 7D$PWGD$t$h8B#D$P0 ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW̖D$u?\$S谝 J9t& t uJ؀\tJ\$9u돉닋x$8|1x| $A AAhl$<t$$hV0WrD$t|#t3=w&AL$0hDe%h" HD$1D$S0Wr 1ɍD$D$$D$ 01D$ύD$PD$$P=D$h8B#D$P* ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hI$UO hb%U9 h<#U# $D/'hc%U 1Ʌ<$t$V! H9t- t u!H\Ht$9u1@$D$$<PSi 1Ʌ $1@D$U$@tXtT$@S3 $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPdg t6ʼndt$_ `Dd<t A`NhDe%<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щ؁$^_[]USWV։ϻ`l$Uf' tu;uHUh{e%f'D$uuUh#t$$t$$Pf't$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPtt*t$1PPU覱 t xTuXTj卆jPW67 X6H(\x|tW,|u싾xWtW,u싾WtW,u싾Wt7hu닾WNtW1,u싾W`V^_[]SWV@t.Ɓu$È@Ƅ1@ ǁt!t !ց u %t utxx^_[USWV |$,t6D$(!3|$$t)`#L$# $ 1CƋl$ \$18V%sV%Sh_'Pt$ujt$\L$,1VSWP|Wzjt$\t$ VSWU^W\jt$\t$$VSWU@W>jt$\t$(VSWU|$Xj=|$\WU NÊ@tC< t< u CCu1j h g%W豄 _j hg%W虄 jh#g%W聄 \jhJg%Wi =jhCg%WQ %jh9g%W9  jh6g%W! jhlg%W v jhug%W  jhg%Wك  j hg%W !L$P1T$XPiL$T$t$XV**1K&j/V uD$|$PLjPP PL$LrL L$LrLL$T$t$XV)1Kj/VR uD$|$PDjPH HL$DrD L$DrD |$XD$Pi4$PTt$X)TCD$P@3|$XD$PJ$;\3t P"11j|$\W#ƉD$VljW"t>th-#%V V$ǀlD$P \|$X L$P T$Xj$HD$X|$PjP,"he%he%D$Xzt$P jP!]hb%|$X@ D$P$<at$X轁  $<Pv D$PU|$X hF#|$\W| t$1VWjWWWWP苃 L$P9>t$Xhe% |$X t$1VWhWWWWt$tC L$PA 9>t$Xhf%M |$X< $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV$$6?mjt$\D$ 0USWVSQQ jt$\t$$USWV5Q3 jt$\t$( D$Pt$P1t$Xq%mdžD$X 8 j/P 1|$Pt@j/P tƍt$X$t/F1V$ |$X t$1VWjWWWWt$t舁 L$P9>t$Xh2f% L$P?)‰T$Ajt$\ hb%|$X7 j,|$\W  ƀx 9l$Ps%ƅ@|$1WShSjSSt$t蜲 ,9hif%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFup냃|$Xt$1VWjWWWWt$t L$P9>5t$Xhf%/ |$XD$P 4$HLt$XX#L|$X1K|$XGl$PGt< t< tGG1L$1V8"7T@jPX  XL$TjT UK< t< lGG|$Xt$P\At$XT| \he%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P$Ɛjt$\V3u7D$0Lw 8t$Xhg%11IT$P  8D$P(D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPW fFPfFSfFVfF^fdžƆD$Pf$6l$Ptu|$Xt h)h%D$XHU 2 )@Uhh%~D$P|$XkD$PD$PD$P|$X0$6t$Ph1h%l$Px|l$PŌ*E$ |$X.E$$(1|$Xl$P$Š|$XlD$XhE< < ED$PD$PD$PD$P"oD$P \D$PLD$P <|$Xt$XV聬@ $d |$X|$XG\$PHE  @D$PD$PD$P@D$P|$X$;zl$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV6Hu8jt$\t$ USWVHujt$\t$,USWVHt$Xh{e%mD$Pl$Pń$1D$X2u31L$,|$X_D$0K&   CD$XxG< t< tGl$Gl$1USjSSSSt$tVx 9]Jɋl$t t + OGuhh%D$PD$PD$PD$P |$X2t$PBjt$\)AlD$P\D$PLD$Pƀt$Xhvj%|$Xtut$1VWjWWWWt$t:w L$P9>t$Xhj%D|$Xt7t$1VWjWWWWt$tv L$P9>vt$Xhj%Qhj% Ct$Xhh%W~ à \$S˯ƅ|$P4Phf%SV]  jV@Ht t u@j/t$\# {AL$t1|$P# D$sN|$XQ1j:W訖 l$t2At$1VUhUUUUQu 9.Rhh% j=Wc ED$(E@1 t rH@WhOf%GD$Pƀ 11 # yD$Pi1t$P XD$X+.U$ D$L$t$XYd$D$ $D$ D$0D$ D$,dtV`͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu Nul$P`BjRQ¼ ƋdHR‰`df||$XD$D$ DD$ DD$ DDl$$j/Uu G VhXh%T$P?@?Uhe%]D$(he%GC Ɔ hf%" D$Pǀ~hh% 1K$d Vhj%  hd%dD1DDD DD#.u he% @ ;1|$1WSjSSSSt$tVGr 9t Vhh%_t"Mt t [ME1UD$1\$P@jP誺 gQT$ȉ|CD$(1h}q$WCjhq%W-1xhi%Wh$Wqh="Wlhqq%Wfh|q%WCh8#Whq%WT h"W{w hq%WeZ hFq%WO t$ hMq%W.O hSq%V^ h[q%VR hbq%Vi hjq%V h"V hq%V hq%V h$V~ hq%Vh hq%VR h?q%V< hh%V&z hq%Vk hq%V\ hݣ#VM Vh^i%T= 3 t *KC   t KCWhg%Ɔ  Vt$P1$ƀh!hih%ttC< t< Cuhi%ǃhe%slD$,@ǃ%Ɔ 1YL$PjGt$PAjW @Kh%W t-h%Wm th%W[ t hfj%W9 t@hK&V thlj%V D$P@tsFH t t@@1G t 7H@ttC< t< Cuh2i%Ƈh:h1j%sF)< < Fhe%Wd 1$SUj tUhg%1C CC$f8l$1USjxSjSSWk $D9]{$ƃWhg%]ttC< t< BCuhHi%Ɔ )L$P1SF@D$PVL &" 7"ƇhD$Pǀ1^S#؄  H@เƇh7D$Pǀ$Ft< t< u GGu1L$l$S L$1Wp F <$W[ÍD$PS#CUP#؃8L$QP#t$PWSP T$Xj n11jU\QÉD$=hi%t$PjPj 1Ӄ@ (CjVtl$P@ hH"1F؄t  H@hh%1K؃<^_[]ù@D$Pǀ=ǍhPVj -hQj%F -{ < < ChRg%蛿11Kh@߉D@ыD$C*A*B@zhe%$| Cg{< t:< t6CSݠNljjU? C%{< < Cnt$1VWhWh\WWS(g L$P9>Shg%2l$1S 1K4$ƍ|$WP FWPw 8UPh D$P4$VP L$PT$XjC"ut$PjPxCt+j/S tIGC1L$Pc 1D$PVSj u7tb\$1SVhVVVVWe L$P93tQUhg%tGShg%覼1F FFv@dD$PƀMG=6 @/@(!  t$ %|$(t u$Whoi%t$ût$1D$( s$t %@uhi%葻?suhi%ptF1tC< t< Cuh$Wt)Wa Åu"1rWhi%-1ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP t(t$Qk,1҉T(T$T T!he%,S譬VD$0D$ FD$(F^ t8Uj ljD$FWUP艋 >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$Vbj >"u y"uIFA $Vjat*Ń!9 VSa ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=.3DWtCT41Fu|$ D$ |$jjD$PW T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P5W T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vͮ 71M^_[]USWVՉϋR] j=P蝀 ,$|$D$ Vg 1ۉ\$t?t9D$ 1j=S[ )9uWVS[ D$\EuV4$] t5ƍEjPt$ ٧ 4DL$hj%Uhj%hj% |$$t#4$\ tzSaD$už 8Vt hCl%ňjjUq jWUq Gt ;D$TG9t ;D$TWUnWV`jukGTL$tIѺ!! t=m%Wjv3u! 8t 8t hm%(W9߅81SSVp tLWVmWUk9t!蛝 h,l%ҥWSSVp Džu1VD$PVD$ PD^_[]t$ t$ ËT$11;T$ tэ HUSWVPՉ΋BTx tt /4u$UhtEPXt1^|$H&tem%lG|E|GT;ETUWyGttEtuGMQPUupG8M8QPAu\Gx;Ex$UV0htb@tt EtGT;ETu8M8QP1WjJ1uΛ 8t$h}m% 1$Uj1u藛 8thm%ϣ1ۀ<$tWVkW؃^_[]ËGx $;ExtUj0u: 8t hnm%r$=hYm%hRm%hhHt4t uxjhf'P  /1hm%h$n%hhm%? D$tEHt;tu&xÃxu x uxux{ /1hm%h2n%hhm%ْ USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+˘ /1NjB1ɉÀthAu_1ۀ=:uD1FFFF FFGF:SVrVW_uH:މ^_[]Åt 1u19[:Rt1hm%hAn%hhMn%hAn%h'hm%~ USWVP|$G<t<$ $ l$W)Ã|WhVؓ t(ٸF|$\$$)؃|PjV裓 1=:u+:W9u!:3 /1N^_[]hsn%hen%hnhm%臐 SWVt$|$~tuV\t1WMu;^G8u-8rt!1ɀu,r)É!rPWV ^_[hn%hn%hhn%hn%hhm%趏 USWV|$t$)Ã|UhVC t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQESyKWVPQ; ^_[CPh\$WVS 1t߉hk%hn%h{hn%hn%h|hm%虎 D$tL$tf Hhm%hn%hh%hn%hhm%T VD$t&L$ t/fqPp QPI H^hm%hn%hh%hn%hhm% fVI$g'Phn%· u^USWVD$t$V|1Ij0V1|$/ooo WV5]'t-1C ]'I?r   DE9u֋-]'t/11C ]'I?r 诓   DF9uWt$V<脓 1ɉt$\T$\RVQ2PbVt T 81I $ȃD^_[]WVP|$D$L$ $QPWf tWjd t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjPu tbL$1tHhFo%h"o%hM8| /IG?uWG9rD$^_[]h2o%h"o%hhn%茋 USWVl$t$|$t1ۅu>t7NH[S%t&U<#tÉS1ۃ1Ct:tVZtXtShZo%t؉8txt@HtPt؉CjVmt.V%t!thbo%`t؉Ct:8t1V]t$t8uC^_[]CWV΋:t$ FtPVJ 1H^_SWVD$1tQ|${t[ 1N4~0jhoo%W= uWWfI G9rЉ^_[USWV |$ 7u ;l$$Ujho%Uj= \$C UPWho%OS1t^DžtnjSW [ 8thp%h[#莗9hto%1HzSlt$hp%h"S tG11CGt0WH ؃uhto%ho%?Ņu1 ^_[]Ë$t|$u%tPWhq%hq% =mQ蠠PWhq%h(q%迖KUSWVӊB D$ L$$t W *QPEZNjD$$7@uMh#IRo%tQho%W = Pho%Wr |$ t$hp%WM }D$D$h p%$UE t$ hZo%U+ UjF |(6hbo%U 1>hZ%Q~ hU<#$U~ 5h[S%U~ h$Z%U~  h&U~ h!T%Ur~ hY%U\~ 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jS+ȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Php%W K4,g'hp%W -7$@D$o|$L$ uMD$@tBL$qPShtP%W@tP%D$K|$tShtP%W! <$tBt88t/St"D$ pHpDShtP%WO|$ tSW5D$ t7t1Phk$W D$ 0uW^b Wǀ|$ WD$(P D$#tp%Ph+p%WH xKHS%t̝$&tRh tr7@MǀD$(hf'P>Tt0ts~ t!V5t&PD$,P9uvhp%Nhp%A1OĨ^_[]D$D$D$hp%W菭 t1PPt$0VZ tc1PPVZ 9thd?%hk$WO oET Phk$W1 QjUt$0VXZ Ņu1UVWU| hY%$Vx h p%Vx hZ%Vx hU<#Vx h&Vx h[S%$x tzh$Z%$rx p%tn|$"D$<u D$xuT|$t Su@|$ "$<u D$ xDu'|$ tjS\up%#(##D$##tp%Uhp%W Vhp%W SKC%tPhp%W[ 3C%t= t1tVC%u vuPhp%W ?D$ thp%W|$"D$<uMD$@tBL$q PSh@%W:@%D$S|$ "$<D$ @LL$ qPPSh@%WfwUSWVl$t2E1Ft/׉˃PWhp%StEu11N^_[]fUSWV\$l$|$ttUPW> 1tk<.tgh@#Wu tUhDp$Wu tCj h3q%We1 t/tj.WU tUW3 1t^_[]D=|Vt$ 'Bءd'3H d'3;t'3h\'3j 蛬 \'3H \'3 Fut$d'3H d'3;t'3h\'3j X \'3H \'3 Fsh>q%? Fshh%) Fsh$ F sh<" FEq%Lq%Rq%Zq%aq% iq%@uwxn{q%rh"r]q%rR$ rGq%r| V 1| "1H|$0t1rЃ^_[]| { 7{ USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy.3DHes.3DH@O\tx.3DH={ \\$ $2f\\ $$\$T$$\$O$sZ/t uPz tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1z T$$t4<$t s%|$$u1Fy 71N^_[]USWV Ί .3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMElx 1 ^_[]ÿx 8D$t)ݿ"USWV$$${ t;$tu:{LtDD$@-KMspQhhP~%W3V3 18Hx 1H(D$ q%tq%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjSSj C@G jPS( fC $4CCD V$4PG UShipU C O*W>RQPG UShipU ym 1N^_[]WVS ut$Ĩ^_[]USWV։ϋ$hjSg jVSu% kS$R Ĝ^_[]USWVHE %@T+02]|$HhjWf G_@t$GE HtΉOG ǃ8D$ PǀGPD$TuUt$ L$ L$ u=M AT@fD$LD$TAXP!L$ u D$T33 ȹu ȉL$PE @| t L$PE @xtD$hD$xD$|1G$|$u ωL$TU rT1ɉL$(L$$L$ L$L$L$NfL$SRPB tKC؍u} |$} t*f D$fC1CCC CCCC jL$ T$,PQR^B L$8 yu(|$4uD$5$PRQ@ ~u~uF $uG*SVP{ tuW 1^_[]fD$fx(t1ËL$ D$fx(uD$V V1ËL$ D$fx(u D$V V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWSfR |$jj!JYƋ$(h@hs%QljFuJ1ۍl$Sht%j Uw h@U"FuCU 8tǍ\$($PhqB@W= f<$f|$ jUS ShlBW= txD$PhpBWp= tZ$$VЃuBD$PhfB@v>= t(D$FP7?F u+ h t%4]Ft PVO1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ - FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP; ^USWV L$@T$R 1H:`q'DŽ$DŽ$@YQhBP<: `^_[fUSWV5x%q't$Ph/@#/u uD$t_L$1۹tU1ɋ|$;t A,9u9u'u uh-t%t PUD$C,9r|$t"w 7h-t%t PW,Nu^_[]USWVL$$wQ 1H^_[]Ël$ |$ $9;l$ tWj . L$tu!s^+9ED$tSUD$ P* ݋D$1PypVPh%m%WIv auRpPh4%W#v $P3Wj臈 1Ƀ HP "USWV$ vS$$AKtGu4|$QPhW1Nt8Whk$St u!"O 1tO 1F^_[]0doPhk$V5u 1Ntҿ9tB$Uj 蒇 t$48oPhk$Ut u$jQ HVPL$ u:t.BSu( PVjpR t<$r f1^USWV(t$@1ۅ@hHL$@D$E_l$u$D$T$Pjyt$  tl1#3EoD$T$Pht$  gx%L$T$ sM 1K41ۉL$$$ s09t$@诨ōGD$ t=VPǍD$Pq' 1HȉD$ 7΋IL$uEtD$D$|$@$D$ PUEL$QP8L$QPUt$@聨t1CL$$9΋l$'1#"t$@1Kt$@l$t>*@h t$ Vhkx%}k|$`$0P6DL$L$QWhPt$$@$@$L0" 1I1AT$|x1|$$8L P€rM$0 $4WPVU t.t$PhSt$$@$@$L0 E,T$;|r1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$Pj9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$}C  pC V1(^_[]ËL$DtD$L$tPVQ- D$ƅu%C SWVD$ L$tT$$wC .11t$|$X+9sB "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p>v\F\^VF`t# Pk>v`LF`^SWVjh0j.L 1NǍ\$PSPhW2trjSjjW2t]jSh@hW2tBD$$1ɉ $L$ L$L$D$fD$DtD$jPW( t W~^_[USWVt$+VjU@Chu,\t#tVh"Pjq?^  r%st%PSht%`PSht%yH 1Bh"^_[]WV΋tF>rD&߈ GTt tB9tt9BTtI䋆tÀ~>r QVhx%RH ^_ËD$\PKL$1Bh"Y SWVt$tgw]Vh"j>^ w$f_PShx%"G GLhQ ^_[USWVhuD$G$D$GH L$t0w9GGGG G _G_1ɉO OuG_T$SPND$@tGHNu%_0MwA SPhqu%F _0G8 9=\$8D$<l$8 X&|$ D$ fD$l$|$Xl$ D$XG8M PQhu%,F w$]w(=PSVt$hu%EG0GH#u%Ep w$]PVt$ h*u%E G0GHGu%z1HG8G4q w$Y]PVt$ hVu%IE K\$0D$4l$0 X&|$D$ fD$l$|$Pl$D$PG8G4tc;G8\$G0D$(D$,l$( X&|$D$ fD$l$|$Hl$D$HG4M PQhu%D CG0D$ D$$l$ X&|$ D$ fD$l$|$@l$ D$@G4\$?u8Odt1D$;Au&Ghu Mq P,\w0PVhv%C Ep w$ \w0PVhv%C6u$HujGtGht:?5v%tPNhFL^_SWV1{\t^_[ÉjhQS C\t4WhG`jp1uh}%hR%>U6 8u"5l3h|%> Wh}%h"b> 1NcD$T$ P2USWVPt$E $u 01E E9t~WSV|5 ur6jSV]5 t jPc= $WEWSV25 u(hSw%hGw%h@ hw%. PPV 5 tSE EdP $PEt]U$uu hq.CF Phv%<6uv%EHPV褤 Vhv%= ^_[]WV։h,j(t/L$ PǀcSc tfǀ 1 ,^_ËL$hq.VD$tF9tAtIdtI;u D$ thZ%P^USWVt$\$#uk  GiP6V9?tAt;<t5n w$FSPUh^w%:; j1VUj2/w -o ow-GOGO oo_Hu1GdGhSV謢#Vjj1^_[]V8=wc-1GG G$^_[]USWVT$ ED$@L$ \$8KL @r@t‰SLih݁ 4\$ S=-C t%uzy%|$ tnq'\$ t]z8ZuSQ_= D$ p t%uly%|$ t`q'D$ tOz8BuE1ɋT$8RTt$PD$Tl$P5X&T$ L$D$\$$qy%81sTQVhTy%81D$ jP1G\$t2=[Lh\t$$G\u1\z% 1Nz%L$ QP8ދ\$|$L$4uAPh,ja$DžT$  D$@dtdрs@G RuMH t$;N(ދ\$u9L$It$cu%uSucu L$AhtL$ A(GA>ɀwȈGGT$ *QRP T$  t$|$t tAtftaލ|$`Wj0D$1SPW, 9s1Ht%t fG f|$fGD$T$ Ɖىt$FTȉGh D$4D$LJcScN$tG~DcScu>|$ u(T$Rdt$Fh;J11ɉދT$)ƒsSz%D$ PR6 f5PT$T$ Pt$~$~DcScuuʉtwL$y<T$ \$tmL$+L$rf@6L$ID$ 6u/Ct)CZu#D$L$)ȃfPL$L$  $ShP ǀ gjW裭Ywb¹ sU@tJL$T$)9?@B+AQWP T$ |$Ã\$\$u9D$,t@D$L$)ȃf2AL$D$,tCt1D$L$)ȃSz%f3ȉAL$Sz%D$L$)ȃif7D$ 1D$$L$(rSX\$0u#1Ct$t>t$<ɋt$<r 1CL$L9Ptt$\$L$(B,;r|$ |$uL$0:u \$t$ʋL$\$$9L$hC\$$\$0L$ t$\$W D$4L$T$)9w; BL$4JQWP D$4ǃZHT$\$)9v |$QC\$ $ AfAAPWǃ|$|$T$ L$|$,t6t-C^u'D$L$)ȃftAL$L$& ȋT$AtBL$)9?ABAQWP |$Ã\$\$Sz%C_D$L$)ȃL$f|ȉAy|1ۉ΋ًL$)9gT$JIO4tQ Sz% Gt$FFCD$;r|$D$$|D$(D$D$t$ :z%t$|$1|$t$USWV$\$@|$wK*PQt$D u)C Pt$h|%,' ىt$ t$ X[u^_[]WVt$ Vt>www  W6ttt9uq@苆t'PdžtPǶdž@1^_UWV}tuPG><r 'u#r G(ftf u  s% u`hYm ƍG 4$D$,$5X&D$\$$w%%WhEVje^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0j& u&h4j@`GHZ%GP_iVjhS聣tSE0賫 LJ  twAQ2 \ BjWh`jPh!}%hR%#sY EX>@P UB( A J*R>RQP  ]rts4 t*Mq @T$hRQP3PV]hX}%2C>t2Mq M*T$hRPQPV]hn}%P" Pj1wLw ?w wL$u]rruG XixiF SPh}%! D$h$PS6UORh!}%+"@u3EpCP  t: @ NH M plYh1}%!u Vh-}%!h}%!'3=u1HL$h$QPC t=w:F h}%Ph}%d! w 1Ƀ8tmF SPh"(!1Ƀ W7@uÍT$D$ Pj5SM؃ PG tL$SQP h}% 1ɉOG @L$jQV.T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSkG@4G cL$Scu%0tGiL$QP6L$ <G cSc{ ni;`CLsu"1C &cMScq s$H6PVh}%< M1CT$ wAOV*PRQ14 t,t$UĤ)Ĝ^_[]~ D$,$\$Lt2P1ۋl!9,tG9r P/PVhz%*DtH1ۋl!9,9rD$Pj5t$h t>|$t7T$ \$uK u)\$@I{%D1ɋ\$T$ t*u4D{% Vhz%T{%L$C$D$CL1CDpـs%USt$T$ t |$}Cu|$B6@t&Uj6t$^ |$}{%t$\$SWVStǍF WPh{% W@|$? 6uhy{%VxGiP6͜Vh~!wPj GPuD$߀ Vj4We t|$t$$}, uZtV,j@Uh@h\$ S襉 t$j%4$teSPh"Vt$Whp|%t$( "ۋD$t$0$ P%4$L$ t/PUVt$Wh`|%QSPh"t$Wh`|%t$$E $PUt$ Wh|%Q.  hW|% V^_[]USWVPPj8t$ 5 1t1,$t*ǀ8t#EPtUWPc +މ^_[]SWV(΋6ulVjjAK AuA jQV t=Ht*ub 4$#PVh|% OVD|$ss OD$L$ q qQPWV  (^_[VD$ Ph|% v 81F FFL^!L$h]_USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh|%h)R% t `jW0Y tD$ WV h|% `(^_[]USWV$$($$$$_\ftPh}%h)R% cl$h$USr t'sPUVdt3_\t,Ct$?tF Ph}%h" V6$^_[]ËL$D$1PlSWV΋1u1PPVI t7O t P SGt-^_[F Phv%% v%GHPV q^_[WVt$ F Ph~%OhGL^_鱿fD$ȅtȰ (1SWV\$C r 1H4t${GPhV ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0hf'D$(PJEdx t]SLXƀH|EdH #HL$|$WVhEd@ D$WPgF9VD$(PyX1VVP VVP ƍF8P+buz3VMhVPr SW>WG| WD$(PWjVPZ ƅuSD$(P萭C$t{tlSWD$|$WPfFWPfF8MdQPfXMdQPfVD$(P/WS訬1PPD$,P toVD$(P~xF| uF|FXMdQP;fVt$|9tVTVS1PPD$,P1 ƅuC$t$xhf'D$P1PPV ƍC D$~dVL`Sn8U8`?1PP$ 9tC9t?UW{c T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} 蠢 PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u& 8 (΋L$T$(t! tE;F unt ;F ʋNHNj4hƉXEFT$(F 1ɉNON1wF ~ u Ʌt ѹ )QPh%m%jW D$0L$,t 1ɉNFfL$OыE@rt$4VQD ƃu V2^_[]h%VD$t:t0t!PtQPV PV^WV|$ 1u7j>t @1H1N^_USWV $ yr t$ $ q>Ypi@D$ \$fl$Ӌl$ hV%WU 1 8th%hl%dt$@s"j@T{Dž@78 D>1ɨ1QSV PQFRC F CFKN\$l$ 4 ! F4 ! F D$(t8tjVW uʋEu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF oUSWVD$1tH8tB\$l$G@tjUP! u8u@$t .o*Shq'Uz Shr'Uc kD$ 1L$A AAPj@QW1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$Xj.PSj= 1T$ JO9zPW.EPt.tRD$@D$,$KU5E XUPh% 4$ f4$ 1SWVt$\$Gt!PtQPW P41PW tt2jPt4%W1VPj^_[Vt$^USWVPD$0D$ h@$6G@jPU= tGT(1D$tJGTt%G OXQt$(Ph8%GTGT@t[Ot@HO?D$ @PGP u ^_USWVl$$tEt^_USWVt$Ft-9t'\$l$9GuGxSVPUT?tF^_[]USWV0t$Dl$ UjF D$D$D$ D$Nj9w!D$Gd@rNGTjPUZ Od)v u"GPt$h% GdD$D$wxF u F4jPUܻ N )v t}NTtYF n%t$NXQRPh% Vjn[u!ɾ 81t迾 8t h%1F$F fTװD$$D$ȋT$ 9rЅtD$L$ 6<$tl?~u $tF$jPU 9Fv $tƋ$C N0QPh %> NtHN됋<$GTjPU衺 OPD$,_LD$s)\$$h$@sl$ D$<$\$wtuۃr֋\${t$l$ D$tT$l$ D$<$뱃t)+|$,vމD$ 9rÅt߰D$|$ xT$ŋD$ <$D$u.ƇD$@D$t$Dr1Bjt$D!ȋT$ 9rЅtD$L$ $L$ tVhQjD$t9t$h5%nj6lhbo%V,0^_[]SWVt$Vjjtj11G9quƁjمuިt?j6  shbo%V\+^_[USWV] D$@Cxt$rj.VL$,Qj! |$,wVh`%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h%e^_[]T$rRQPh%ߋL$@T$ru_L$$9ujIu_yjjPL$$ tjt$(VQm t8D$ L$rQPhb% RQh"%g \RhE%<$EL$t^9HtutL$EۋL$t$$t&9KuC jVP" L$  uhj|ËD$CNC KFCF CCj.L$vQPs Cx1ɉKxC|ƃ9KPƊðD$(D$$D$ OL$4QD$Ph%T$ RGTD$0Pj: $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$( D$@h0u$@ t|$Gl1fLJƇGpht$#GxtHTGxD$`g >@t $L$$yD$<<t:<ut$h%<<tj<uŃt$h%|$$HL$Xpx jP$P蝐 D$<t$hc%|$rst$h,%$p΁Vt$hЅ%t$ 証$x|$D$ƀt$hA%D1ɀ|$t +L$$t$$4XQjP1 Vt$D$`PϏ \$Zt$hJ%t$ $A D$PAD$LIL$HD$D G$?u|$(u&D$xdu|$Ttt$4t$h%t |$u3D$8$u+D$xdt!t$ut$hۆ%:|$(t$L$U@AH|$u D$D$6D$t0t$}t$<t$0Vj6 t$H\$1ɿSQWWV1QWBh p%t$D$u%D$6j蒮D$@`L@O|$ut$h%t$4q t$ ho%jsLߋD$,9CPut$,t$V mVNGPD$(t$,谘GLtbt$,Vt$P9 wPD$$À|$(91D$(h%3|$(>W詨0Mtk,‹t$90t ,IuЅtVt$4p t$ h%U|$u/j |$u$jt$ut$h%詵t$5t$4t$t$ h%f|$(tL$11BL$jsD$$D$(SWV|$G Ph%ujjƉ6菧F_>tC FPj蜠t.t+@JAH *RWPO tF F^_[h%}^_[USWV׉΋A1PUSFVUSt!NtHNVJFxjt$PK t$PtQP PevLXVO^_[]USWV8|$L_OTȃ GTGPtTk GX$PUhZ~%e t#@uUh5%k S0AC $1E9^t 6u(Fxt1ɋPT8t9tʋхut4$h%Uj봋4$VUh%r Wj Gu!g 81t] 8t hc%蕲L$o@G WQSRPUptDD$GTՃGTD$ j.PUj t'OQPh%m%j.V hv%)h  WhCPjm8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW uFTt|$tF$61^_[]USWV΋yx1t>1COTШu* uG@jPw3 OTt OT tY?uŋFuhbo%Phbo%Pt-u~`?w#F0hF Ph%0^_[]jt$_USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ ShG%.L$jQ= u hg%脯$BHJAWhRjj趥G Ph%跮WhRW iShz%Yj-t7Uh9jP@hg%hR%ۮ)hg%ɮd^_[]USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h)R%R jSW< tD$ SVc h%p^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh% PU!D$C,9r|$t"w 7h% PW!,Nu^_[]WVt$ tqwgVhjߣ1GGG G XGgt^_$& Vh%h"Ӭ ^_ËD$@|tHT(tuðUSWVD$1t(x|t!\$l$SUW u?u^_[]USWVD$t81t9\$l$tp|tSUV设 u6u1^_[]1USWV$/GXt$ j.VUje $wVh%$$tXjWV& ÅGD$Pjt$L$QNj ulpt$NjSV藛 tL$9uPVWw t0 D$ PSh%航 ^_[]h҈%jjt$t$VUt+> t$ u2}E$<ߋl$ D$ PSh%늋l$t"UH4:QuU:QuU:Qu$t9t.tI4tU:QuU:QuU:Qtc΅ M $Uu@4xh@L$ QPUWVRt$ShF%d$ VSh % G PSh%6 t){4t#D$} t*tu Wh% Whm%jjt$U\$D$D$D$1L$ ‰1Cl$s6jPt$l$Uh!D$ 1Cl$L$tjPt$U"FL$ ,D$;ZE%fu" PSWhی%艨t VWs't Qf9Au<< <ut$H $r'jD$$Pt$S) )ȃ&D$>l$^* D$ PD$p WhË% D$ PD$p Wh%D$8\$ x@tLD$@<8u@ D$ PWh/%IG L$ QSPh%jD$)t$VjRt$t$f|$ ˉكčG DQSjl$ u(PhT%Q](kl$@D$1D$@jjt$UdtjD$$Pt$' s ?4$j%&G L$ QPh%˥ (SPhn% VjSt$t$atHf|$u@0ΉčG DQwVj\$ s,Ph%-s,VPh% l$jD$$Pt$& \$ iۋT$tj݋B< $9J@s#P4$[L$A<4$V\$ SPv D$p@;u D$8u/D$ P( EPSWh%ؤD$H|t9PTtuȃ XL$ QPWhM%`h#% D$ PWh0%A|D$w; 1L$ T$t$QPR#SWVPjh0j@ 1NtKljjSj hPٌt $jSjj)W轌t W3^_[WV jh0jΥ ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW\D$jPV^ t?jWj$j)Vt"$jWh@hVߋu%h%V3 h%1N ^_SWV\$|$1t=$Dr' r]t1ۋhDj2H(H,|މ0fǀ<fǀ?WjhP!jjW t W G Ph%eWhWa 1^_[Ët#uujWuW 1NUSWVt$1퀻?~ Wh%P~ k1@CCC,C kVUjt(aeVhnj jmWh%h" ^_[]USWV(u48Ѓ% u 58uu@1ɀusA u$s'D7sl7PuJȀ1C u u$u t8u VLD$1OxhD$ 1dt`1$f;t$ЃIu[1PPShjPWh%hR%3y$1M 6<$tu $\$ t=F QPh}%9 D$$hPS6%Ch%衞Qh}%'3=u1HL$$hQPD- 'D$7@\$  $9|$L$Qt$P\% sTVjTj< D$!ЃD$L$+D$NT$T$$MVjt$  L$ChUt:+|$t$t$19}$uB Ph;}%1FsD|$W]CDtL$$WQPn {H[\$ h%(ut|1QQPO 4$6I$sD}1CDCH6.u2脔 8tvz 8tlD$ Ph%h"補 NE uf։T$,|$t 9t,Nu:t^_[]USWVʋE4L$tPT$E4] w$dr' 9 ȉt$,u9  D$,1uD$ D$,L$(D$$-D$ $WhPZT$ D$$]D$( |$ l$D$  $D$D$D$1t ߋt$;tS,OuBrD 1FuD$ 8rD$ 8u D$D$E,;,$ut$t)|$ l$T$&1D$1QD$ |$ l$T$11|$(ujt$( T$ ƃuAt΃ D$4upD$D$WjRP葀T$ D$x7?t@11A9r1ËT$u 1Ë}1$1 $r'D$HDH8D$PjWQ$D$Ãu D$hDxHT$B|tIHTu= r x t1:t,@Ptftft x t: u ft볉։D$ dt`1f:ÃIuD$81ɉu(D$6uD$ @t @u$$u D$PDhH1 L$wZ sPD$ uCD$2Pj URt.L$ 6Ƌl$ uD$ Ph%辍1l$ S@pNjD$x4t.X8L$ lt&f|$2uN H NHVP)1N K(H K(H K(H K(T$t,B>r#D&"D$H<D$@ WgGt tY;L$t tv4t8Vu 8fu8FtIыT$tz>rB QPhx%4 D$P4 uPL$pffBfBptYQlRt^ D$p4t$ffBfBtD$WVPR1^ $L$t6D$fffBt$tVt$Rω] ډ dr1ɋ`ɍ<@L$D=1fÍ4L=L$H1ɉL$LL$PffffJBt$VL$LQPs] t$ ރL$I|/,$YT ry |$?APtftfty t \$; ugf;:ub,$;]uTftNyL|$DyH|$@y@YD\$<|$8|$8\$S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWPZ uƃ Vh9%&V΋QhBjht1ɉHH@@ @ @$t ^ Vh%h"L} ^WV΋Ƈ?DtuU1B:wLoGDOHGLOP1ɉODOHthZ%VP6##9F Ph%|G|t1IHU H$H u1j:u)F Ph%^|1VPjs^_USWVX։ϋtu'C|t@Tu1ɀ@ƃ@L$ tG uVPh9%Qy1Q%8WjjrD$$Pju|$w$r'8uJZ%=ǃ8%8u+7%8u>%8u a%8{`G D${|tat$ްGTu3N`W u u1!1t9wGXPt$hi%z ؋?ut$u {`|$ui s`t$h%z 1CdC`|$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pet$|t$,t$,Pt$h%s:fD$D$D$PjUVJD$0T$4)̓w!j t$h%rfjPD$DP[D D$LȉD$LD$PȋL$LD$P9v)Gj t$Pt$Pt$h%rrl$4D$h|tjD$@PUՄ upmjhD$DPt$ъǀifD$ $BE0JM,E(EL$E(ETuET$%ETBE<JM8E4L$LM$E T$P9t MTU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ hˎ%p~h t$hZ%p|$ɋD$,u ȃd^_[]USWV|$_T؃ GTGPtG OXQPhZ~%Dp wE tu{E|1ۅt5HT(tgGPt ftftGTu tǍF Ph8%fot}u^_[]8Vs6&^_[]SWV΋y WhQ%Qo 1CCCC CC$t^_[Whw%h"Qo ^_[Vt$F Ph%So^L$\Vt$?N QhϏ%Pm ^L$ WVt#׉΃|jRP t j6^_USWVPd΋ $1۽`D/fu /u'|/u|/u|/u|/tbfu //hQPVІt:ǀiL/艈L/f$HC;dT^_[]Vt$Vh`jpdF Ph3%m^PL$`Vt$?N Qh%Pnk ^L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%h)R%l tjS0 tD$ WSV} h%ul`^_[]ËL$Vt$?N Qh%P>j ^L$VL$@ht%P1|$L$8jQj*j)5p<Gu hW%<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5p<Fy h%Q<t+DŽ$j$Pj&j)5p<FuK1ۃ|$$p3D$,tD$t3S?<uhŖ%h%ƣ::|$$tF1FFFFF  F)F.N,::9rF t$ƃ|$t.t$詯L$Aut$h%+p3D$,|$,tF)F/p3F <@;DŽ$jjj y h%!<\<(<`<,<d<0<h<4<f"<'ul<8<|$tjt$ j.j)VD=p3ujh <V yPhk%UPhp3Pj)VDuY=p3tjhp3j j)V{DthG%$Ph <Vש yhw%h%h%%VlD$ t3 | h%%$jPhh5p<Ct$8jVj$j)5p<Cy hڗ%jVj%j)5p<Cy h%<H H r8r t30 s~|9~ h%<t$jVhh5p<By h%jVhh5p<Bhė%d8t3PQh%u <Ѓ1۹3<PSSQVRh <!D3<t"Qh0%t <ЃPSSPVPhT<Ct"Vit$0tWNuVj)N VjN 1<<L$?V1Fh'3Vhh%# Vk USWVX <<t91ɉ : :1GH < <<f < r+rm ]1sq::Y::\< :`<$:d<(:h<,: :: t1: <<: :f:t3Uf: x<ff :f:=t<u"t$@jV: ȣ:Fȣ:t3:T<:1L$@A A:Y ::Ph:5p<a ƅx9t&y hي%VS5P<hA%r <uWh3Wu <<<<<<<< u2ء<<<<<< P؉+<5<D$8t$ J$$D$TD$X1$$$$$L$\D$`$DL$dD$hPD$XP5p<E 1D$ PD$LPQ T$T|$Xz<nЃ3<P1PPhVjR:t"VWh*% ~ t$&G 8,hE"G 8h؈%j<h%D$h t$dt9t1~)u~,u ,< 19wΉօuɋt$|$D$h r[L$dL$tOL$L$ L$ȋ9t9y)uy/u 9 19wΉ\$,t$uhN%|ء< <t 9 ؅< Fjh\<Pj u!F$ l<9< Ѓ3<P1PPhWjV8t"Wh%Wi I L$L$ t;|$)u .u tj 19wωt$t$\$,uhp%F(=ME<t$Ph8%h <Ff9x<Ff<<=t<'fD$FȉD$(F ȋ|$P)lj|$PD$HL$Ly@B|$P+D$(D$HL$L$$߬$X&$ڼ$@<H7ء<H<8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"57<t$PV;hD$$HL$L$ 1x1PPPW jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$? ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$;_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$7<D$PVP,C L$@D$D$ 1 G|$<$D$=3$TD$j=h &|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h &S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPU SVUJ |$|$t$ "+Hj=h &P Ņt$,]' 04$Q"x' 0D$$|u'߈FHGNm&Þw$u':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4*! "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H E dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=8<u t11jNt 8<1 8<8<t P X1@h{"h#%wE 8<1USWV1= 8<MT$ l$(L$DžD$58<hh!8</U  |$t$8"j h!8< D$!8<h8"VM 8<tUPx uTWVM8<WVMt7j L$QPGN x#L$9u8<;D$ D$uL$us 8<8 8<APQ~ PQ@  8< tuQhh!8<-T  |$u 8<1^_[]8<$<<$<<1Ҋ+~,u"1t$L$t' t" t΅tAL$=@?<u@?< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=8<u# 8<8<tP 8<t 8<1^ 8<8<tPw 8<VtJT$1Aj<ƃ=8<u# 8<8<tP- 8<t 8<1^t 8<t D$8<1@1USWV D$,L$(l$$~ )$1H$`t 8<1A\$9|ωL$ tgp9tX tt$ Pl t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$ 8<8<tP  8<D$,L$$ ^_[]f11f11Ã=D?<u /t(H?<11hhx?<PjNtH?<1|C<D?<t PUS1@h{"h.%@ D?<1USWVT$1=|C<+\$0L$ D$D$|$(D$5D?<t$8SuP l$,D$ D$D$t$j S \$1 h8"V)IE|$tt$(P u~8"WVHEWVHt^j L$QP~I xJL$9uAE;D$ D$<u/h8"VHtj L$QP=I x L$9t[ D?<8 D?<APQ~ PQP  D?< tuQt$8SBO E hձ#V$HEthձ#VHwhձ#VGah8"VGEHh8"VGE /h8"VGE$j:t$ X 1@|$ u|C<1^_[]WV=D?<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhx?<hH?<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=xC<u+|C<D?<tPL$A L$D?<D$$tˉ01C؃^_[|C<D?<tP D?<PPhhx?<hH?<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=xC<u+|C<D?<tPL$m L$D?<D$$tˉ01C؃^_[t xC<t D$xC<1@1fUSWV\$l$t$VJ PVWګ U1 PUWƫ S PSW貫 t$ V PVW蚫 ^_[]WV t$uRt>DžtA=C<t ^_Épxj Ph E"# ؀=C<u1F1=C<t@ 1맋53 l1#QQhA%Pփ USWV1ۀ=C<t ؁^_[] D$ |$GSSPhC<jWn u C<׳ C< C<r1HC<l1#1ۃt2u3hWh7%_ D5C<~ȍQ2w$u'C<PAu C<?$D$-3} h"L$QhW%PՃC<3@C<3 C<I9@3 C<I9@C<C<C<C<C<yC<pC<g3 C<A9~WH3OC<F3|t%ƍC!t2)É$)t* D<L$ D<$)PD$p xPhC<=C<=C<WjD$hpj Ph E"- 53 l1#QQhn%53 l1#QQh%Pփ 111{PZDWhV= ESWV 1L$ |$ ru\95C<s(>tGǀ=C<u.;=C<rN;=C<rDC< DžtVjW =C<t^M 1ހ=C<t& ^_[À=C<u1Ffu]pxj Ph E"蹣 뺋53y l1#QQhܡ%Pփb NUSWV|$4t$0Ë C<9s&C<9 8Ս1ʅ/C<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95C<95C<H_ŋ C<!9r؅ C<9s9s_C< 8!9t.M9wI9rEC<8! 3!9u!=C<=C<C<Rf ʼn9rPVU  8!!ōD$p C<PVL$D$PVt$8C<Pt$jUVthŋ$L$Ai QhC<=C<=C<u=C<9 1=C<tM^_[]t$hC<O=C<1GDu3t몍D$0xhj Ph E"肠 536 l1#QQh %Pփ 9U7)SjZP)MPjS :9/ $)QjZP)PjSt tƉ111USWVˡC<!9ta)‹ C<h t u9=,$)<l u=C<OE$)ÍFu\wlw'xD$X C<PWPW=C<N V D<5 D<w(v' ww'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=C<tGV^_[]ÃWU VjZS vjZv  VjZSt V t$=C<tt ^É01ɉHHj Ph E"赝 ҋL$SWVȋC<!9t+)֋ C<| u 9t%)D @A QhC<@D^_[USWV=C<t^_[]þl1#VVVh%3Vh?"h k"h%3@#=C<u6#%=C<u&\"=C<uJ&RQPh%3%=C<uӢ%d"=C<u"%=C<uA $֢%=C<u$VRQP33$ C<|$gfff̉ҍ4މ劄14#GO wһl1#?"SUWh٢%T$t$|$f4SUWh%33$ C<Ggfff̉ҍ<߉劄94#FN whl1#h?"Vh%T$3$ C<|$gfff̉ҍ4މ劄14#GO whl1#h?"Wh%T$3$ C<|$gfff̉ҍ4މ劄14#GO wҸl1#PPWh%T$3$ 3|$gfff̉ҍ4މ劄14#GO wҾl1#Vh#Wh%T$VVVh!%3USWV΃=C<tPt C<3!1P8AǡC< C<!)ȉ9r1UAC<9tEuótP-C<!1PPjhjUP} t(D<tD<=D<=D<-D<1ۉ^_[]V΃?D< ; D<v$1uD<Ɖ D<^USWVPC<C<C< 0trƃhv'P4F,=C<=C<4$t|n011FEEhv'PـEECC<(9r:53g l1#QQh_%Pփ=C<C<11C<9s[ $,0EEhv'Pms+C<CC<]ǡC<C<(9rC<9$sj,Ѓ0EEhv'PC< C<s C<)ÉE;ǡC<C<C<(9r$^_[]M L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡC<D$C<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9C<s$5C<!։Ņ9C<v6J Љ  ȉ  F1r{@p9C<sBJ Љ  ȉ  FC<C< 3u%1I#5C<!֡C< 3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU: tPUJ$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=C<t=C<uVj1^_[]VhU USWV5C<1!- D<t E D<1-D<E@;D<v@uW-D<E@D<tE3t,ÉE uUhC<_=C<t"=C<t! D<E- D<^_[]VhVjS USWVΊ C<T$ T$FD$t$V$D$9Btr$u$…C<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VSESD$x,t @,KZ C<tjNjD$G GC< C<)ʉWOT1Nt TtWt$-C<T$ C<^_[]1USWVȋ5C<!) C<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡC<94$1PPhC< Åk jSC<W SW D< D<;-C<r ;-C<1WWjhj\$SUw t\tV9tRSP?w uE" j@\$S0t -3 h?"Sh@%PՃ=C<1lj1C<4$9v(C< 1QQjPjVQ8w @wg1=C<ju6ŋ5C<!Ɖ)tPT6C<9tut݉<$/C<u1]4$D$x PhC<tA<$C<C 9r09$v+jSV  SV D< D<uɉD^_[]Z VC< C<r!1F<u. C<C<F9r^USWVP $1N=C<1!׉) C<D$)ot +t=C<;C<v|u+HL)͉ll+;C<s| ullD +lD;G,$vuWVDGWVM;_s_u.G WP=C<u.M,t C<-},^_[]jPR] 5C<^_[]USWV@׉9 C<95C<j:4;C<u >9uP4;C<FjWV *1ۡ D<t  D<8D<H@; D<v@jD<H@ D< 3H C<HPhC<C<9rWVs u=~ j@S0ү -3 h?"Sh@%PՃ=C<9=C<u] D<t  D<6D<H@; D<v@u,D<H@ D<t=C<p xPhC<T@^_[]9C<u)C<C<N f3ø3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á,,3/D$t$Pp)WVL$T$ ‹q~y ;q~ t 1~9 QP6 ^_D$ .3DAD$ .3DAD$ .3DA%D$ .3DAD$ .3DAD$ .3DAD$ .3DAD$ .3DA%D$ .3DA D$ .3DA@D$ .3DA%D$ .3DA%D$ .3DA@WV1F|$ 4w'W tF u1^_ËD$t w$Řw'1ËL$1t9t1ҍB|uËL$1t# t|$t.3LH1H rËD$t .3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ |.3DAD$ x.3DAWVD$ l1#l1#tƀ>t.4% 0PWVh@&h'3G ^_Ð1|$w L$t9tø3f|$3-#tl1#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$%9 (vt.3fL$Σ%9 X(v!3føÃD$L$L$ L$D$Vt$ t$Vh'3 h/R"Vzt"^ 0kPh$R$h'3 '3Vj %V ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP% t 0 1$^ÐWV|$ W4Ԇ'T tFu1 ^_D$ftL$Qp'1USWV$п$$ u V4  X)jL) ŁTUUrP$@@D$0jPD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#N4$(~111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$D<L$L$ tU'|$$1Ĥ^_[]USWVt$~X>3܃ V$ ' j F H @(N]_?[\;^r~uFFD<D<C><% ^q{t|~F~F ;^r~uFD<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFD<F^9րրw t$rI{i9s <$=.3]D_\,<$t~uF FD<D<Au~uF D<F>:* +F)@HWPF)P)?#{Ë;NsD9,u=A.3IDJt"9~~uF D<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPF)PPp^XWSF)`P}F)@xWPcF)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF D<F"{u@9s .3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup .3DAu f'tf`uW~F=@9t8}@u~uF ~uF D<FЉGL<$USWV t$ ^h.\u/;nr~uFFD<D<EMŁ'$~]$L'|tfύ]Љ8S dBtr@SB*@.[Oω\σ~uFD<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFD<FωωD$$xt~uF D<.n~EFx .3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS F)`P9\9{ ËV9sE9,u>A9s2.3 DJt" 9~~uF D<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF AM ^D$D$ F@^ ]$.^t~uF D<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFD<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP] D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj~F jpf]@T$P F$\$T$  D$^90NL$]H9s-u9]-t{[9 =:uv9r$8uD<^D<]t -$8uD<FD<$8u D<F ËN98-P9:]:-f-9؋$r;uD<F<]t<-u;uD<F= T$P V9H98=9] f9u$ÉT$P^99]=,,30f9Ë $~9u D<Nff9ۉT$SRC1=,,39f9~w;d;TH9s.3DJ)Ãr~$u[FPSPD$$Pb DD$P4Ԇ'D Cu$:uD<D$D<:\$1ɈL$D$L$D$PD$ Pk$~8u D<F1ۉD$1D$\$D$D$PD$ Pj<\$1D$L$D$D$PD$ PjÉT$PC=u,؆'11GPՃtGT$P1Ƀ=,,3G9ɋ|$G@jP7 t@OQW fHV9sjH9ы$8:9]9~$F Hl$ 9=.3ADWuI$:Hf9݋\$C@jPs" tCKf,f|AK$8 T$j-K^9H8] $8L$T$ D8$tF @tL1=,,3耉11G1ۉD$L$119 $tOL$G9fl$|$L$=щF X@ $D$ t(|$w71$؃9u F H$8uD<F,^_[]ËD$ |,uD$xuD$xu D$ |<tF +h 0Ur0붋D$ D(D$SWV$΋A @u1 .3LAtx x.3u|.3f9DAuP(^_[Ë>^D$f@]D$F~>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQt F^_[USWV1y19sC11-.3D]t#=k)CB9u1Bt=|yuA D<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)PA~uFN)! ʉj~uFNT!ڃTjGEUS1CU?Kl$E1=‰$|у $~)ExWUWt$jpF)PR~uFN)# ʉj&~uFN#TTj)~ )EHWUF)PP FD<FUSWV\$1=,,39~1@(ϋF,@jPv(I t|F(N,QV,fH~<t}|.3Dh ,,31҃9~1B ,,3x.3Dh1҃9~)1BuG D<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFD<D<D<^_Ã~uFD<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFD<F1^_[]É؉D$%܆'t$t$Ucw u U t/uՃt~uFG롋$USWVl$q)t3ӉϋQ,t!GO RPQ8 o^_[]SWV1G9Qs7ӉjRq tF^~uF D<F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]ÐUSWVt$8e x ?E G  $$$T$$ƃt$l=,,3|$ r3GtD$WT$ou]t$S܀ |$Qo ]GtD$wt$wt$wS虀 |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ - ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$pt OuË|$$ωL$ =~uf~|$\$\tf .3>|$u l$`\$\z .3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" .3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVUo Ɓ|$tK|$tA .3D$¿!DQf_֋D$ !DAf|$$_8tV|$u.3L$ DHuf|$$_u3|$u.3T$DHf_u =wu$t$D$PhwPU D$<(D$@t|$0 L$4$hUt$HD$DHW_N$;GOXL$LY;GU_$_ŋt$DF81ۋ$;D$09$;Gu G1;G ;G~x t,sO$9u G19U8 LD$@un=$;D$0.@$V1ۋ$;D$0L$I L$|$D$<1ϋ|$L$9D18$ED$89t$DN_u_uuP uC͉$t$ t$ D$@PVt$@L%;D$8Z,m%)$'T$L$GL$Tt !1ۃ)uL$ dAL$ L$0)ы4$9G T$RPV t$T$\$@E9uo$L$8uG $T$LBT$AG$l$;t-)ȉt$ Ut$@Pt$@9Ml$D$89I $L$8u9uD$$9'$;\$0t1ۉ؃^_[]ÁGT$$ˉ+O l Lt$ t$ t$@Vt$@كÅuGlT$떁GTT$$ˉ+O l LL t$ t$ t$@Vt$@CكÅDGl T$T.M$t$ t$ UVt$@ÅH!=ET!4*F !فu։$t$ t$ VPt$@É뚉USWV0Չ\$LT$Tـ1@D$\$؃=|D$\$D9t$t$|$ |$‡T$,L$ɉL$(t$ɉL$$D$ F $'L$P)D)~T$P*D* cL$P )TL$Tс1Ct!1CӍ ;сuD$PL$LT$P*D*V9!ځXT$P JD$=zD$=y|$(~D$Tw|$gqf|$,V`D$=wK;D$ /9|$$~&|$ | f|$f|$F D$1=,,3耋T$ 9~OD$1T$T$3D 8\$P+D+)ʊ$u tω\$DzD$Dt$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4l L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ 誶 ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf .3>|$u l$`\$\z .3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" .3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA .3D$¿!DQf_֋D$ !DAf|$$_8tV|$u.3L$ DHuf|$$_u3|$u.3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V=9 @wj/VQ 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhy%jPh(E<P(E<ø%Vt$1Ʌ1t э^fUSWV$[XD$1dD$V׃1diՉƃut" $4,rƃu$UVjj |$09NjL$4sD$D$8T$<UVt$Dt$DK L$D|$ t$ 1Ҹ$|$(RPQt$ |$@tjjdUVD$ ƉRPUt$  D$ T$_D$L$ |$֋$)&URt$T$2WQPt$HD$HP՜$RPQt$8W轜^_[]SWV[$$u^Jw $PhPV5 u=uk+ W&hPV05 PhPQ5 t&hPQ4 OhPQ4 e&hPQ4 hPQ4 5&hPQ4 /PhPQr4 &hPQN4 ,hPQ74 &hPQ4 (PhPQ3 t.&hPQ3 &hPQ3 P:' Ą^_[USWV[xD$$L$ ttD$D$&D$UPFlǾUD$P%DžID$8t۱|$;D$ T$$75/PPW~h E&PWfh (PPWNh &PW6h t&PW"h |$D$ tHPPWg &PWg PPWg i&PWg t&PWg |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [å$ @$ $ ,1$9r 胼$ t+$ $$ FhPW- $D$ D$jD$$ xfD$4D$dzr /$$ AfAfI?QPRhWJzt$ VPj $D$ $P!1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VhPWj, j:WC D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPct Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃKD$ $t1L$ L9s ዄ$ @<CL$|I't$tjhQPR*D$4 zqPh$PV$$9s|$$$9s$$[1 $L9s D$HL$H P &RQt$ Ph$PW$$9sD$4zqPh$P${$_9sD$hI$/9s狄$ @zPQh$Pb$$9s獃4t$Ph$P $$ o9sD$ tWzQPh$P袎$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ u^$$$9sD$dL$HL$P'L$pRt$t$t$$h$PDD$L$HL$HL$HL$,HL$(HL$$H @ &T$0PQt$,t$4t$ - 9u8jj$[ t PA 1 4b 0ǃ $ǃ$ƃ tZb 01^_[ÐUSWV[u$01 uut!j/V4 uS tƅuz` ƍ|$ )VPQhWʃ=ra ?h@VǍD$ jPW ya D$$WtLD, L$Pjhjjj QD$(P^D Ƌ<$t'Vu D$8 ta 8 a L$^_[]ÐSWV[&~ u|P66ƃ $tj/V2 uA"_ Ɖ獃 )VPQhWt=rc` ?$t" VP2R tEF$u7hh%@V} $ hVP Q jj$X t=jjj$#H !ƒt"= P$!7 1u_ 0_ 0^_[n_ 8#uVt׉O_ ƐS[~|>[ÐS[^|t$[ÐUSWV[0|u }^ D$<$^ t$u$$D$Put=k<T$JL$|D$x$L$x$PQ?$$$Pt$>lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$`1DPu@4 $((9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$8\ D$@j PW \ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $#T \$ 8u$$>$0։S D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ<4|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR^{ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6kW8G4jjdv6M3 jjdRPjWPGLjh'v6%3 W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJ2D$D$4\$Pt$,2L$ )ȋt$ T$4TT$t9u1^_[ÐUSWV[ûOL$$tEׁ u$C t+t9u11ՉL$!։1^_[]ÐUSWV[;O|$GtB#l$%t$PCt!G t7t9uӾ^_[]ÐUSWV[N<tC#l$8 t$PCt!G t7t9uӾ^_[]ÐUSWV[[N̘tC#l$Ș t$PBt!G t7t9uӾ^_[]ÐUSWV[Mt$0t$,Ǎ&VPV‰t$D$(%D$1퍃 D$ <$l$$tg|$ !RPAtG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tR PUW/ >&t1<$WQ*^_[]fUSWV[ëLt$D$hEt'1PV@t%D=u1 u<"VPjD$@ 8^_[]ÐUSWV[(L|$ D$hEt$1PW}@t%D5u ^_[]ËD$@ 40tMw. D$jPt$VP ŋD$18tE. r"u## u4B"tt$ a44$WPjуH<"WPj^SV[Jt$ vw(v l(Vc(^[ÐUSWV[øJD$,8tD$,1퐐8@ujHƋ|$(WF$"jU!F D$ D$,F>&D$Pt$1}nu1ɀ}ouL$D$j=U tǃ|$D$,t1PU=>tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8 t 4$&V&1^_[]Í<"UPj`USWV[I$4$,+ 04jPU uj:U 4jPU tKt$}/3t$UhV( jVPcUR PTt$UD$P|:|$ X"jjWjjV mt$ jjWPjVP t$/pD$PV_ǍJD$t$j5Džjt$W uj$4$4jWtƍD$Phzd@VC V1D$(Pt$ u4P$0>$0VPWm FD$ GL$ `"jjQPjR8 tqVUW Rh) 0Q$0XR) 04kC) 8uj/UvŃt$ $0UW ) 04QPW 111( 0Q$0P$4 11,$j$4V$4WjU0P!PWJt$t8HPQ&B&\( 04$0P$4 1,$D$P"U"( 0^_[]Í4,$UPVWI1' (xWP$8$8IVfffffffS[DD$D$ $L$T$jjPQjR! yD$[fffffS[ËDD$D$ >$L$T$jjPQjR yD$[ÐS[+DD$D$ ?$L$T$jjPQjRa yD$[ÐS[C$L$ 5jjPQRAyD$[fffffYCT$uÐS[NCt$@SWV[,C|$Wt$t$ 9r% ?5WVPj^_[ÐSWV[B|$Wt$t$ 9rq% ?Q5WVPj^_[ÐSV[ÍBt$ )ƅu5Pj^[ÐSV[MBt$t$Uƅu5Pj^[ÐSWV[ B|$Wƅtu5WPj ^_[ÐUSWV[Al$|$UW|ƅttu5UWPj^_[]ÐSWV[|A|$Wt$]ƅtu5WPj ^_[ÐUSWV[+Al$|$UWt$ʹ t# 05UWPj^_[]ÐSWV[@|$t$WIƅu6WPj ^_[ÐSVP[Ü@D$L$T$$RQP| ƃu-6Pj^[ÐSV[M@t$t$t$| ƃu-6Pj^[USWVP[ @Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1" (B6t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[Ê?Pt$0t$0t$0t$0t$0jt$4= Ɖ׋,$t1 " (6t$,t$,t$,t$,t$,t$,Pj ^_[]fX?L$"wÍxffffffUSWVDX>D$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjjB~D$$<$|$ D$81$|$ <,PL$4h"GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$$~D$$L$1ɉt!D$,tt$$T$()9sF$$$L$l$$)\$@L$<`L$ڋ\$4Rt$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjj: $~D$$|$ $1\$4WRD$$Pjj: $ˋ\$4VRD$$Pjjt:1Ʌl$<릋\$4WRD$$PjjO:~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$Pjj8D$$u|$0L$$tB;L$s5T$ >#\$4 L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[1jt$t$t$t$t$[fS[î1L$T$ Pt$t$t$[ÐUSWV[h1|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuU 8uFQt$ t$Pt$t$@t$ jt$ 0 [ÐS[ jt$t$t [ÐSV[0t$t$Vl( tD$~ L$u  PQV ^[ÐSV[}t$ t$t$V( tD$~ L$u  PQV ^[ÐSV[0t$t$V' tjt$Vh ^[ÐSV[t$ t$t$V`' tjt$V ^[ÐUSWV [xt$<|$8l$4g$gMVT$$T$D$1D$؉D$<$L$ϐUE   $MQjuUv;t$tMtEt=;L$=?j WuUUWuU3& k$;T$8tT;D$u:j WuUU;|$~Gj PuUUG9}$ǁE|$9~j PuUaUW $E;L$8Mj QPU5U|$<D$ $|$`DHtj WuUT$D$PuU% $tuCj uuUTEj PuUT9}~WuU$ $$D$D$D$j t$ VPUNTj WuU:TD$=D$ $ȉD$ t$8)ΐEj PuUSEPuU;$ FuՋD$ D$Ej PuUSEPuU$ t$VuU# D$8$(14$ ^_[]ffffS[0[ÐUSWV[L$(9tL$(#AHD$D$D$(p@, u L$(I1ɋT$(;rRT$(zD|$ D$T$(R94$@T$ 4L$D$ 9u(Gt"G͹!ȉ;D$u  tsuD$(@, $+Hi̋D$ fgG! D$GWD$,p|fG;|$cfy눐L$t'T$(B,4$+HiPUVRr4$D$(;p}D$(@,1t$(m1^_[]ffffSV[p VuN8@1^[ÐSV[t$ VuN8@1^[ÐS[îD$ L$jjjjQQPPt$(v$[ÐS[~D$ L$jjjjQQPPt$($[ÐS[Nt$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[$\$Xt$QP踂%$ % $$`t$PRs&$  $t$PR4&$  $$dt$PR&$  $$l$htD$xPR訁 |$x  T$xtD$PPRr |$P  T$P$t$ptD$(PR0 |$(  T$(tPR  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[å$$tvu $ $tvu $X 󥋴$t!ut$ $ Ƌ$tvHu $0 󥋴$t!ut$ $ Ƌ$tvu $ 󥋴$t!ut$ $ Ƌ$tvPu |$h 󥋔$E@mHt ։t |$$$$Xt t |$,$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XjD$D$8$$$\$`l$($D$@D$ D$ D$HT$LBD$0$L$Q$x},1T$L$'؋ $ IfDL$9$@,dL$$LD tu@D ^_ÐS[t$0[ÐUSWV0[øD$Hx'pL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|Hw|ut EGDuQDP@I|t+1zxtItPv1^_WV^-D$L$ QHׁ8P?tׁ;>uQDP@I|t/1zxtItPv1^_Xƀ ÐSWV[||$0 2@ 2 2| 2 N d N$ NTh NX N\ N`h Nl8 Nm Nn822@22|G G$dGTGXhG\G`GlhGm8GnWG1Ƀ2QPG GlWW ^_[ÐUSWV[ûl$uP輡Ņh4jN1ƋD$L$dž3Ndž2dž2 3ƃ fFddž2dž3 h3,V 5VU2@xpu xhdž2jjjjjjV膠FjjjjjjVfFVZV谏jjjjjjV"F tdjP0VWVNV% VlGHt 3t VdV@Z2t Pd2tuc29ʼnu3V1^_[]ÐSWV[lt$2t P}d2t7uc29lju2VbZ3390uVn^_[fffUSWV[ t$@+@+@+@+@+@+@++ uǃD >ǃH <ǃL ^ǃP vǃX #ǃ :ǃ0 'ǃ4 #ǃ8 #ǃ< #ǃ\ -ǃT -ǃd _ǃx |ǃ oǃX -ǃ` -ǃ| <ǃ >ǃ *ǃ !ǃ f2Ot^t8tjtfx ؋tvQjPW 1 QTpQTtQTxT|=u^_[]ÐVY1 T$tpqttqtxqt|1=u^ÐUSWVP[Ú l$j+GG(ujjQP uxPjj3QPej>|X j9L$u+0D$PH8@<utCu-/u5tMt$ul1‰jiP0t$UMƉ$L$PIE/t$1jƋL$P1‰PL$Tƃt|y<x -tl|.D$8T$PAB $tJt PrR U}" E @t9 8u/3t$d10{ǀ3e -D$T$D$ D$D$ L$jjr@PQUD$PU%|$u@*2$t u $ L$TATJSV[0t$t$V tt$VZ^[ÐSV[ít$ t$t$V@ tt$V^[ÐUSWVL$[d|$0D$(T$ 2D$ED$4D$D$ f#tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4 ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ D$4Pjjj 4449)4L$ 4QWPt$a4;4}2Dž4t(D$4PVt$ t$ 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)Q)R;* t$VUF @f|$t7&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f17Pjj!Q jS[.t$j[ffS[0t$ [ÐUSWV$[|$uz2t PO2GHtȍL$ QPVU>|$<2ȉL$uCT$ GHtȍȬRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(:7P耉tjjPl ,GTC7PVtjjPl GX!2@@xGX GXO <W$d OT h2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V| PέD$$<$$u$PC HuǐuUS| PUD$$鐐<$$u$}PӔ Huǐul$Ut$VV`UW$|$D$H$d H HT HXh Hlh 2| p2 t2 x2 |2 2F[ÐX tT$QXh1øSWV[l1t$t&D~fx닎f8upσ>~"14蓸;>|~Vu^_[ÐUSWV[fǃ h赧u$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$4#j T<TV$2@0#4tVu =wlj<$hVt$ Vw Vu 1rNj2Z1퐐T,jj L,LNp9u^_[]Í7P#jS[0[ÐUSWV [|$ EG8$u%O9OuO9Ou9$uxW/t Wr`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PGGMIAG GAE3t4d10wEǀ3 ^_[]Ë3t*Q33t8tVW^‹D$89L$uG8W<ut#u%'t^1Ƀuk1g RG4$֐=u8 $A @11 $<x D$8 $tQWTL$|$u $E t΃2t2u΅rhƋ $a aU 8uE3 $tԋd10uL$Eǀ3뤐SV[0t$t$V\ t V^[ÐSV[Ít$ t$t$V t Vr^[ÐSWVP[K$t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[+T$9D$Po 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[E1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[øD$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RW輋ŃuRG @tG袴 8u=D$3t.d10qD$ǀ3G @|$tmG  f Hȃ  fftVW豊=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB2 8u8t$3t)d10oǀ3g 룸7Pjj Q jSWV[|$W览ƃuOG @tD荱 8u:3t)d10rnǀ3^_[ÐUSWV[{tt$339}3AP3%t' 333343;33PQRP!W 33t331^_[]ÐUSWV[ëtt$339}3AP3Ut' 333343;33PQRPQV 33t331^_[]ÐSP[$tT$ 2Pjj $[ÐX tT$QT1øUSWV[VTAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh`to DHDHDHDH uǀD$ FF^_[]øs7Pjj7,S7PjjQ舀 j>7P誾j(ffffS[Î0[ÐUSWV[ht$$F,NVxF ,|$ |x<$ |<$l uLJPj  ƃ [ÐS[ u j͐ ƃ [ÐSV[ʰ@HtȉQhht@P{ t!$tL$td Hwtǀ3^[t$ЃS[+ uO,O$D$D$D$ D$D$ PQj蕑 ǃ [ÐS[û ~:Pjj[ $; u jPj8 1 [ÐS[^3t[ËPtЁ3QPt [S[Qt3PjQ踆 [ÐS[þQt43PQt [ÐS[~^[ffffffSV[]@|$t|u7x1t+DQjPT 3p+i 1^[ÐSWV[3@t8|t%DQjP 3ph ^_[Ëx1ufffffffUSWV[kT$2tt6usRRt1u8]RuARt'2DPjR pg ^_[]ÐSV[ý2tt6uq IIt1҅u8[ Iu? It%2DPjQu pXg ^[fUSWVP[t$F8 t V]F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$ @tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$L$9A}1ËI,$ÐUSWVL$xaT$r)~VT$xN9|1~B΋D$x, 9})D$Xh( B9(~(B 9}ԉ1^_[]ÐUSWVL$ $T$r)D$$9|ƅ$Ήt$#;L$}z|$(u-zZ(B,,ME9~u 9}ʉƐj(B,{79|B9}j({ 9|r9}/$$$^_[]ÐUSWVL$xaT$r)~VT$xN9|1~B΋D$x, 9})D$Xh( B9(~(B 9}ԉ1^_[]ÐWVD$ H~+P,2u!9t t3tL$jQP [ø[ÐX1t T$~93|4 RDÐS[þt3t P7U[ø[ÐS[~D$t3t PT[ø[ÐS[>t3tPTt*][ø[ÐUSWV[0Ɔ43t)2FttrPVPVla3tR3~>11;3}:tt3PPS^_[]ÐS[>T$t$t$ [ÐUSWV[93|$0t$,T$ $ux`MDH@utl$4D$ Uw< 鐐t$ D$PL$ QD$ Phx)t$贒tL$9D$)<9u AT$)RU41t( $4T$4R7D$0D71^_[]ÐS[Οt3t P[ø[ÐUSWV[È8D$ $4VjPj肐tSʼnt$UElƅtMD$ $t$UD$PVFtT$t$$V Vr|^_[]ÐUSWV[˞|$3t P 3~/11퐐440|0;3|4{ 3ǃ wwLJ3j0jt4tW2Ht<@xX3~3LZP\62@HX3@$4Ƈ31^_[]ÐUSWV[ët$3t P3~/11퐐448z0;3|4z^_[]ÐUSWVX(t$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([ؚ4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wq6 1Ґ$t$V|$(WD$0PYt$$謍ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj Vx $4D$)Džu |$ $tR1VT$ V 4$)tWj VUx T$L$ (^_[]ÐUSWV`[(14t `΋43t42NzRЃPWVPV舲hk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<Wi4 PWVjUt^_[]Ã<$7L$ȃ,D$11$D(PD$DP0y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P*D$T$3;4}D$PRjQD$PRjQ舥Nj$D(PފD$$L$ ;47&ffffUSWV[+|$$D$hjjU蜊 t)ƃ|$t:L$tVD$ tNt*T$P19tL$  11fVUl$ UV D^_[]USWV[{|$$2t$脉Ƌl$r:D$0讉D$4草uX9uE$E EEEEE EEEuDE$E EEEEE EED$%EP9tL$ ft M}Wt$UQ 1^_[]ÐWVYD$T$ t$w4  p@^_fffSWV[üt$V}~tyы9uv0rv,r9p9p 9pt PqqVq1^_[v4q9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PqffffVX^t-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[Β|$ uT$[[ø[ÐS[Þ|$uT$ L$/[ø[ÐS[n|$ uT$[ø[ÐS[>|$uT$ L$[ø[ÐSWV[ |$u<t$D$9% Ɖ-t1^_[øSWV[ì|$u8t$D$|$% Ɖ1^_[øXOt/HX2#H@H@Rz8tT$ щH@1ÐD$t/HX2#H@H@Rz8tT$ щH@1ÐS[þT$R[S[ÞL$T$ 6[ÐS[~T$[S[^L$T$ [ÐSWV[<t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[üt$|$tCGX2@TtgAWW@x8tg@ 1^_[ÐUSWV[K΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt V4t"G8tt V 1t$׋NX2#N@N@Rz8t N@^_[]øSWV[Ü΋AX2@Tt{ @f @tf@t Vwt Vr1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXϋHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXϊHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[t$8V$ PVW ^_[ÐSWV[ìL$|$t$x"1t%<t9u Wi$ PWVN ^_[ÐSWV[Lt$|$W3$ PWV ^_[ÐSWV[L$|$0x1t!<t9u W# PWV ^_[ÐSWV[ü0t$t$VK t|$W# PWVn ^_[SWV[lt$t$t$V t(L$ |$x#1t&<t9uW# PWV ^_[SWV[t$t$t$V菏 t|$W" PWV ^_[ÐSWV[ì0t$t$V; t$L$|$x1t"<t9uWR" PWV7 ^_[USWV[5$AL$I,D$$|$@1 $D$HL$D$ $cUT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PhuxNjT$u$^_[]ÐUSWV[%$$AI,D$$|$<1 $$HL$ D$$pUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$qt$0[ÐUSWVZqL$,Dt$(PD$8t90t #FHD$ɉT$~~^;^P| nT9n)9|ʃ$)9߉l$}i$؉щT$ 9\$|$9FPjWVpG;~xً~;~P| FT9#F9F\$Prq, ^9YF,T" !~uV,LЋN\$|$l$ U9ʼnT$ 4~11$F,NDT$ p. .L$L.L.fL.\$Pw|QWHfD.$O9ȉ|F\$|$l)ڃ9tm)9|ʉD$ щT$)Љ$9}YD$,\$#VRqpk+ ;<$}%V, * !~uȉ N,Ӄ|$F\$$щ$;T$ }i~11퐐F,ND$@8 8L$L8L8fL8fD8Rv|VtF9|델K~l$ 9\$}!FPjWV9uFt PV1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$@ÐD$@ÐD$@ÐD$@ ÐD$@ÐD$@ffffS[k0[ÐUSWV[k|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}fN4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZn`L$1~t$ ~9J$u9r ^ÐUSWV[+`D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77>1^_[]ÐUSWVP[ê_t$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux lQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0X)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p d912u-t@:uP $Pd1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV[H]L$(l$$UuX< ;~$|$,M;~ L$ L$(+ut$l$,+o w4$tpL$l$4$l$(9nы$;JT$,,$9U t$t$ $;r|D$(GD$,G W: Wt$ IOD$,G W D$79t,鐐FN Vʼn |$(69ujW跴1^_[]fffffD$H8T$ ʉP81fffSV[[T$L$ Aq D$t$jVPt$ ^[ÐUSWV X[D$1tYՋD$  +T$$QQ\$(Dž )yy A;D$$&ދY 9t$$A9t$(7Y9~ 1 ^_[]ÉL$\$t$,jVt$0Wtɋt$NDHDNHHHh L$ H$pH$h0ȅɋ\$xƒrUǃ߉AA8ATApǁǁǁut<ҍ<1Ґ9u$J +N J(~T1B,,B+FV, HMPUE $pQ8DT$E;z}J(뮉SV[ýYT$L$ Aq D$t$jVPt$ ^[ÐSWV[|Y|$199Rjw www0$ƅt VW^_[ÐUSWV$[Yt$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV[EL$8T$4y1ҋt$}t$j J\$L$(xu$0)\$L$(xl$H l$H}D$$ H1D$4Wl$H9} U,4I,U L$D@t!t3t$t4D$84NT$8R,Ju͋l$Dl(EDL L EHP fǃT L$Qu|*ELf\ MH!L$fl$|$ ~tD$8@,Dtbt$$HL$xo$j" D$@, !D $jjUt$W|$ -\$L$,@@A,D$(@(x ;i|J1D$(@ D$3D$@x9D$||$D$$@u#L$8 I,T$ QT$L$(q  tU1L$ QRLD$0T$,P8t A xtpt$4L PV(iF!;D$eFٍ 4)Nj$y1D$ @@LD$,|$0t$;l$l$M|$HxGu ;W|$ } D$HP(9}eD$$3l$DtJL$4L$4u:D$XfD$\$jjD$`P\$ D$4) U:D$$Hxq2U 2;q<|$@D$(u(Gu"$t$W&\$D$$HL$pjYD$X, t$<;t$ t$u 9uƒt#L$  $jUQVt$L+D$$L$ Hh;l$${"T$$ω;l$GD$(l$u $t$W%\$T$|$,;T$0;L )tO;P T$JR,t$ R 9ut$9ru r;T$wD$@;D$ T$t<i̋D$@ ))Ƌ$t$,\$T$ 9v(PL$ I ywwy1,L$;i|:A;D$ uL$$ yL$s;D$ A8uKЋT$Pt$  D$$xLL$CD$ @tGt‹$jCD$ @Dj+W 딐$;l$Tt$W#<GŋL$$ yuD$뾋D$$Չ9h֋L$ T$9Ju\ыR9~S9}OPp$jT$ KD$@, $jt$ VUV*(\$D$$p h 9|T$ R ztH{t$L$q9|d@D$\$D$Pjt$4ZT\$ D$|$x D$$xD$8;xj@,L$ 4pP FL fFVX !ZL \ fN\ 49D$8;x|T$t$t$ƃ$D$8;h}xD$$p|$OoL$AD$$j\$G, 9;t$u 9l$ut+9L$D $jUt$ t$V$\$T$BL$$ ABAOHL$Nfɺf|#udt$T$։D$,)jVD$PRPfL$<$|$ T$t$WL$΋D$)jPWVW#t$QD$ @f|$(ut$It$t$,QpDQjP-ɋ$CdDPjQQ f~$~gD$@u]D$$t$Fh2u&P9u%$PD$<0N;\$6>v t6>vuD$ @tt$ t$tRFz$j=D$ @$ $DjP\$ ?tdtD$PjQP\$ D$ @txHL$pmGD$$j \$G, 99uT$9T$u $9 $jt$Ut$V!\$E;1f΃9!U,<t$uw\$GEʋL$HAQ,1f1ɋ$u뎐l$;|$ ,0t$l$,L$DT$0;|$  E;l$(ŋt$|$T$0D$D$4l$@sD$D$4@ωD$ D$t$9]D$9D$<D$T$ЋL$9ȉD$D$ AD9` ` ` $Pq|r\$t BfBD$ ALfBt9zAD$Rq|\$uD$<GD$D$4T$D$4x;` ud D$P1r21` $Ph Va\$ ǀw ` $PQR8\$ D$@` L$Pd D$ T$)ЉD$LD$‹t$)T$4)l$,0|$LD$ xpT$)l$ E@H0T$҉|$t$ xpuDt.t%|$T$t$>t$ ;W|$Hrt$t$ Q}f DUjPG jjjVWKt$ @UjppG jjt$jj @t$QfUjPDG t$ D$4T$L|$)T$t$T$L։t$TI,T$DD$<4|$(|$0D$<|$4D$4D$D<9;t$;t$D$ @,֋T$(;W|$Lt$|$ WQa DUjP C jjjVW|$ @UjppB jjt$$jj@#D$PQlaUjPB |$ F|$GD$0D$D8jjD$0PVQE@tT$t$9rt9؋$PQ`DQjPB jjt$$Vjt$8HL$QP`l$T$ϋl$$DWjPA |$D$l$,t&ŋt$ $@WjqA u|$oL$ɋ|$L$T$ $NDVjP(A |$0)l$l$,|$ $@Vj@ u|$ $jjt$$VRv$Dl$@$Wj@\$ uUjH@ |$t$ |$,t!|$@UjHT@ u@L$ IQjp0^ UjP$@ jjjjt$ $D$VjQ?\$ |$0l$l$,@$Vj?\$ u|L$ɋ|$ t$y8UjLx? D$t!t$,@UjLV? u@L$ IQjp0] UjP&? jjjjt$,@@p1DQjP> L$T$ $jRQjW\$!HD$$jjt$VRS$Dl$t$ @$WjHy>\$ uL$L$ T$9Q|$ D$VjP&>\$ |$0l$l$,@$VjL=\$ u<8587PQheR$ USWV Xh#D$\$DT$@|$5 H@ @t)@tDQjP5 H@@t)@tDQjP4 H@t)@@tDQjP4 H@t3Ht$LtDQjPz4 H@^_[]ffffS[0[ÐUSWV [T$ 9t #BH$$BjD1Bt$9J~B,t$pD$F9.u(ftN!; $u~ tN.fFF! $FVr|)tfF;t$r[f~y벸jRqjjV! 1 ^_[]fffSVD$L$ ;u@Q;Pu8Pf3Qu+I P ÅǸ tttu t1^[Ått;uIRDžu ѐS[>D$ L$QPQfPQfPPq [ÐUSWV[|$t$O tR1ȋHvDžtYujtpG@v1ɉDžu1X1tRiQuG .1t(@yQu^_[]SV[-D$ tpPu^[ÐUSWVP[D$H~D$@1L$I$9}Z~L$I,$ i19}ƋM tyQuD$@Ń^_[]ffffffUSWVD$T$t/L$u+1t 1%t 1^_[]ÉӃ1 9t<1lj1D1ǁt%1ƐUSWVL$2T$119:lj1zlj1zlj1zlj1zlj1zlj1zlj1B؉ǁt %1z 5É1_É1_É1GÁt%11^_[]fffSV[]D$ L$T$t$ 1c1^[ÐSWV[ L$ D$T$t$|$ 1^_[ÐUSWV $[õ 79| 9|$} dANj ʼn ș @ 8@D$Dj ~RD$8t/@@tUjP - j @@ltUjP, 릋 ǃ d9| H 9|[H 9 }B @8u@xhu ǃ $n d9 qNh9}uuJ Bt> PQJ t*NjD$9 t#W购$~ 1ɋ$DPjW+ ^_[]Ë@D$DL$ d;> MIIlttt$ jQH+ j D$uǃ USWV$T$ [ D$PBpL$ t$tIT$$h t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$ Pjt$) ǃ ǃ 11ҋhD$8 tlj)D$8>$@D$8 $<t$u; } t$Ћl$)$t$@@9 9<$ PjQ) @x H$L$T$ t$dՉL$)4/L$T$ 9~L$T$ <$ Pjt$( ǃ D$ ; ;T$ 9<$ to j PXx) @lt QjP( F t3 j PWx) j |j m  ǃ 1;  $ l$*ǃ ;  @@ltWjP6' yA t`j t$Vx )ȉ }u D$8o@@lU8 LQj `u ;  "UjPw& ; ~U   @@xuă tjWVx) j띍 ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jPu% D$(19 ș)Љփ< 9D$@u t!j t$Tx) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$ZSx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP" <,$ t!j t$Rx) j f ; ~nUjP" ;  @@xu̓ t!jt$)Rx) j룉PS[D$ t# PQQx) P1[fffXHy8~DyD~>Hlt htðuu냹tt u1ÐX/@ xÐUSWV [AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$tDPjR| MAҾt.DPjRU $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";|0 fp"2fr"4t"ǃ ǃ 21ClD$L$ /jt$%\D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[:L$9 ft$9|$ 9l2uCUw$-4$t$sk>(w(|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVX2lT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y>(f>2~w-s q>(f ^_[]ÐUSWV[{L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW6DQjP 1^_[]ÐSWVZ¼L$x?9J\~2D$t$|$ Irftf>vf1^_[S[^ǃ0ǃ49t% DŽp"DŽt" t 1[ÐUSWV[T$L$l2uI~w-ss>(w!((ff fff0f2ǃ4>t* f0p"f0r"DŽ0t" t 1^_[]ÐXh2ÐUSWVP[t$ t@@1EHd9l2p"fx fr"yVRt6$DPjR[ 0 $!A@Ep"f@dfx0ɋ2@Ql3DQjP  Er"Zfp"fx fr"yVRt6$DPjR 0 $!A@Ep"f@dfx0ɋ2@Q#3DQjPQ Er"]fx*ҋ2@R42DQjP Efxd#H@ H@^_[]ÐSWV[Ül2tu6@t!|$DQjP 0!G@f@d^_[ÐX/f@dffSWV[ D$ yOQW~ ;O~ t Q WPW^_[ÐSWV[Ü|$D$OQW~ ;O~ t Q WPhW}^_[ÐSWV[<xWt$WA^_[ÐSWV[|$Wt$tW^_[fffffffUSWV^ƻL$xLT$xD6~9|5^9~.nF,9}#,]19CENV1^_[]ÐUSWVL$xHT$x@t$~9|5^9~.nF,9}#,]19CENV1^_[]ÐUSWVD$$pHP 9,$l,$,$m19|$ Í],$]xppt_ÉΉ׋HP {)xs)x݋X9|֋h9~ω\$ Xl$h,,$݉\$;\$|,$\$leh^_[]fS[.t$0[ÐUSWV([t$@D$$ D$ D$1Ʌhv2x|$F1ɉȃ(^_[]ÐSV[=0t$t$V tt$V ^[ÐSV[t$ t$t$V tt$V^[ÐS[îjt$ 0p [ÐS[~jt$t$D [ÐS[Nt$ t$ 0 [ÐUSWV\[L$t1-1qxƅ|$pGPD$iL$x|$D$t@$L$OGʋL$tiL$pIL$T$L$p|$E  u;yTuA8 u  t t+D$օ_1^D$ D$1oT$$j vxË$h0L$ș)T$L$L$ (D$D$ $u'x)ʋEAT$$Pxt$EtD$ ~L$p֋QA)Ѓ9~$t$NT$ T$ AD$t$t|$L$1ҐD$$#D$ 1ҋ|$D$=Hd(D$ t1sT$|$$|$t$j xƋh(L$ ș)L$ T$|$$|$$ t$`D$ |$T$1$vlx;l$T$|$t)ʉ$ l$T$P/x‹FL$T$L$l$tɋ$ T$t$D$p@,L$ Ql$ tL$(t!|$$y4s |$po(ՋI;)})t$֋O9΋|$T$@ ,L$؍4D$49\$,L$pD$0ADE$Uq|GHEEfEfED$09w|$\$,#FEF E FENME9sًD$ D$ t$|$ptS$G,L$D$(ED$ uLGD$wD$ GD$GWwD$GD$;GTu"Wx|$T$D$t$|$T$L$pAI(ȃL$(I ;~t"|$tL$ L$ $t$$$Utt$p>1\^_[]ÐSV[ý0t$t$VL tjt$Vh ^[ÐSV[mt$ t$t$V tjt$V ^[ÐSV[0t$t$V tt$t$V ^[ÐSV[t$ t$t$V` tt$t$Vz ^[ffffffUSWV[{l$t^T$r9n t9tB 1ɀx$u B1Ƀxp|$$t1R(Wt$$t$$UP 1^_[]ÐUSWV L$[|$8T$`D$01DFt01ҐЍ GDFu<.u=GLnL$1D$thЃՉ,$D$tGDFu$L$4PL$ 苜T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K|(Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K|(Й~ ƃQWT$H ^_[]ÐSWV[<|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[þ  jt$t$t$P1[ÐSV[}  jVjt$PJ1^[fSWVP[;|$t t9t QD$PBL$QjPW6L$N|$kK)l$kK) <8;<8i))PU耸t;y t0q$t~fuUvIu1 q )^_[]ÐUSWV[hD$$L$t@1D$D$>D$PL$QjPW5L$kL|$kC)l$kC) 8;8i? )*PU^t7q tAy$t+nuUw)u A*y^_[]USWV[HD$(L$1҄t@1D$D$8>D$D$P}L$QjPV4l$-?L|$ ) i)ʼn) i)k8{8lj*SiŠ)Ǎ+PD$P$t1D$H+<tzp t:h$D$t}suPuɵD$uދ} مt3l$,t+Et$WPmuV|EЃ^_[]ÐS[þt$ t$t$ [ÐUSWVH[Èt$\t|lD$PpND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$Uz{L$QjPU2L$ȿNt$kK)kK) <83<8i))PU輳$D$$)ED$j=U舓tƉH$$D$<$|$W|zL$QjPW1L$Ƚ-?Lt$) i)) i)K8s8Ɖ*SiŠ)ƍ+PW覲D$5tcL$f <$|$WyL$QjPW^0L$ȽkLt$kC)kC) 838i? )*PWtD$E+E!D$*DFw $$D$tPU蝱%PU腱8PUmW%PUU@PU=tz8PU)tr~8PUte8PUtXDUPUu^O1<5.' D$UwNj$tPw 1L$;D$v==wL$L$Qt$wL$uD$ 9D$ tf, UQ,$t'UW|$BU諸4+1t$ 1L t]|$uf, FM $QPI4$v  $LD=uVQVv $4D$ H^_[]1|$t4$1USWV[VhOWT$L$ $L$`1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG(M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$8_ 1Pʋ$H $$$H $<<$Rt$Wˊ /$//$H $>$D$^_[]ÐUSWV](2~:^^t@\|,$n*^ÍxЃs.ÉD$$`D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%`Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[Ë1l$E<%uEpuEπ r?уstlu~;|$~,|$tӵ릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$hi 5 @0t$E4}0u"$h1E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP趯 l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu, E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $>ȉىӉl$ |$uGD$1l$뀋$`DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $X@$t"A$|t+H$D+$1$uՋ$1ڃV$A!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,nRE,}0M4T$$V$0PRQ1$E4$߯1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PgP=D$π$O6\`D$TDl$H$th$V g9r‹E0M4ʃ9‰\$WE,y$H$|T$`t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$d1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$ʫ1L$ ʀŸw Dʀ¿~4r$膫1ۋu0M4A9s E,u,߃$Vu,莠rE,u0M4tڍqu4 $ 1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,jtRE,}0M4$V$0Pt$QE4E,M4},$ݩ1^_[]ÐSP[T$ D$$1Pj= [ÐS[t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ÍT$ D$$1Pj [ffffX_L$8ÐUSWV[8|$(t$ l$uP1mƅ>l$$uj hj蜜L$tfjVP NjD$uj(P/D$@ x |$(u?9VqE\1F489Pk1D$tGuP|$(8x |$(tF|$(m9V|$(19Phht@U規 t$t$tL$t RB(J8tRMPktjjPO IA(XP`ktjjPN IA1t^_[]Í8PjPdT9VSVP[T$L$D$tRQPVƋ$t P.^[fUSWV[Ût$|$t$jt0ʼnVU|$T$VŸj9Pt$Ǘt~ȬPt$谗tko9Pt$虗t[u9Pt$肗tK{9Pt$kt;9Pt$TuA1 @VK^_[]ÐUSWV T$L$[=ǃ 9P|t9j|Vkt.)9uUt$Vc t6u0,1(VR9ſuUt$V+ ^_[]fffUSWV [øD$48H L$@ 1퐐/t <,tEP脃UWPs .,v3l$4uWۓEED$\$cD$9D$|$j|WjtD$4@ T$L$ tx17t<,t\$RT$QD$P莂tDl$VWQr Ut$Pr 1<$W*QNjt$D$Pl$8uEW|$WVq WtD$D$D$ Džt$R\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$UՀ\$8C k$K($fC K(K(|$T$ t$49P9=>p1\$91\$-4$ӐK\$9P<D$P褐D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q~ ^_[]USWV[رD$t uyx9|$ 1퐐/t <,tQL$M$P~t2ƃ$UWPn 4$t$Pm 1^_[]ÐUSWV[|$ t$FN,9vtU6uCu;U}t.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[z|$ l$FwPW uLt}D$x@ȃǃtVot$ UĄ)Lstƃntfuă뿐1ɋT$z H膒D$8l$|$ u)1|$9WuPt$D/WKpr :WuPt$D1TL$4xT$$s$tntfuσ1} t WPVg l$ E|$f>t WPVg }t0EfEfF}WuVg f},t&E(fE,fF}(Wu Vog f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[K|$ t$FN,9vtU6u]uUUvtHnNT$l$f,Ninf|FFWRPwe ~F 1^_[]ÐSWV[Üt$FNy9vtW6nuCu;Wkut.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$D`EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1*:bGj|Uy{D$tL$j|U!\t L$U8C=rUPt$P 10^_[]ËD$tPCL$ =rA:"D$t+PBL$=r^:QUPt$T^jjP{}tt$ $@ 1D5t <,tFPsD$4 VUPc D5$(L$tSD$HtJ11t <,tFP$s Vt$Pb D5$h|$t+D$Ht"t$7 $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0xv$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p u$D$t$HjjjPjfWjQ:VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[ʔ|$ $ ftGt D1DWG(f hwU1 =wb, Ƅ |)ƋtVPU1 9vD|ŃƋGtVPU{1 9s D|ŃE$^_[]ÐSV[͓t$ tavCqv8qv-qv "qv$qv, qVq19 uǃ ^[ÐXO @ÐY/ @uxUSWV[$(E$$4D$$0j:WGtjQP# t0V$0W  NjE;$^_[]Ã\u 1@tMduHt6luPttxXf$O:t @t@uS4$l$w$D$j@UPR/ <:t$EF<:uEl$4$D$D$Otu<PH\PG`ǃ< ` D$O6P$$,PQhW蚕 t" ǃtmsj <<g @X jN `_\0 `! )BPC+BP% .;P7t7;j/Vct|$uP$jPRQVЬ'PT$$jPRWUQV觬D;VPj/SV[mt$ j:V&DtjQP tt$V1^[ÐVYT$փ1u@t^1\^USWVH[؎t$dl$`L$\D$Dȃ=@u\<$yS;L$VPj@Q3T$tLT 9 $ƅtID$\WU\ ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\\@DŽ\DŽ@tp $;D$Du ЃH^_[]USWVT[x|$pL$ll$hD$P=@u\ $t$ uY;L$WPj@Qϑt$t$ T$Ijj lD$Wt$@o $t$j l9<$u-;D$PuyL$T^_[]WQU6 ;L$PtNT\}@nDŽ\DŽ@o;D$Pu T^_[]@USWVD[(L$`T$dt$X}|$@uM@u \t9ƀ_;RQt$dPj@W艐 tRQt$dVV M;L$@uD^_[]SWV[l|$=uj@u \tVw>P}tL!\@DŽ\DŽ@W^_[ÐUSWVP[ȊD$hT$dML$LL$pL$t$lуuc@u \tOz=m8@tW=mSPT$ vPQj@R x. VPR$U b&<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l\< 4()uT$ff׺r$σߺfDfu,$tу$$1kE;D$Lu^P^_[]Ët$d\@DŽ\DŽ@(k,$1,$\S[>D$u&@u \tj-[P[ÐS[D$u&@u \tyj-[t$ PM[ÐSV[Ít$ j:VF<tjQP tt$Vj-^[ÐSWV[,|$t$j:V;tjQPX tWhV WhV ^_[SP[͆D$ L$ $L$ƒu&@u \tMi-Qt$P [ÐS[^D$u@u \t1[PDK[ÐSV[ t$ j:V:tjQP= tt$Vh-^[ÐUSWV׉[äR!jj ueD$UWt$@  t$j Le19tG4$\D@5DŽ\DŽ@g^_[]ÐUSWVL[D$D$H1,<jU\ u} t @u D<@u^\@~DŽ\DŽ@ gD$;D$HL^_[]Íl$ E< us{Uf8|$jW\ u|$ u}Fu\@DŽ\DŽ@Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:$ D$t$DRL$D$ A @`? ;19<$$ D$D@ @`ƒ?;91$ D$D@ @`Ń?+;9$ D$D@ D$@|$`D$?;;|$  ՋL$$  <$‹D$Dp$ D$L$ D1 <@4$T$<`Ń?|$_u+;19QL$ T$D $L @`ʃ?|$_u;19 l$ D$L(D$<_D$$D @`Ń?+;19 ՋL$ T$D |$_$D @`ƒ?;9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tl;i;;D$(Q,^_[]É<$t$D$$ VRPQT$T$L$ t$ ?3;|$D/? ;D/ ?;D/D$;/T$T$L$ t$ ?3;D/? ;D/ ?;D/D$;D/D$L$ < ;L/ ?;L/ ;D/D/ $ <$<$B USWV[%|$D$$  ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ @$ z3z4t2tkƷ< sԃ1@tt$ tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ z|$| t!qtAD>1tBD>׹@$ zD,|t.tkŷ< s݃1@tt$ tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ ǃ$ z|$| t!qtAD>1tBD>׸@$ zD|$t=2t$Fi%I<<fw1@tt$ tlj瀍 ; 1ttD~t$ a{  fAB{ w~4AB{ w~4AB{ w~4AB{ w~4AB{ w~4A{ wʼn41 @tt$ tlj瀍 ; 1ttD~t{$Q{$A$ {$B$ $u1 @tt$ tlj瀍 ; 1ttD~t⍃_{$ 0p}QP}QP}Q}u$ D$p$ D$l$ D$h$ D$d$ D$`$ D$\$ D$X$ D$T$ D$P$ D$L$ D$H$ D$D$ D$@$ D$<$ D$8$ D$4$ D$0$ D$,$ D$($ D$$$ D$ $ D$$ D$$ D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف{р3ʉрUɀʈǃ % ǃ% ǃ% ǃ% ǃ$ ǃ$ ǃ$ ǃ$ ΀$ D$$ D$x$ D$t$ D$p$ D$l$  ʋD$h$ ыD$d$ D$`$ D$\$  D$X$ D$T$ D$P$ D$L$  D$H$ D$D$ D$@$ ʋD$<$ D$8$ D$4$  D$0$ D$,$ D$($ ΋D$$$ D$ $ D$$  ω D$$ ɋD$$ ? ? ։? T$ځ $T$ 1$ u$ E$ Qu$ ƃu %?? lj%?  $T$ @D$Xƃ $ ΃   ː ˔ J΃    ː ˔ J΃    ː ˔ J΃    ː ˔ J΃    ː ˔ J΃    ː ˔ J΃    ː ˔ J΃    ː ˔   f 4$l$T$ L$ Ń4Ɛ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]USWV(]jD$<X%UUUUʁUUUՍ4P᪪Ő Ŕ x   x   x   x   x   x   UUUU   $؃Ő Ŕ x   x   x   x   x   x   T$H  l$  ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x   x   $x   x   $x   x = = $x   x   ȃx ! ! x ! ! x " " x " " x # # x 5# 5# x $ $ D$@P1(^_[]ÐS[+eD$1ɐȊt tT Tt t t4 uP1[ÐSV[êdD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[àcMD$$D$DD$@D$9\$6D$L$T$@jjPQjRqD$HPj ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWFD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP薐$jP脐D$0Pj5F\$|$ juh$PhD$lPj$Pj$PjWV)4D$ PjEt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[u`$|D$<$`% hjD$@P DŽ$@D$V$@8$u H$@D$E<$@UVqljD$Pt;uH{;WPs4;WP[4uD$r;WP=4D$UVqljD$r@jPW D$,u:|$$@PW#x$@L$,UV/qD$l$0&t$\$UVqD$ D$D$ D$$$@&D$ \$UVptt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWoD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V91$xU$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-;PQR3d_h$DUt$@V: j jW  hjU hj$P D$@hjPҾ D$<;$`u`d^_[]D$RWmD$tT$@PQhR_l$ $fffffSV[ýZD$ h`rƉP7)Ɖ^[ÐUSWV[xZl$0;jD$PU thh`) $)D$j PUl $l$1}$K1D=t<$t h`tt$,ō;$' 4$t$L$QWPjbVt^' L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃;t$ Wt$t$Pjbt$(V^$' ' '  ' jQPR ;(' ' '  ' jQP ;,' ' '  ' jQP ;0' ' '  ' jQP ;4' ' '  ' jQP ;8' '  '  !' jQPS ;<' "' #'  ' jQP  Ƅ;@' jjt$X ^_[]fffffUSWVD[èW|$\w Q:2t$`tD$@jPV$j NjD$@9t8t:D^_[]:8"u tr臂D$yD$ kD$D$[D$<D$8wD$X$2a$;WQjP[0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ $ $$D$$AO$WUVUWQV W$$l$ U|WD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $V SD$\j@PViS $$VRS VWTVRD$j@PV/S jWV#S VWYTD$;$u ^_[]WfffUSWVP[:;|$l$t.jPUM Ƌ$9t8t"1^_[]8"u t7ސUSWVPX:L$ |$t$Q̓t2$1ې?;9u)ދ$r`?;?;V ?;V?;V^_[]ÐUSWVPX9L$ |$t$Q̓t2$1ې?G<9u)ދ$r`?G<?G|$tl$ t$D$ tKWV(tD(1t$Gt$ ;U2T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[ø2t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[1jt$t$t$@[ÐS[î1jt$t$t$[ÐS[~1jt$t$t$[ÐS[N1jt$ [ÐS[.1jt$ h[ÐS[1jt$ H[ÐUSWV[0t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[0t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[(/t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXO.L$Q##wdÍ^@ÐUSWV [.|$(l$$t$ D$4hD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[~-D$ hPt$`  [ÐS[N-ht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[ý,D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[D$pML$LjPt$lv D$h|$df$D$VpL$)L$D$PVWD$ |$$v=D$t$.D$lp8L$ QjjV*V|$)cƃPD$2PL$Q舼 ? $ $$m=|$D$lp,t$ jjt$>VV蕛|$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>VOV&|$)Ƌ $PD$2PL$Q謻 rg $ $,p=D$D$lp0t$ jjt$>VV軚|$)v#Ƌ $PD$2PL$QE sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7ʉL$R)уtuÐWVt$  r!̐cw^_fffffSWV[<t$|$G@hjP j@PW袶 g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[$$N$@r8hUtE\EXETEP$t$tAsE@hjPt Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$V!hVU< hV1;$u Ą^_[]茅USWV [hl$(16t$ %T$$NP NT  ()`N`L$$WRP裲 ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPԱ 1 ^_[]ÐUSWV_$hRP莱 RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$hL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P, g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQU $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]sffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[(|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[kD$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[ËD$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]($D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$A4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$`A$FQ? T$‰ً$|$D$G<uD$ $@ $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4hL$ |$ )t$)t$$t$,)wD$ L$?? n@ T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍 AFL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N AFL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj @&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B @Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅޒGPGX ޚGTG\GG?$L$u aD?@FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  BFL$Q? BFL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$A$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tAD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$A~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=FA$FL$Q?P$@$NL$Q?D$T$ ߋ t$FA$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $IUSWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP&v )t]D$)WPu8v }43M(U,E4E09w)RVPu E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[ܸt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[kL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQUt F4n0)Pv8Ut 1tN0^_[]ÐUSWV[۷t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[øL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RoT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXŰD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$̛L$@D$?? u)D$(AL$(AÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+T$D$tq01t ^_Átփ*tUSWV _ǸL$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[Øl$$t} t}$t }t9/t ^_[]ËGHǃ8ȢD$(t wNjT$,x9L$u*@|$D$ @$;|L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPm )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IvtxzG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[X|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw #I o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw G o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw D o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQD F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw C o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQQCL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw B o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw }A o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw @ o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw @ o $ho)o)hu $AA~l$(u ~tvet!@UV|Xxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq > $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq x< $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$XHq$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv * n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ) n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv ~) n on)n)ouGGD$8xt1$^_[]ÐUSWVXl$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu E% } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu $ } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu # } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu 2# } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]Xd ÐUSWV^cL$4t;T$8\$0Ӄs3I͉у1&Ӊi913 ƒT$4zR13 ƒT$4zR13 ƒl$4M1ʉ3 xT$  1ϋL$ 3 Ã1ؐ\=13 \=13 9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3 3 3. 3 $3Q 3 3 3 $3A 3 3 3 D$ $3A  3 3 3 |$D$ $3A 3 3 Љ3 |$|$ $L$l$11D$D$33 3 3 3 3W13 3 3 3 3G13 3 3 ȋT$3 3W 1‰3 3 3 \$3 3_1ˋT$ )3 3 3 É3 ϐÉ13 W13 W13 W13 W13 W13 W1Љ3 O13 RЃ^_[]ÐS[Þ^t$t$t$ [ÐUSWVXh^$D$$tz \$׃vND$t$ 1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX]$D$$tz \$׃vND$t$ 1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX\$T$tfǃvEt $ 1ف 1υt1Mu밸^_[]ÐUSWVPX\$T$tfǃvEt $ 1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Wt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX/VÐUÐXUT$J r ù)ыÐS[þUD$D$ P"[ÐS[ÎUt$ 3[ffXoUL$  $ (, | 0 <8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_RT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PIL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXOD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$ PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$Y=L$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +D)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX;:\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[ì3t$VGR=yaratV=tcidu3VuVStt$P`F 81^_[ÐSWV[<3t$VQ=yaratV=tcidu3V;uVtt$PF1 8^_[ÐSWV[ü2t$VWQ=yaratV=tcidu3VtVctt$PpF 81^_[ÐSWV[L2t$VP=yaratV=tcidu3VKtVtt$PF1 8^_[ÐUSWV[1t$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$VuD$PWUa 1u (Vu (^_[]ÐUSWV[1t$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VD$PWU 1u](V&u B(^_[]ÐUSWV[k0|$Gt,/D(UwU t D$0 1^_[]ÐUSWV[ 0|$Gt,/D(U蘚wU誒t D$01y^_[]ÐUSWV[ë/|$Gt,/D(UHtwUJt D$0 $1^_[]ÐUSWV[K/|$Gt,/D(UswUt D$01^_[]ÐSWV[.Pt$ t$  t6D$t7<$D8W`t$WqtD$ 01KB^_[SWV[i.Pt$ t$ N t6D$t7<$D8Wrt$WtD$ 01^_[USWV[-t$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$VD$PWU} t_V D$t<<$D8Wrt$WtD$(014 8&8V t^_[]ffffSV[,t$t$ePzK=tciduL$1=tcid^[ÐUSWV[Û,t$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[<,D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[+t$t$Vt$t$f D$V^DD$1^[ÐSV[Ý+t$t$t$1dVPP^[ÐSV[m+t$t$t$dVPQ^[ÐSV[=+t$t$t$cVPwQ^[ÐSV[ +t$t$t$cVPQ^[ÐSV[*t$t$t$qcVP7R^[ÐSV[í*t$t$t$AcVPGR^[ÐSV[}*t$t$t$cVPR^[ÐSV[M*t$t$t$bVPS^[ÐSV[*t$t$t$bVPgS^[ÐSV[)t$t$t$bVPS^[ÐSV[ý)t$t$t$QbVPS^[ÐSV[Í)t$t$t$!bVP'T^[ÐSV[])t$t$t$aVPT^[ÐSV[-)t$t$t$aVPT^[ÐSV[(t$t$t$aVPT^[ÐSV[(t$t$t$aaVPT^[ÐSV[Ý(t$t$t$1aVP'U^[ÐSV[m(t$t$t$aVPwU^[ÐSV[=(t$t$t$`VPU^[ÐSV[ (t$t$t$`VPV^[ÐSVP['D$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[|'D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP['D$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[ü&D$QPGt&Pt$t$za D$V?D$1^[ÐSVP[\&t$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[%D$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[Ü%D$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[<%D$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[$D$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[|$t$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[$D$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[ü#D$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[\#jt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[ #jt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[ü"t$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[\"jt$Et&Pt$t$] D$V:D$1^[ÐSVP[ "D$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[ì!D$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[L!jt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[ t$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[Ý t$t$5YP*?=gntsuV!t L$1^[ÐSVP[L t$t&Pt$t$[ D$V8D$1^[ÐSVP[t$t&Pt$t$Z D$Vd8D$1^[ÐSWV[ìt$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[<t$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[t$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV[{t$t$WP==gntsu?VŃUHt$UPV t D$8 W1^_[]ÐSV[t$t$VP<=gntsuVzt L$1^[ÐSVP[ìt$Xt&Pt$t$qX D$V6D$1^[ÐSVP[\t$(t&Pt$t$!X D$V5D$1^[fUSWV[ t$t$SP;=loobul$VzEloob^_[]ÐSVP[ìD$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[\t$t$Vt$t$ D$V4D$1^[ÐSVP[ D$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[üt$t Vt$?D$V24D$1^[ÐSV[}t$t$t$VP@^[ÐSV[Mt$t$t$VP@^[ÐSV[t$t$t$aVPWA^[ÐSV[t$t$t$1VPA^[ÐSV[ýt$t$t$VPB^[ÐSV[Ít$t$t$~VP'B^[ÐSV[]t$t$t$~VPB^[ÐSV[-t$t$t$q~VPB^[ÐSV[t$t$t$A~VPGC^[ÐSV[t$t$t$~VPC^[ÐSV[Ýt$t$t$}VPC^[ÐSV[mt$t$t$}VPD^[ÐSV[=t$t$t$}VPgD^[ÐSV[ t$t$t$Q}VPD^[ÐSV[t$t$t$!}VPD^[ÐSV[ít$t$t$|VPD^[ÐSV[}t$t$t$|VPE^[ÐSV[Mt$t$t$|VPWE^[ÐSV[t$t$t$a|VPE^[ÐSV[t$t$t$1|VPE^[ÐSVP[üD$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[\D$QP`8t"Pt$}D$V/D$1^[ÐSVP[D$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[ÜD$QP7t"Pt$ }D$V/D$1^[ÐSVP[<D$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[D$QP6t"Pt$N|D$VA.D$1^[SVP[ÌD$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[,D$QP16t"Pt${D$V-D$1^[SVP[t$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[|t$t$5t"Pt$zD$V,D$1^[ÐSVP[,D$QP15t&Pt$t$x D$V,D$1^[ÐSVP[D$QP4t"Pt$>zD$V1,D$1^[SVP[|D$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[D$QP 4t"Pt$yD$V+D$1^[ÐSVP[üD$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[\D$QP`3t"Pt$xD$V*D$1^[ÐSVP[D$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[ÜD$QP2t"Pt$xD$V*D$1^[SVP[Lt$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[t$t$1t"Pt$awD$VT)D$1^[ÐSVP[ÜD$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[<D$jP2t"Pt$vD$V(D$1^[ÐSVP[D$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[ÌD$jPD2t"Pt$vD$V'D$1^[ÐSVP[<jt$1t&Pt$t$s D$V'D$1^[ÐSVP[jt$1t"Pt$cuD$VV'D$1^[ÐSVP[Üjt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[Ljt$1t"Pt$tD$V&D$1^[ÐSVP[ t$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[Ü t$t$T0t"Pt$tD$V&D$1^[ÐSVP[L jt$0t&Pt$t$q D$V%D$1^[ÐSVP[ jt$/t"Pt$ssD$Vf%D$1^[ÐSVP[ì D$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[L D$jP/t"Pt$rD$V$D$1^[ÐSVP[ D$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[Ü D$jPT.t"Pt$rD$V$D$1^[ÐSVP[L jt$.t&Pt$t$o D$V#D$1^[ÐSVP[ jt$-t"Pt$sqD$Vf#D$1^[ÐSVP[ì t$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[L t$t$-t"Pt$pD$V"D$1^[ÐSV[ t$t$EnP(=gntsuVz t L$1^[ÐSVP[ì t$Xt&Pt$t$an D$V"D$1^[ÐSVP[\ t$t"Pt$oD$V!D$1^[ÐSVP[ t$t&Pt$t$m D$Vt!D$1^[ÐSVP[üt$t"Pt$5oD$V(!D$1^[ÐSWV[lt$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[t$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[Üt$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[<t$t$TYt"Pt$mD$VD$1^[ÐSVP[t$t$Xt"Pt$amD$VTD$1^[ÐUSWV[Ût$t$jP(%=gntsu?VŃUht$UPV9 t D$8 W1^_[]ÐSV[t$t$ejP$=gntsuVt L$1^[ÐSVP[t$xt&Pt$t$j D$V4D$1^[ÐSVP[|t$(t"Pt$kD$VD$1^[ÐSVP[,t$t&Pt$t$i D$VD$1^[ÐSVP[t$t"Pt$UkD$VHD$1^[fffSV[Íj ƅt%PPV FF F^[ÐUSWV[;|$tzj /1tcPPV FF FWŃPtQPK~n VX1^_[]ÍBBBPQhRSV[}t$ tVdP4^[ÍB4CBPQhmRoSV[t$ tVP^[ÍB4CBPQhmRUSWV[øD$tfL$ L$QPjj"1x@ƃ$Pt+ǍD$ D$Pt$ t$W1ɉV.ʼn^_[]Í!CCBPQhER`USWVP׉[\PQj t}ƍPPV n~L$N uq$( U( VPӱ9tBPUˁ$u v V1uWU蔁^_[]ÐS[>t$Pc[ÐUSWVP[ t$t P9.t 1^_[]Fu V5F $Pt͉NjFuxPW$\PQ讃j t!UP$ F~$F qWaUSWV[8l$1t P9}t ^_[]ËE D$P tߋMuxQPD$_\PQj t'WP_E$ED$E y4$iZL$1t P9tËA ÐVYNT$1t P92t^BBtux^ÐS[T$t P19 uL$ tB ;D$v1[ËBuxPQC[ÐYD$t P9t1Ê@$ÐUSWV[{l$1t9P9Eu.E P]tNjEuxPW^_[]ÐVYT$1t P92t^ËBux^ÐUSWV [|$ P19t$$9Gt{o F D$D$Pt[$WxȅtЋT$ՋVtэQPRt$t$VOwo tQ1 ^_[]ÐUSWV[l$P9ED$ Etp} Pǘ$PtM}D$uxT$ $RWQP|$W?M}u tQ1^_[]ÍiCNCBPQh+RwS[.D$tP9u L$ t9t1[QP[ÐS[L$t P9t1[ËD$ IuxPQe[ÐS[ÞL$t P9t1[ËD$ IuxPQ[ÐSV[MD$ tP9u L$t9tf^[ËpxЅtItRPאS[L$t P9tf[ËD$ IuxPQb[ÐUSWV[Øl$$|$ }$tV 1^_[ÐSWV[Ìt$NtFt_V9wwu QPTtFVL$z~ ^_[1DlD-DPQhRQDlD-DPQhR2DlD-DPQhRSWV[t$t$|$PWtu^_[ÐSWV[|t$jVt j V~1^_[ÐSWV[t$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[Lt$|$ʃ>tXVt j V1^_[ÐSV[=t$ jV)tj Vt jV 1^[ÐSV[Íj艽ƅt5hvtFFF V1^[ÐS[.t$[ÐUSWV[D$ t$tPD$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋L$qD$ tL$9QWP 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋH vHN15t$F FFFFU=tP w싔<Nx"u+1Ҁ8t$FHt"tV x>t1^_[]ÍEE-DPQhRUSWV_Kl$D$P1 D<&t0<<t;\$rJ1ɋB닀ztuTz;uN<szuuuwXtEuW1^_[]Éw񐐐USWV[UD$PZ>L$QPjjj$0PD$PZ$$_HtыxnU襗tUt띐$$QL$ QPƅtׅkUetT$$4$tz1U:$ƅt`L$HtыxnUutUPjQt t뫃tX^_[]Íǟ^F-DPQhR |F^F-DPQhRF^F-DPQh RǟE-DPQh;RFE-DPQhERF^F-DPQh RrS[.t$[ÐUSWV[$x4$tT}tNU؀t H|/tv鐐9/ 9sf$.V肀H r/?fD XDXXXXDistX/.plV W$P\ 9ucV^tUj蘖P苖WVat)V^Ut$V/`u-~8u8V^V Z81^_[]É9tE9t qy/t)rVUP 4USWV[5j3[j%1 Ɖ|$hj$] tLǍD$PWLt.L$Al$h($#$V9s&W]VW]V(4$D$ l$t1jjWjjQjE,$EWX]tFjVWa D$D$ u;jjjhj|$WPlEt",$u U蕿1Č^_[]VUD4$ڐSV[t$ jv6Ra v6DV=^[ÐS[ÞD$Pvt[ÍEE-DPQhR螽D$t1S[>jt$t$ [ÐUSWV[$4$0$,D$PStED$$;t 1^_[]Él$L$QL$QRUWVPu=VU$8P$8PD$ PT$,$0릅4$t$$8$8D$ PRt?t$ $,|$$0D$$1;<$4t $4jj$8W$8Ut$ VJS$,$0PQjjWUЍ6FF-DPQhR葻S[ND$P[ÐS[.D$PP[ÐSV[ t$ vV~^[fffUS[EM L$$D$e[]ÐUSWV [Ö\1PQa( W^( l$UV%tPW}^ ^_[]Ét$Wf^j *thʼnPU|$GEOM,$EV#^W|$W襌t(P&V]4$Cp1l,$UW̍9uVMFFFPQh@R谹US[eEM L$$D$e[]ÐUS[%EM L$$D$^e[]ÐUS[EM L$$D$e[]ÐSV[ít$ 1t9u V^[ËD$@$ÐWVYmT$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ¾L$1t91t^1^ËAQ^ÐVZ~L$1t91t^1^ËAQ^ÐVZ>L$1t91t^1^ËAQ^ÐVZL$1t91t^1^ËAQ^ÐSVPYD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY,D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPY<D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY<D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYMD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐSVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYLD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY=D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐS[ÞD$t9u L$ t9t1[QP*[ÐVY^D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYnD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV[uD$D$ D$~6~$,F0tW-uk腲D$jPv T$ D$1ɿ9F8"xxu-D$jVD$jPvU T$ D$1ɿ9rG߱8"u=ձjD$Pv ` T$ D$!Ѓu 話8"t7L$d$D$F!jPV tu L$e^_[]ÐS[Þ( jPN( PQ}1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[}D$0( VPOV1^[ÐUSWV [8t$4L$8AAItFQPRj W!UVtWVt UVR1 ^_[]ÐWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[n\1PQpO( PL[ÐS[.( PWL[fSV[ j@ ƅtCPVjPeMF,F0F4F8F<^[ÐUSWV[Ùt3PjFtjj@yDžuUOj@^1t=PWGjPLo,w0G4G8G<1^_[]ÐL$WUSWV[t$19nUxLN4 Džtbl$~4<$tC1퐐F,USWVP[|$1ts9uiw4#(ƍG$PrI4t$1퐐G,4V4.t;o4r4$=I4$0IV1^_[]ÐUSWV[Hl$1t.9}u#ED$PH19}tt$H^_[]Ë}4tE,$1)ωr^$tUPt$$dt1Ʌ~ă뽋$tuIIFPQhR賢1[UGIFPQhzR荢USWV [8l$ 19EL$$09uVG}4t$tfD$$D$M, $1)ωr6֋$tKՃPt$ @t1Ʌ~1 $tt5t$!G ^_[]ÍUGIFPQhzRuIIFPQhRVUSWV[t$$t 9t 1^_[]ËF4;F01F8u$FD$PyFv4t[D$$x,1)Ήr=$Dž,Pt$, 1Ʌ~$j봍MPQaG( UrD) t$(VWrD$PiU@D|$$o4;o0w,Pj覚ǍMUVWf D$$x,ljh0V2,$tD$,PD$,DV|$UCV\_ǃ,wj,<j<t$$D$$x,ljH0l$,Ujw,4t2$ƅPt$,萗y&$'L$n@4@<C$ōƃM)WRPK L$$A,T$TT$,T A4A<$D$P!D$mhN0QPFt$(P薾t$ ~UFBt$(|$WptmPFUBD$ x|$$t$PL$<WVVJ L$$A,T$h t$ VWq9Ƌ|$$UAD$ D$XUGIFPQhzRr5GٔFPQhRSUGٔFPQhR4(JJFPQhRJIFPQhTRS[îD$t9uL$ t 09t1[Ãt$QP] [ÐUSWV[Xt$$t 9tFD$ PAF8D$$P4D$$@,D$$׉T$)ω,$D$4FPt$,jt1Ʌ~,$벉t$9vwL$T$ )VQPH D$$@4@<W4$t$ A^_[]ÍUGIFPQhzRaJJFPQhIRBS[D$t9uL$ t 09t[ÃQPc[ÐS[îD$t9u L$ t9t1[QP:[ÐYoD$t 09t1ÃÐY?D$t 09t1ÃÐS[D$t09u L$ t9t1[QP[ÐSWV[̽,tIPt#D$PVQ tVQt> 61VD1^_[ÐUSWV[[l$}t^_[]j@FtƋ|$PVjP>F,F0F4F8F<}$t7htL$7PUrVPbUSWV ։L$[Ò|$ *jjWg YFjPww Ht(ut$$әӏjD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t#Ojt$(P6t$}.t1t$$U  ^_[]ÍJJFPQhKR莗S[>YFPt$ [ÐSWV[ ltyPtWD$PVQ tEVt8>VtW0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(GqGFPQhbR藕QGP;W͖1^_[]É.5GqGFPQh`RHMqGFPQhqR)GqGFPQhR S[þL$A4tPQ4I,Dt*P1[Í)H HFPQhR譔G HFPQhR莔USWV$[8l$<|$8uV9}4tMYFD$ PWtj WctD$<9t6$V9$$V9YFPW,^_[]ÉL$jjftMNHl$MPQ@6( PQ3[ÐS[( P'3[ÐS[޲( jP2P) PQ_a1[ÐS[ÞD$L$ PQ.[ÐS[nD$ t$P[ÐUSWV[;l$}tQ97uGW3EtS90uOH<1;M uM;H4w\t @,4ȃMW3^_[]ÍH[IFPQh{RHmHFPQhcR֍HmHFPQhhR跍SWV[l|$wV3Gt$9uG@WUP@j jzDžt!`PWGwo 1^_[]ÐUSWV[Hl$1`9}EuBM1tDm $t: $Uyt^Ut$D$Pi U-;1$D$jyt"WPT$ED$E E^_[]ÐZL$1t `9tËA ÐZOL$1t `9tËAÐSV[T$ t`19 uL$t r ;t$v1^[ËR1ttVRQh ᐐUSWVP[úD$1t `9t ^_[]ËHh t( $tDUxt؉Ut$Ph ątKrK5KPQhR|KrK5KPQhR]ZL$1t `9tËAÐS[ުD$t`9u L$ t9t1[QPj[ÐSV[ÝL$ t `9t1^[ËT$19Q ut$tRVq讱 ֐USWV [Ht$(~$t  ^_[]ËF.njQvPt҃~ t躌D$jPv蕼 ʼn$u 蓌8"tD$NN 9u8"t=KK5KPQhR܅1jPj N,$Uv7ǍFPD$PU tcD$;$uZijPV& tD|$u W賆1,$j!vƅt-`PV譱F~n Wvt WdD$$0USWV$[õy11T$G=w ⍋ jAPQXe u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5D$L$ yt QP[ÐVZL$1t91u T$ t92t^19^ffffSWV[üj@mƅtEWVD>jP"F,F0F4F8F<^_[ÐUSWVP[Ht3Pjvtrj@(mDžuU}Wj@ m1tE,$UW蔨/GjPd!$G,w0G4G8G<1^_[]ÐL$GUSWV[È|$1tv9uloU !O4ƅtIl$44$t*1G, 6`t1V蔦1^_[ÐUSWV[ël$}t^_[]Ët$j@ctdǍVP7t$jPG,G0G4G8G<>}$uL$UxUSWVP $[*ts֋|$jjWƥ tCI,jPww 諩t(t1qjjPUt$wt1U&^_[]ÍOOMPQhBRqS[NI,Pt$ ë[ÐSWV[|tyPСtWD$PVQ tEV衣t8>V袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%MMMPQjfRoQqGP=Wq1^_[]É.MMMPQjdRoMMMPQjuRgoS[D$H4tH4[Í`NENMPQhR!oUSWV[ؒt$(l$$~W|~4tHI,$PU胛tj Ut 9t6$W6$W%I,PUU^_[]ÉD$jj it|pLqHVD$~T$rL$9F9(u:G@D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[(t$@|$t$t$jt$2[fffffS[t$t$jt$t$t$2[fS[ހt$t$jt$t$t$2[fYXZQ̀QQr0cS[Þt$t$t$t$nc[ffffS[nt$t$t$  [ffffffS[>1;D$[ÐS[1;D$I[S[H8t j`1[ÐS[þH8t j`1[ÐS[ÎH8t j`1[ÐS[^H8t ja`1[ÐS[.H8t j1`1[ÐS[~H8t j`1[ÐS[~H8t j_1[ÐS[Þ~H8t j_1[ÐS[n~H8t jq_1[ÐS[>~H8t jA_1[ÐUSWVX ~<) ?) R4H) ѐ>t1 @u~1ɍH) >t 9u#;T$t$RyRjVD$S#jt$V Ƌ4<$lD$,$ltAL$t$t$$UT u͋D$|=uU|W9,$}d)tuDur;MDMDMD MD9ux"1 ^_[]ffffffUSWV[%t$/L$({L$,EL$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPj S[~iL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[6iL$u"]UOUUPQhREt$uHT$D$t$ 9Љ,UWt$Pt$Lt$Lpk11҃^_[]Éȉt$,9ы|$0}Ut$49Ƌ|$8}!UWVRPt$Qt$Xt$Xk 맋L$<fffffY?fimNA90%ÐXfL$ffffUSWV0Xe$t$Du%$JV@VUPQhRBL$H|$PL$u)$XV@VUPQhRlBL$X1|$L$Wc2D$ ؉D$ )t$D$HOL$|$ T$/,T$D$H9wԉL$Lt$9s,D$$PVT$XD$x ͉ƋL$L|$$WVT$XD$H\$tt@1ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$  T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$L7D$4D$9ƋT$L߉l$9s.*D$$PUT$XD$x ŋT$L|$tB1ɋt$D 9u)̓|$nЃ|$S1ɐT T TT TT TT TT TT TT T9u|$uO1l$ t$L 9u)\$T$Lt\$|$$Wt$T$Xt31T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$1Ґ  LLLLLLLLLLLLLL9u.$t$ S=1$sB0^_[]USWV<[Ø_l$X|$T|$\|$T!D$u D$4tǃǃ T$PT$$9L$$xT$,)T$0\$|$ =$D$(\$ ǃ|$ l$XL$1L$u8D$4;L$$fD$T4>-u FD$,t$0fE<+<-n L$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő Y6YXPQj0R^)jjjjV=tt^[ÐS[NLt$j t$t$[fffffUSWV[Lt$|$u}YKYPQj/R(jWX~G0t ujW=^_[]fUSWV[ÛKt$|$ttft7wt9fh L$f@Hx$p,L$ H(L$$HDL$(H -1^_[]ÐUSWV[Kj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$ tltڍ̵uft?$L$t: $fH f@xp$L$H,h(@DH  -W'1^_[]ÐS[.JL$ D$T$rRQ0P [ÐUSWV[I|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[ÎID$t$t$t$0P [ÐSWV[\ID$8pP&tWփ1^_[ffffffUSWV[IT$l$t\tE0~-},t xr }$t jr2Uڗ1Ƀ^_[]Í}Y֍YPQj;Rz%uYY֍YPQj]VP^"I]VPFx]VP.]VP]VP]VPm t9uuhl$t!j2pU` xq[QPs`YRKD= 6 / ( !  l$zPQj2UFU<ƋD$XtPUt$\ ;D$4u 8^_[]fffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[ @|$t$uz^h^5^PQjYRF)F31uF FF^_[ÐSWV[Ü?|$t$ua^5^PQjwRQ~uP\$wGN Qtt$ t ~t/>^^5^PQhR~~uр~|$^[ÐSV[]>t$ t ~t/F^^5^PQhR~uN .wu^[ÐSV[=t$ u"^^5^PQhR1~t^[ÊV u.wL$~9|ԐSV[}=t$ t~uQ(^^5^PQhR3~u'F u <.wL$9^[Ð|$t1ËD$ÐSWV[<|$t$u"z^^5^PQh.R1u6T$L$9w"QjV FfFF^_[ÐSWV[\<t$u"z^ _5^PQhMR~u/L$Fy |y|9IL |F1^_[ÐUSWV[;t$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]Í+__5^PQhhR6__5^PQhiRwSV[m:t$ t~uF(z^B_5^PQhR#~uNuV9r ^[ÐSV[9t$ u"z^V_5^PQhR1~u(NuV9rT$x 9v ^[ffSV[Í9t$ y__i_PQjTRG^[ÐUSWV[;9t$|$uz^_i_PQjbRl$u__i_PQjcRMϸwG)o >1^_[]ÐUSWVP[ê8t$u"^_i_PQhRh|$ |$u"__i_PQhR;cUL$$Hn 9uЉ,$)1!)1։t$uFAPjQ D$0D$8t p,$VPQ@ D$0)p)t[uQNr-` $`׍i_PQhR)L$JBQjP D$0)r& `_֍i_PQhRU1^_[]ÐUSWV[ø6l$$|$u"^-`i_PQhRr1>0L$(#4W 9u$)1*!)1ׅt"uGFNPjQ D$ NjD$8Ћ $)ȍx)t_uUOr.`L$`Սi_PQhRL$JBQjP $D$8)r* `-`׍i_PQhR2L$Q^_[]ÐSWV[5t$|$tt1)tW^A`i_PQhRuύT`A`i_PQhR)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SWV[3t$|$tu)OσO  9 9tj9tly9y]^b`i_PQhWRAiT`b`i_PQhXRB 9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1VL$t"T$ tփuQ^ÐUSWVP[z2|$$"T$(D$,<ȸ9D$ 4t)щʊD$$L$(l$y1`u`$i_PQhRT$L$8D$4t9|$tl$0|$ thu[r&`u`Սi_PQhRcGRjP^ D$$L$(l$0O}^_[]ÐSWV[,1|$L$1uLwt?;t$w6)w*t$uQRjQ ^_[ÐSWV[ì0t$|$D$Vt$P8 ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Ø/|$$D$(t9D$ L$,ň̍`L$`L$i_ $ut$t$ht$ d$<EtM9w'M )9w 8t9rD$4 ^_[]ÃD$0D$4(+T$ ܐSWV[Ì.t$|$D$VPt$  ^_[ffffffS[N.jjt$t$t$t$ʧ[ffS[.jt$ t$ t$ t$ t$ t$ [ÐUSWV[-D$$$$$7$$$utaaPQjlRI f t$pPQj V1D$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$66PNvPVQE jEataaPQjiR $SataaPQjjRW $cataaPQjkR* D$@t%X, hPV $0$$,]PQH"e9x\.;PD$$u"SacaPQhzR$$u"cacaPQh{RTu"caPQh|R.t$uc$T$@PhQRW*<$D$Pjjjt"D$PjjjD$Et$螥t t$ 莥jjWu t$&L$U$$$t$D$;$uVĔ^_[]ÍccWPQB 뺍cc ccPQ軳t$Ӥjt$xjjyccPQkj t$舤ujjx*jt$xt$Tt$ Hpyccu^$puSPP$0uP$$u6$@$8j7 $ccpQRj/VtDžtjPQo $t$u5j$$2$PQWV ^j$$1$PWV8uZj/Vt{j$PQVc dVPQ英 j! USWVh[ã'E$dL$u"bbaPQhRQ$|u"EabaPQhR$$u&ǍSabaPQhR$u"cabaPQhRt$u"baPQhRĸD$LD$PD$TD$HL$8D$HQPjq l$$D$ bD$$D$ D$l$bPmjuD$Pa Džxb1Ƀ8=D$ȃ}D$AD$D$`jjjh|$pWuut,hPW L$bWPmD$`jjjhWuuut,hPWl cWPt$(h- |$ 1(WՂ|$ n$$juD$P D$jPzt$t$X4$PjV )VCPVW՜ V*9h|$(fD$,t$t$0fD$4D$(jjP ~ D$6;8/cP荭xjPW? $l$$|V脿PVW $VfPVW $VHPVWڛ t$XjVW u9|$XBjVW u+jVj蕛 |$X uL$1P觬<$$0輝cPxt$D$PD$dPV謝 V聝$(D$a<t<jjD$`Pjjt$(D$xPuD$XP!x%=|cP:l$<$7GcP:Vl$WݜD$8jPjǚ E;$duch^_[]ÍocPo$묋D$pG0TPVQR)l$`S[N!jt$ t$ t$ t$ t$ t$ [ÐUSWVH[!D$D|$\|$d'D$l|$hu&ƍcasaaPQhRl$tt$`u"saaPQhRofƍ t$$PQj V!%D$D$D$D$D$ l$D$ D$L$PQVt$h6.tz6PvPVQ8 EasaaPQhR|$dSasaaPQhRl$p $At"X- hPV D$\0t$\ $Ut$pt$pt$p4$;D$Du H^_[]2SV[t$ u"a|aaPQhRjjV> ^[ÐS[jt$t$ [ÐUSWV[Õ$E$$u"aaaPQh R:$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQ ǸxVtuTfD$D$PW~,$D$f$//,$$ffD$UD$PW; yQ80uN$=uW#,,$(W(,$W֗,$M;$u Ĉ^_[]迫USWV$[Øl$@t$8|$DD$ D$D$D$D$D$D$D$ L$mPQRV5<$t$L$:$u ]2 uL$>͍ >T$1ҍ2 -9si$:fU;L$s>t 9sE.9r9s34$fh9s맋 $2 9s$]2 ^_[]fffffUSWV[Û t$|$tU載D$D$?D$D$@D$D$AD$ Ÿ4$jjjjUWƍf8D$$1VjjjjU~Wƅbt$$Vw$Lu"deePQhR|$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$TD$$LD$ AD$AD$AD$AD$AW$L|D$(P4deL$QL$ Qt$($TPt$$l$(L<>4LuŋD$;D$uY^_[]Í[gPgfPQhR7gPgfPQhR$tffffUSWV[Øt$0l$,D$tu5#$fgigPQjFRCuj)Sƅt]UP1 F LFuF(;D$u^_[]1sUSWV[$ $$Ph@V^1$|$$ $ u#D$P|$W©P|$`l$d$$ʃ|&jQPt$ 9|=P$Pt$] ƅ~.V$P$PP |) uS84$^A8|$$uj)jƅ~$$QP1F LFuF(4$W]|$;$u^_[]1rqS[þjjjjt$t$[ÐUSWVt[È$D$p$u"MfgigPQhR1U$$U uj)ƅtZD$\UP1L\F LFuF(;D$put^_[]1pffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Zt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP訝 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPL ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [h|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW肩 ;D$u ^_[]zYfffffL$$Yai qyD$A(tQS[8Rjj#C [1ÐT$D$ Zbj rz $z(t RPS[jRjB [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[SRjj>B [1ÐT$D$ Zbj rz $RPS[jRjA [Xt@ffffffSP[D$ L$T$$RQP[[[fffS[îjjt$jTA[fffffffS[~jt$t$jz[ÐS[Nht$t$jz[fffffUSWV [t$ uNggPQjw ^ffffSWV[It$(WjV xqN|$,t?r$ԣd$D?r'轣- d$!L$jWVz ^_[fffffffSWVP[Ût$סtB36 PQhR*x>L$ $6 )QVWR6 PQhR6 > t@> ^_[fffUSWV[t$uhhwhPQjbR謜D$D$I@t NQwى+tՃ-!ȃƉNtu+u0u;t#>!tu:uCtPtЉ#.!tō,#.!u뼉#> t<#> 0# Ѓ'^_[]ÐUSWVX[ø|$l? D$DD$@D$D$jPWC NjD$D$ |$ t 8"u$9r6l$4D$4jj P+ š0軚8uQ$)l$4$u&ƍhhwhPQhtR賔-@@+x @`0U)P01X^_[]=(3l$l$u"hhwhPQhR-qpt+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmUSWV׉[wu"hhwhPQhtR9L$D$T$W~>ǨDt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ffffSWV[y|$t$uNihPQj:R6$D$ WVjjjPL1Ƀىȃ^_[fffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[(t$(l$$T$(1aHD$8t8P3y`i0`D$(8rl$ Pt$ŋ$t$\i)iPQhRQQ\i)iPQhR'*0S`D$8t8PN2W薏4$,t$,覔01UPt$&ŋD$G6,oD$ G > > D$8t8P1G^_[]ËT$((E{/uZjUPQRVtj躒USWV׉L$[22jeVej+Vet-1|$WjPjcyFu<$|$1jrVtqb $UWdt1j}u%E07|+wq+)01^_[]ÐUSWV׉[G> tu(+mu?ru<6+FtjPOfv*+u4jj2f&v*tjPf6*^_[]ÐUSWV[èt$0l$$T$081RHD$8t8P/f&D$08rL$ Pt$kŋ$t$ci)iPQhRۋ[ci)iPQhR豋4t0D$8t8P.W%4$)t$})501UPt$赈ŋD$G6R)oD$ G > > D$8t8P`.G^_[]Ët$,|$(T$0VWU( j]USWV[حt$u"siki)iPQhR薊H$8t8P-> t9ut@mt9uu+$8t8P-h1VߊEu> $8t8PI-|$jWu % ƃu 規8tUltt$^_[]ffUSWVH[øD$`|$\u#ƍiiiPQj>Rst$$UVPW6stUVt$&`ǃu.8ujF$~;$} VP_ǍD$9tLV衉A$jD$Pǂt&UPt$hWr{D$$oH^_[]USWV4[øD$\l$Hu#wU6iPQj8RuD$lt$Xyj6iPQj9RJL$`uxtuut덻tǸtD$T$\dL$00G?L$T|$LtD$HT$Pɉ|$ xGD$Gz9иG|{ϹdkdD$T$D$ HSQ|\ϹЉ)kϜD$D$ T$D$OD$ dD$D$0D$ڸD$ dD$D$D$`L$$׃txpL$VE (T$L9v 4^_[]ÉŋD$\0l$,t)1vwL$$L$$rx|$j|$WQRq|t,jWRP^|tjWRPJ|+щ1ɉ4$tD$LσT$(s1d;21g1di։Ńut% 44rŃu΃T$(19L$$}4$j|$WQRy{щ9} 4$jWQRS{щ9} 4$jWQR-{щ9}O4$jWRP{уjWQPzуjWQPzjWQRzщ9} 4$%jWQRzщ94$D$\|$Љ׋l$ D$D$Nj|$1ʹ9 d$00BL$,ȃl$L97gfff4$ֺQ׉Ɖljҍ)|$聖L$ T$ Q$j4$Qt$V0WRUt$h$4$jjdQRωjyƉр|$ul$эj4$t$$t$QPRJ4$l$2jjdQWyыT$ t$rj4$Rt$QPVt$dVt$d[ 9wjWQRxщfffffUSWV[U$,$(D$ D$D$$u)jcj1jPQhR$<$4$0uBuB$,J BB$$,D$(́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$PH L$P^_[]ÐUSWV։[1$$F t%G HO =r贅Ef{uf}}u f}f{ft"fGf{uu"sjj1jPQhRgt$)pL$PUQ_ D$$jjj1jPQhRsjj1jPQhR~$$D$$1ft`fz~f{tFf}ut^ߐf[u͉񐐐Qf]tfuft΃뭐룉T$$$6191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]ÐUSWVT׉[$Pl$u"sjj1jPQhR|1D$f8~|$"G -t$$$L11ҋ|$\$DKfsf/iD LDKfdf/ZD MDKfUf/KD NDKfFf/<D ODK f7f/-D PDK f(f/D QDKff/D RDKf f/D SRDžjj1jPQhRA{_sjj1jPQhR{=jj1jPQhRzLYMLN?O2 P% QR S9tYD$ |$LtcD$$NT$t$L$PhQRVlhuD$t @ $t$>o |$$t$($P&Dt$tS1ɐftsfTLLTftWfTLNTftMfTLPTftCfTLRut:N,19tDtPLvt$FP:vF^_[]ÐUSWVYT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWV։[F,F tvzzFUPol$~D$uNtQjPqvD$ L$$t$ F1퐐fY/k1jPQhRssj/k1jPQhRsUc&^_[]É$t$ N|Lj$1jRQhpPksD$t"1Ґ W t9uPs닋t$ NjNBʉ<$l$||$T$F tD$$89<$:SWV[ܕ|$t$tt676^_[Í1jPQhDRruʍ:k1jPQhER\r릐USWV[SD$$ $u"jj1jPQhlRq$$f 1fMHftf/t;$sQfyٺҐf/u;$s$fE/Hf/tfuyjj1jPQhmR$q4jj1jPQhnRp$sjj1jPQhoRpfE<$$@1 GtALGt1LGt!LGt=u1v$B @uD$$PQaD$$PQR$16$@ $NQVuE/jj1jPQhCRo$sjj1jPQhERdoLj1jPQhpR:oDf}/9D$%=@=u>jj1jPQhSVnLjPQhpVn1 GtfLGtVLGtFLGt6=u $$$VPV$y$B @uD$$PQD$$PQR(u%#D$=@u;$s#E/$B$L$ ;$u Ĉ^_[]USWV׉ $[à$s$$u)jj1jPQhR6m$|$$u"jj1jPQhRl$u"sjj1jPQhRlD$fr$9 $9=*uG=*uG=*D$GD$ 9$D$$)9$f:BD$D$ D$ $f9uxjj1jPQhRkkjj1jPQhRkDD$D$ D$f9Hu&sjj1jPQhERekL$1AtATAt1TAt!TAt=u1E @uD$$$PQ(D$$$PQU$1ɋ $X#T$,@tsBЋT$$Ut$P$$BT$$UP$ $D$fD$f9u&sj k1jPQh/RjL$ftL$t,=tsAuE @u1$P -$hPQ9* E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtun$0Q׃}1E qjMD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjnl ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ KE;D$f/t$$$P $$$$$U$u"sjj1jPQhERf1$ BtILBt9LBt)LBt=uf$@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=pIM lt$10kD$/ Njt$$E @D$uP0PUu Nk8t E u;$uĤ^_[]ÉNjt$iUSWV׉[Du"N1jPQhRel$(9rfu ^_[]1t$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$zf9u;Twˉٍ^L$ |O]u`$$;D$ u)1;T$t\$9vL$\$;\$(f$ω4$ލ^ρ]tN-uf9w f;Fw$~ːf9t4$뱍k1jPQhRc k1jPQhRbUSWV[Յ$$ukykDkPQj_Rb$$tu8h1D$$tŋD$3l$ y@h@PYD$(D$$D$ ^L$L$\QPJtYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1j1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tW PWu uh QD$Rl$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0J D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$kjPvo u|$1D$Wt$XƋ$6yd$t$`D$|Ay DAD$$uD$*`ՋD$DJtDHD$D$ $@uP ` DAթD$kjPD$pY\jPD$p; D$ |$t$ztG$`L$tZkjPq@ )jPD$p /1ҋ$tkjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1LD$ 1H1D$ D$D$8=a< "aY1D$ D$l$t)aD$D$\Pju V |$`8|$ $%|$tKrjPu |$t&`D$u|$`8|$ $tt$Dtu V^T`t$jl$ U~\ 1$u UZ;$u!Č^_[]Ë|$|$[|E S[.}jhjt$t$t$)[ÐSWV[|> t-> jhjVPt$$t8> 0jF> > tPI> u^_[ffUSWV[{||$ukkkPQj jjj襞 > l$> tUQ> x > tb1i > 9> wHt QcY > WH> t$UWP > u 1T$ Ɖ^_[]ffSWV[|{TW> u> jP0xƃ> 1> t > 1Wb^_[ÐUSWV[ {TW4> u> jP/x5ƃ> > U";D$wUt$%w1Y]0W^_[]ÐS[~zt$-ƃ> [fffffffUSWV8[Czu }D$D$L$$pjjPQjRnrL$0 $$t;L$$L$D$l$tL$(L$D$l$_uVk1l%lkPQjERmVPAl%lkPQjFRFV,D$,D$D$ l$_e^_[]ffUSWV [yLlP! xt\ƀ8tUT$D$j PV tŋT$t|zt)VlVP腑1ɿxkP&wAT@xʹ&7ux@9~ $lljP,$lVPՐT$t$$D$ t l? RUPjQ|L$ t>? ^_[]ffSV[Ýw? u*ǃt&ZPW>t L1t 1t^_[ÐUSWV$[i$ jj$H$DDžtu!K1Ƀ8-ىL$m|$dW5D$KWP$H$D5D$&hy5|$4$l$t$ D$1t$ D$,8hUPV&l$D, jjV$L$H;D$$~UP?l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11PDUD;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[f$ jj$H$DDDžtu!aI1Ƀ8-ىL$m|$dW3D$KWP$H$DD$&hI3|$4$l$t$ D$1t$ D$,8hUPVl$D, jjV$L$H;D$$~UP=l$|$UPV$LV$HfPt$VW$L$L~9u`|$D$ǃ;|$.$D$?11PBUB;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[õd$ jj$H$DDžtu!1G1Ƀ8-ىL$m|$dW]1D$KWP$H$DD$&h1|$4$l$t$ D$1t$ D$,8hUPVƎl$D, jjV$L$Hb;D$$~UPn;l$|$UPV$LV$HPt$VW$L$L.9u`|$D$ǃ;|$.$D$?11Px@Uo@;$ u,D$$^_[]D$ʋ4$t$ l$1USWV[Ëb|$l$t+PWUD uu^uڸ^_[]ÐUSWV[+b|$l$t+PWU uuuڸ^_[]ÐUSWV[a|$l$t+PWU uuuڸ^_[]ffffffS[na0t$t$ [ffffUSWV [1a} F FEFUVzRu)ʃԉF:FJFx9uRu}N ;Nue^_[]USWV [Á`} F FEFUVzRu)ʃԉF:FJFx9uFpRuy N ;Nue^_[]ffSVP[_D$L$T$t$4$VRQPUffSP[í_D$ L$T$$RQPKIfffffSP[}_D$ L$T$$RQP{IfffffYO_T$t :tp1ÐUSWV<[_t$PD$D$8uNm^mPQjhR;pVPQ_ @C hjD$P= HC D$ $WC D$ t:t|tD$ 9rXC jPQt$^p \C jPQt$Dp L$ QPt$,p xNt$ PV2t"mPV2u 16  C VK;Sj:Pt$] tC l$OUPt$u tL$hC գUPt$Zu t D$pC UPt$7u t D$lC UPt$u t D$tC 1+D$ PVt$ o t$ u"km^mPQhR9PVYPVyYFPVaY9PVIY,PV1YPVYPVYPVXPVXPVXPVXPVXPVqXPVYXPVAXPV)XuPVXeePVWU1PVWEPVW5PVW%PVWPVW`1DQVXUVt$Ur tD$1fDC ~vnf^VNF>6.&)fDC t$ 6UPt$Rq tD$ pC lC xC ?*UPt$ q tD$ tC xC |C UPt$p ftL$fC UPt$p ftL$fC UPt$p 1tL$fC UPt$pp tL$fC yUPt$Fp tL$C u,UPt$p tt$C $UPt$o tL$C rUPt$o tt$C fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&C aD$ `|$4&L$ qL$%L$)L$-L$1L$ L$5D$ PWt$ o tD$ UD$,Pt$o tD$FUD$0Pt$n 1ɃtL$Nt+D$PD$4Pt$n t D$1vF UD$(Pt$n tD$ 1L$ F L$ D$ PD$(Pt$xhL$ L$ t$L$ u&k΍m^mPQhR3wr1PQRt0Euዃ` 1DJtV赫t$F t$ <3L$ L$ l$|$4=D$ fC fD$4dxD$6D$50UWt$hm 1tL$C D$51UWt$?m tL$C D$52UWt$m tL$C D$53UWt$l tL$C D$54UWt$l tt$C ǃ@C WEVǃC WEV4$-2L$D$;D$8u ȃ<^_[]fffffUSWVP[jT|$L$W4ك</@t)9v"9vH8/u)t\9v N8/@tvljD 9thUWV~Ƅ+D ^_[]À|$/tÍffffUSWV[XSl$UCtNL(`1DJuK4$5D$j PUh }t֋L$9tJ9tE5^_[]ËLJ wӍ<((@눉b58"u rL$ <$։q1늾=3ffS[NRj t$ [fUSWVP[*Rt$tttnL$VtH|/t|$/u29r9vzz/u)ρwH hUPV|Ƅ+H ^_[]fffffffUS8[UQED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[Pƃtk|$|$uP1uP9jjP t8jPjWjW|WI^_[j1fS[.PD$t=u2[t$ PU[SWV[O|$t$u>YnmPQj1R,WhV ^_[fT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[TN|[Ḯ̀rS[4N|[ḭ̀rS[N|[̀ffff̀ffff/̀ffff^̀rS[M|[̀rS[äM|[Ḥ̀rS[ÄM|[<̀rS[dM|[̀rS[DM|[ḇ̀rS[$M|[̀rS[M|[ḓ̀rS[L|[̀rS[L|[`̀rS[äL|[R̀rS[ÄL|[2̀rS[dL|[ḩ̀rS[DL|[P̀rS[$L|[ḷ̀rS[L|[Ḷ̀rS[K|[ḉ̀rS[K|[̀rS[äK|[Ḛ̀rS[ÄK|[̀rS[dK|[Ḩ̀rS[DK|[1̀rS[$K|[Ḍ̀rS[K|[òrS[J|[ìrS[J|[l̀rS[äJ|[t̀rS[ÄJ|[s̀rS[dJ|[r̀rS[DJ|[p̀rS[$J|[j̀rS[J|[m̀rS[I|[̀rS[I|[Z̀rS[äI|[ ̀rS[ÄI|[S[nI|[ᐐ*̀r׋L$Q1fffffỲrJ!Q+fffffS[IN(SV[HL tFL PjtsL 4+L 4L L RK ^[ËL HL jjjhjPj趫1tȉL uXj$Pj j)S[.HD$L );L t P%[à QPʪ[ÐS[GjP+L uPi[ffffS[îGpPt$t$t$ [ÐUSWV8[pGuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y`DP@Ӻ\$%D$ D$$OL$ۀU|$ɋ|uL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ PPt$t$ ZD$x$WPt$Wb @D$x$WgPt$W7 )D$x $W<Pt$W D$x$WPt$W uD$x$WPt$W zD$x$WPt$W `D$x$WPt$W` <D$x $WePt$W5 D$x$$W:Pt$W D$x($WPt$W D$x,$WPt$W 1D$D$$T$EHL$D$D$D$ PPt$t$M D$@D$ POPt$t$  D$@D$ PPt$t$  D$@ D$ PPt$t$  D$@D$ PPt$t$ D$@D$ PPt$t$X D$@D$PZPt$t$' 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ J|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ nD$ n|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$3@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$n|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VrD$Pt$V@ ID$ VCD$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$pQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$xA(|$€´|njWP 9$D$D$PD$PWt$ 7D$@D$$PD$PWt$ T  j\$0T$L$0DHtJD$0$Pt6uF $jP)F$F(Wv|$*|$z$d1  $iUB$J($1 UB )iJ$$B(1UB $1+1|$r$L$B(aD$ t$ D$ L$ȃШ uNQi)1uB,i)\fиwi)\f1N Vk4<$ȃ u|$$uD$$FL$NlQkdl1u'ui)\P ףr1с)҉)i%Iэ))ƒʋt$$$Iʉ)ʋL$())uFЃFL$$ШL$NQiҐL$)1uE,i)\fuwi)\f1=‹Fk4 $<1ǔʃ;D} $r+3MAD$AuNL$tuϋNQi)1uB,i)\fиwi)\f1Nk4$NȃF ?NQkd)1u'ui)\P ףr1с)҉)ȍ 0i%IЍ)ȃEHx3QЃs1΅$u t1$Ep]΃t1ɿŃD$ $D$,;$0u D$ e^_[]sfUSWVh[X*$l$|D$dtb<$EMw T$ w <|$*|$WUPj WWrDjB ??? F??? F?? ?F ?:??F:?? F????fF eLL$|$T$WRuuuu W|$'QPjHW&.(W]rL 9t T1 WV%<$;D$du h^_[](S[)L Pt$ [ÐS,[(Pt$u$ffffffUSWV[ l$jUt}(t4UE u8jjjuU(!ЃtsE jU?g^uP}Tut5Et.+E EM0)׃9t E<)jUjU^_[]fffffffUSWV[l$jU}(t8UE uEFt P F tX~tI1퐐t(0F t((F t( ;~s F @ƋF PF,t PF4tPF8t PyVp^_[]fffSWV[t$|W4M PVA]Wؚ^_[ÐSV[Í|V趚4M Pg\V螚^[ÐSWV[L|Wu4M 1(`DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsUSWV [Øl$(t$ D$D$ |$$El$ߐt$,D$PUD$P|u$D$͐׊D$l$EjD$ w"`sD$tmD$t]+t$ q8qPQhRXq8qPQhR.-mq8qPQhR ^_[]ÐS[ t$t$jt$ [ÐS[î jt$jt$[ÐS[~ jt$t$t$[fffffUSWV[K M |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉM uj(ƉDl$Utwn$Nj 0Q 1M utjh=@ʼnM 0ƃM LtMjуM @1t*n$FUQj P|$z^_[]ËM )USWV[ M |$i)Njtt+~%L$9N$ut1Ƀ|$tΉM uj(mƉDl$Uȡtwn$Nj 0Q謨 1M utjhʼnM 0ƃM LġtMjуM @1t*n$FUQj Pq|$z^_[]ËM )USWVP[j l$UHNjM $tOs;1҉vM ljh=M $uƃM D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0M tuR:t!jуM tiE$SM uj(ŋ$,tIEj |$WPQ W̡tE@E$L$1E^_[]t$̡t@ϐUSWVP[zl$UXNjM $tOs;1҉vM ljhM $uƃM D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$ t0M tuR:ġt!jуM tiE$SM uj(ŋ$,tIEj |$WPa WСtE@E$L$1E^_[]t$Сt@ϐUSWV[Ët$|$ ԡtЋM t61=tDtPǃM D$L$ƃM M t?1=tDtPhǃM D$L$ƃM ǃM ԡ̡D$ 1^_[]ÐUSWV[{t$|$ ءtЋM t61tDtPǃM D$L$ƃM M t?1tDtPXǃM D$L$ƃM ǃM ġءСD$ ȡ1^_[]ffffffUSWV[e$tA$1uhFƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[ët$tD$tdPV$xaa1ɐ΍,?UQ^t&UP#y.w8"tV 1^_[]ffffUSWV[ t$VM PM ƃM ` tj~V:u^tVtDi@u\uRDQ@u말:u~u'M t PǃM ǃM 1 ^_[]ÐUSWV[|$t$L$W91:u?8u(t$Ր}^8uuu@tp:ute:u^wUwvPQhR"_"wwvPQhR81~@t^_[]ÐUSWVP[|$t$u"wU.wvPQhRl$ tt=jUjWV^_[]Í7w.wvPQhROuÍN.wvPQhR)럐USWVP[#$LL$8u""w0wvPQhR$du"w0wvPQhR$lu)7w0wvPQh Rx$|$pu)N0wvPQh RD$ t$ l$4$h\$M $lu)NHwvPQhR$|t$tx8t$tD:;|29v&t:t|u싌$lhw$ $L$1xjjjUPt$ewPQh|$XWjjjh@W3jh@uu D$jl$|$(1ɍl$L1$D$D$L$$AD$ ЉL$L9rT19r=|$T$\$hQl$ U9u ƅ,4LT$|$< u|$$tT$ $1s$#gT$$lu-\$NHwvPQhR$|$tX8t(a:X|O;$v<t:t|u싌$l듋$$$L$$t1<9< t+< t'#<:t <\ut111D$9;|$L$$T$ $)\$PL$QT$+$‰$L$$|$|$t UtD$$t$t|$(G 4$T$\$t$ |$(l$ܡ$ppD$L$,4$|$(D$$l$T$<:u>tuk{D$؊6U8u Xuuu@}=uUt @fƀ:t FuFT$L\$t$$Ut$ t$4 \$,L$Lt&u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:D$\$L$ щD$)9L$ |KT$<,$D$)\$D$PUu))\$)D$Ɖ$T$<*)׉ڋ\$QVPz Wt$DUl t$ t$,4/L$,\$t$ l$T$|$t Uq<$ЋL$49T$v)RWuWJL$81Ƀ|$D$|$uD04$ 20M Pht$ t:M PD$M $D$D$ V4$$lu)NwvPQhR$|D$,P赑l$,t$ \$D$0jD$HPUWW t$t&t$D<u/t$,D$Ht$ Ľ\$WW<D$\$V;D$hU9t_UVPZ~ WWxz1ɊD$D$4T$D$8(D\$4$w |$\t$oKWWy t$ ;$Lu|ȁP^_[]M0Uǃ|$\$t t$oo4$t$ 믋\$U|$t\$t$8o\$t$,b.XL$ܡÐSWV[t$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍwUHwvPQhRE}NHwvPQhRVSWV[|$t$tGtiM tPǃM ǃM ƃM ƃM WV^_[ÍwUSwvPQhRu7wSwvPQhRipS[nM tPǃM ǃM ƃM ƃM 1[ÐUSWV[$,E$$$(M uM ȋM u!.Q0M 7M t%1M M PQ0t $D$uz1M VVǃM M HM @.QPM u"wwvPQhRƿdD$M]h\M:ȉʀ0E€0 ȃE€0 ȃ0^u&M: tz:tuS|$)Fd$PWK*у¾2w2$:밃뫃릱뢱 랱 뚱 떱 뒉l$)u! +F$PUtL$($WUJ ^_[]ÐUSWV[Øt$ l$ B|$$d\$~E<:uM8u*t&M8uuu@=uE<@D$\$jdݶJƃdNJD$\$E<:u)FdPWm?ƹd뽍wUwvPQh"R."wwvPQh#R|$$LwvPQh$RzwUwvPQhRX"wwvPQhR1)nu5 Q\$UW\t2L$$:\$qwwvPQh`R\$W^_[]ÐUSWV[l$t$u"wUwvPQhqR|$MtAp:uu8ut݉ː3V8uău뻀@0#uN@0F ] ~(FF8hWvPD>8/>9v$uP FN8D} .~ wF F PKBuWv ^ tŃ~?:}|@uH)ƒVԍuZF F BBQWPB uvv A^ ?~?:uF=~t   8u F,;8u e^_[].rS[0t$t$ [ffUSWV [} F FEFUVzRu)ʃԉF:FJFx9u0Ru ] N ;Nue^_[]CqfUSWV0[#D$(}< PQeM t$M L$ML$f|$ L$T$|$QRj WPW2uOt$ rF|$j WP u0O L$FD$D$ PjL$Qb 79_t$} urQ tgM9uWM % +x@QPR}Wu19r"y";L$(M jjP@ PID$t$L$ WIt^fxHuHPQ$3U q 3u uًI3Muˋpjt$Vp uEPVu} ;EsD$t$WHL$%D$"T$ ;UwRPu薜 1ɋt$;D$(u ȍe^_[]nS[þxjP+M uh P+>Q [SV[}M hVt$t$t$%t1^[fffSV0[:t$DD$@t2D$D$ D$HL$ $@D$1L$t .$ tEt@u%&{{LyPQjJR苔E@NT$RQjjjuЃ>T$u-{{zPQj[RDT$,$ t|$ tEtHHu0j{Q{׍LyPQhR|$0EHHPVt$0t$0WRUуt 菙0$^_[]ÐS[þpPt$t$t$t$t$c[ÐUSWVP[zl$t$D$ $ t t@8u'{{LyPQhR@8QUVwЃt ǘ0$^_[]ÐUSWVP[l$t$p$ t t@8u'{{LyPQhR腒@8QUVwЃt 50$^_[]ffffUSWV[[t$l$蓖3PQW躽 t"t$ VW :WjjPjUϩ6PQWz t$nfffffffS[δjt$t$t$p-[fffffUSWV[Øl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]>CUSWV8$[$L$4u"U|I||PQhR輐$PD$u,$Pt"d|I||PQhR聐t$$Xu"|I||PQhRQ$Pt$Pr 9FjPD$tk|$jW̉D$(D$ tND$1ɅujW襉t3L$$\$T@u%t11|$l$r1҉D$L$ |$41 tw|$tE9sP r L$4QPUWGx9!xt19)u|$T$$l$);$Pw|$$Xt$,VMD$jP臈tT$1 T$|$$T@uW$L$,Pt$ QW:t4W薤$t 8D$1D$(vt$,L$ɸttQȃ1Ƀr8T$1ɐ44t tt tt t 9uӅt!1ɐ449uD$l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@L$T$ t$ t$ t$ t$ t$ [ÐUSWV[L$(T$ 7t$T$L$xD$L$11jUt$,jPxD$Ƌ;D$u ^_[]7USWV[xD$(L$,T$$>|$T$L$xl$L$T$ jWPjU1xL$ȋ;L$u^_[]7USWV[|$t$t VC1xL$1jUWPV^_[]ÐUSWV[ë|$ t$t VC1xL$T$jUWPVN^_[]ÐUSWV[[|$t$t W8C1x1jUt$$PW^_[]ÐS[xL$1jPt$t$t$[ÐS[ΦxL$T$ jPt$ t$ t$ [ÐS[ÎxL$T$ t$Pt$ t$ t$ ?[ÐSWV[L|$t$WuGكs^_[!t_t$t%<FF ^_[ÐUSWV[˥|$ u ^_[]l$ t$W8t t- t(W!tXWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@{D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVݕt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ聕$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/`DPg%0W$\P$D$4@uW芔u#`DxuGws>4$$^_[]ËD$4  !rfUS [աE$D$D$D$PQD$e[]fffffS[Ît$ t$ [ÐUSWV[U$$%= uRl$2|4$&nƅt1~(Pw,to‰4$D$4D$t$@(ueO@4u\D$0D$(D$D$$31fGHrG D$4l$L$ $Љj0 t9D$"D$ <u rG OJrD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDRb)l$ǃt$<)l$ D$8D$D$14$D$Lt$)DžN( u" .uGt<.utʐL$tXw P[ōG UTD$t1 .YMPNQPT$ RK u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRe4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$Xl1+]}|PQh1R\fD$u‹.l1F)EHftf },$FtpPfu|$t$u N)$xDuW@8/tOF(uIjh@P tFFU $U<$u~ljF^_[]FUSWV[kt$u}}}PQjBR,eH}t v$e>VD }t!v$Cv$8v$~eVueW^_[]fS [ˇpPQt$ t$ ,$ [ÐS [Ët$Pt$ t$ l ,$ [ÐS[^L$T$ pP[ÐUSWV ׉[$T$4tb=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWVs=uDi"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[L$T$ t$[ffffff̀rS[ԅ|[̀rS[ô|[ ̀rS[Ô|[SWV[||$t$u&~}PQj*R9b9tt F9u1^_[ffffSWV[|$t$tt1WVY^_[Íne~-~PQjBRauύne~-~PQjCRa뮐SWV[Ü|$t$tt1WV*Y^_[Íne~-~PQjBRGauύne~-~PQjCR$afffffffS[L$T$ pPt$ [ÐUSWV(T$[ɉ\$u'Tp~2T\$PQj?R`\$t$@|$ |$<t9D$<|$ "v)Df1t$\$VP-U\$ u+t-t D$ 1D$t$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[äx|[USWVXXx$l$x|$lu"$MPQjwR?UL$ttwF$Z$؟MPQjxRT$vl$p1 D$͉L$4A$PDD$(u'$؟icMPQh"RTT$tЃD$|u,$؟MPQhoR;T$؃D$ JL$l$ |$lT$tL$l$ щˉL$9D$ ;\$lL$xvߍ4$WVуD$ ~L$tt>1ҋt$D L9u׍*t$t)փ|$r؉΃|$r1Ґ ,, LllLLllLLllL9u4 t$4l$(.Mu$icMPQh#VR`PQhnV$R$3ȉƅu4$؟L$MPQhoRXRL$ $D$,l$ /؃L$JL$݉D$ \$$!D$T$tl$  *ωL$9w"ސD$ ŋ|$9ߋt$xvD$$WP֋T$\$,D$ ~L$ttE1ҋt$D L9u׍*t$t)փ|$rЉ΃|$q1Ґ ,, LllLLllLLllL9uD$4|$( l$ /L$<|$l$PWփ8t$,ىL$0D$T$tRD$8L$(L$\$|$$D)L$(D$L$T$tD$4L$(t$,t$|$$9.9D$ NjD$84(L$$VW$L$8(L$D$,;|$$rÃ|$ T$tL$(\$t$,D$4;l$ XD$<.+|$lσ|$8D$tt71ҐEL5MD59u.)֋L$(|$re *փ|$rW1ҐL,l LllLLllLLllL9uՋL$(l$ T$tD$4t$, L$t$ 9D$ |$t$ D$|$l\$t>D$ L$ ȃL$t U0uuD$0L$t9rދl$ ;l$$D$ $UP$\$L$<D$D$ |$t$,9W<$VW$L$0Ȩuˉ+D$lD$(T$\$0tL$tU7uuߋL$t9rk|$l T$tD$4L$(4ȃ90rt$<T$HD$ ‰$D$4|$L9|$lΉx9։|$LtՉЉ|$D͉L$(t$@D$P&D$DBD$DD$PՋT$T9tl$$ŋ)4t$9t0t$T+t$@1D$09l$$;l$Y9Qt$$VU$\$t$~ \$0l$1҈ډT$|$ T$t\$ 9؉t$8L$l$$$Pt$ D$4$T$|;D$~9L$,i\$ 9L$$Pt$ D$4$T$|;D$9D$t$w>t$,T$tt$9v(t$$Vt$ $;D$~ЋT$t9w؋L$,l$$96$Qt$ L$ $;D$*T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ $Qt$ L$ $;D$T$tL$;L$ sj$Qt$ L$ $;D$~bT$tL$;L$ s>$L$Qt$ $;D$~6T$tL$\$ D$ D$9l$^D$T$tL$9l$B|$tY9r1ɉl$H9u)ω9r1L 9u:D$ l$$49v$L$$Vt$ $;D$~ T$t\$ D$T$tбL$9v\l$$T$tl$$9v?\$ )1$Ut$ $;D$~T$tl$$\$ 뺉ًt$89l$|$tIE9rl$Ht`1ɐ9u)DE9r1  9uNjT$0Ѓ|$<T$0NONONONONONONOu]Ѓ|$<T$0rPMMOMOMOMOMOMOMOuD$L$L$ 99s9t$T$0d$Dt_|$L$(t$@t.9r9rL$(t$@|$\$t%E9rE9r|9u$t$4VW $QF1X^_[]ffffffUSWVP[:i|$H8tqw$XG$t,GO4$6tV1‹n1 uV ;Wuj5ƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW! u$N*jU!t@ PVW! 1G8t uGG $tD$ 81^_[]fff̀rS[Ôd|[ḃ̀rS[td|[SWV [Ydt$ |$uN,PQjD$(|$u#PQjAR]>D$(t%>񐐐9t uD$))t8t)Pt u+D$ P^_[]fffffSV[`L$D$T$ y9RVQPB6Q4P 1^[ÐS[~`D$y%9Q PQj@R;B Q j@4R Q [fUSWV[`t$|$unLPQj?R<l$tt41 |t$t$ t$ WW uD$ <=u.|$$  R 9ttD$0 R M9u;$R s|9v9tfP2ǃ R ǃ$R $jWP 7078uyPD$0t$ )$jWP 7078u4)  $PjQ3 $ R L$$R ^_[]ÐUSWV[ØT(R t(R 1t0DtPVt(R Hى|$jjD$P tE t5jVt$ F:(R tVt$Vk1ŋD$ R 9tPP1ǃ R ǃ$R $R UjP2 ^_[]ÐUSWV[{S81tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[R|$1|PWtfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[MR̢Pƅt40^[ÐSV[ R̢Pƅt40^[ÐSV[Q̢Pvƅth40^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[*QD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[PD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[HPD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[OL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[MT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$L$TÐUSWVH[å>E$DD$ChP[t]Ƅ$CBljPjx6T9PQWVD$SPM;$DuH^_[]aÐSWV[=t$|$ttAG$NPVQ ^_[ÍPQhRu"PQhRa뛐USWV[X=l$0t$,tt1}tW/PQhRuύA/PQhR}~$juuPo GtPKGUD$P% tEFEMN,$UD$PGONGF^_[]ÐUSWV@[3<Mq$F9AFD$D$,jvPWD$PWv1t_D$0jPD$0D$$D$jL$QPD$PD$P/tNjFMAVQ$D$Pt$VD$@t VЃ1e^_[]ÐSWV[<;t$u"NPQhMR~$wGt P}v$rFt PbVY^_[Ð+̀ffffj̀rS[ä:|[ÒrS[Ä:|[SWV[l:|$t$t{WVVt_GhPV` tIGPVt8G PVt'GQjjWPVnu1^_[Í"_PQjGRf_PQjHRBfffffffUSWVP[z9t$ D$8Vt$ 1;L$$wD$(q D$8 $t*twWt$T$4;4$sc|$(uVD$tcutZD$(PjNjD$8u{PQ1"D$8ut$6'^_[]ÐUSWV[{8|$t2t$l$VUT$,tt$ u1^_[]ffffffS[8t$ t$ [ÐUSWV[7$$$t$Mtd$)VD$D$l$PUVp D$$ht$jU?L$u$1ҸD$D$MEf}T$ twPUV* f}D$9 $D$PU$*p  $.|$D$D$L$PQ|$WRVy x4D$jPWt$V@ xD$$|$33Ƌ|$+͍D$jPt$t$$ y(;$u Ġ^_[]fffffffh̀rS[5|[WV^5D$L$|$T$ :trJJ B^_ÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ A ÐSWV[5t$|$O1)rD$OVw P/ w ^_[SWV[4t$|$O1)rD$OVPw  w ^_[ËL$A +AÐVL$Q qt$ Q1)| q Q^Ð1ÐÐ1|$uD$ L$IHÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ Q ÐVL$ T$r1)r rB J ^ÐSWV[|3|$t$t*tIWV:t\GhWPVF"PQjWRu#wPQjXR1^_[ÐSWV[2|$t$tt3jWVh ^_[Í"PQjgRu͍PQjhRr묐USWV[k2|$l$WU1GOhQPU豗o UPڕED$wPW"PQjwRW\VPQjxRs8"PQjWRL#wPQjXR%GPl$U菎tWU~^_[]ÐSWV[0|$t$t>t`WV躔t(truGPV.t WV[1Z"0PQhRx uD0PQhRR yWV0^_[ÐUSWV[;0|$t$tnu"]OPQhR WVgt3oUVƓt"}uG jQWPV"1^_[]Í"OPQhR ukSWV[|/|$t$tt?GG>tP1^_[Í"jPQhR u^jPQhR WVgtGPVƒtGPVEtG PV4kWV[USWV[Û.t$|$tmGou"PQhR* Ed^wPQh$R qwPQh%R Jo t6tXudGFGFPQh RZ uGFG3Fn<Fn* GFG F   ^_[]fS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffffìrS[4,|[v̀rS[,|[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[k+|$l$uGoބPQj:R(t$tu9#ބPQj;Ru7tiFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1USWV4[Å*$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋxl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF l$0PQjU!.UX$\9ȋ$QU$` FfN?QPR$`U$`-1Ʌ9$Fx$P$T)PURQw-*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L?QPR$`$`,l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$xaPQ|$W$`Uu+t;$Tg$P$T)D$D 1P|$Wt$L$QR"+L$)D$D Pt$t$t$R*L$)D$D Pt$t$t$R*L$)D$D Pt$t$t$Rw*L$r)D$hD Pt$t$t$R>*L$9)D$/DPt$t$t$R*L$)D$DPt$t$t$W)19D$F$PED$1$1xD$ 1D$aD$׋D$ tD$ $ 1QPt$t$UI)H)D$>Ń19t$un 1f$PL$$T)fv fD$ VQURt$(L$ ;$T$,T$0L$RQPW#t(8WĿ$\9vpD$0Pe;fǍ $0PQhWC(Wz$\9v QW$` %1QW$` D$0P(eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@r8ߋ\$<1PQhcRF H1 t1덉\$$\$$\$D$1\$Pal$D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj6D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$dJT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$#D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$N$l$$L$ L$덄$Pj?L$1;Bu>T$L$T$Btۋ$NF\$$T$jT$ ߋ\$IjjP x Pȍ~8L$$Pj`D$1tuyxj%$PD$8($'L$8$)L$D$D$P$t$W7$(t$DmD$tuD$uL$rL$$L$rI3|lj$$Pj$$WtGo\$tP؋\$$$!L$$$PRt$W6T$vu4D$ 8\$$ЋD$ D$87\$t$8MNDž}l$$D$ @xuD$ @Džu$PQhuR/D$88tqG4PQhRM4PQhR$%݇4PQhR\D$t$$t$,$t$t$Dž^ .;L$0NT$D$4t$D1|$4$D$@$!)D$ P|$ WQt$P[fD$>P[fD$>Pz[ f|$fD$L$f"D$<|$h$!VWt$@9rt$ 1)ƋD$ȃWVP^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [è|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWΨ ;D$uY ^_[]Í[g1ˉPQhR茦7g1ˉPQhRbuXffSP[]Pt$1Ƀ $ȃ[ÐUSWV$Y(t$8D$D$ L$`1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4R褄WjP耖 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$Ws Pt$l$ Urs t l$ /D$D$<F\$hPW&s |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR>rT$ \$WjRvT$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rq E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$wqT$ L$E E$\$l$TU//4$U$L$$9sD$DQ1ɉȃ0^_[]D$D\$蔓SV[=t$ u"|PQh/RV蓑^[ffffffUSWV|[j$-1tGljPW*yt)l$XD$\|+W.Q W.1|^_[]jjWjjUjWX.t҃OD$ l$<$D$ƅuUW뚐USWV [|$$(rl$ NBCD3EB 3M t處1 ^_[]Ë|$,j<Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rLVs@sщʉѺ u׋ $)jQWj3F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj2F4~F:F:t1F;pS[>t$t$[ÐD$@ ÐSWV[ T$|$9W v#wG,ʃt$<u0 Ћ0茒L  )r;GvQD$Ot$1^_[ÐUSWV[Xt$,~$ED$\$Pv(t$Q 9quJi$sD$;D$4$t$zD$<$7L$HL$D$ l$PD$$$˰$`$ttl$$;%`t %)l$ $D$D$]t$L D$06vt"l$ $D$D$`]t$L D$0ut"l$ $D$D$ ]t$L D$0ut"l$ $D$D$\t$L D$0vut"l$ $D$D$\t$L D$06ut"l$ $D$D$`\t$L D$0tt"l$ $D$D$ \t$L D$0tt"l$ $D$D$[t$L D$0vt$t"l$ $D$D$[`tL|$4t2|L$DL$ D$D$,$t(dƁ Ot yI uzD$4$D$4L$@L$ D$l$$$莭虅Ɓ Ot yI uzD$4$D$4L$ 63.=&R"M^_[ÐSWV[Ì|$uƁYjVW'u y WPV# ^_[ÐUSWV4[8$D$0D$IuD$HL$j.QPjyT$PQj.jRx$tEL$PQV"I D.0;D$0u 4^_[]"USWV([Øt$L$-uAD$QD$ +tD$ +u AD$Q`x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$`8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʋ$y&-֍PQhRbЃ^_[]ÐUSWV[s}fD$|$D$ D$P0JlHHPPD0ppp RQWjV͉$r D$ƀe^_[]USWVP[l$PU辁QPU要PU莁UPUvPU^ȋPUFaPU.ԒjPU$ 1uR`MDHt?fj PU蚖 f8u$8 L$A.&L$0t9^_[]ÐUSWVP[Zl$0LPUtxF u6njPU" 1u[`MDHtHej PU肕 e8u $8 6D$t8^_[]fffffffSWV[||$t$jWDGHO~;G~ t H WR9jWF^_[ÐSWV[ T$L$Bpr~ ;B~ t 2~: RQ؍^_[ÐSWV[ù|$(D$$u$PD$D$D$D$ jWCG0u ǀD$PW7jWE^_[ffSWV[,LaHt Jt @t A ?t/t5GtPWu001 E49s%sjQjhRE4M01U0)E41u gE _PQjdj$+W4Y9E47>PWu00 E49s)\$sjQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$sjQjhRE4M0QU0E4AD$`/}$D\$u M QU Qqu It$\$QRPVjdj$ +PW\$ 9E4<P$ +Pu0./ E49s%sjQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-s\$jQjhR\$E4M0QU0E4AD$#M }4E0T$WP=;E }4;E0 E4u)\$sjQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E _PL$ Qjdj$+WU9E4:PWu0W- E49s%sjQjhRE4M01U0)E41E HM @Pt$ jdj$+WcU9E4f:PWu0, E49s%sjQjhRE4M01U0)E41E E P E Pt$ jdj$+WT9E49PWu0S, E49s)\$sjQjhRE4M01U0)E41M AE  L$<%\$hL$ L$L$sL$*M01U0)E41E E |$\$7%Pt$jdj$+WS9E48ƃD$PWu0h+ E49s\$jt$jht$,D$(E4pE ;D$8}0L$T$T$ sL$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-s\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru CE _PQjdj$+WR9E47PWu0) E49s)\$sjQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$]VPjdj$+WEQ9E4H6PWu0( E49s)\$sjQjhRE4M01U0)E41|$\$E hL$ L$L$sL$*M01U0)E41E E D$\$O\$Pt$jdj$+WeP\$9E4d5PWu0' E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E ٕPQjdj$+WO9E44PWu0' E49s)\$sjQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0 E49s)\$sjQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-s\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$sjQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$PQjdj$+P;F9E4:+Ƌ\$P$ +Pu0 E49s)\$sjQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$L$ s\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$BD$Q|$XWu u$E? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ L$sL$$+р਀tsRPt$ jdjVdD9E4g)PQu0 E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$|$X\$PVQj2jWC\$9E4(PWu0  E49s%sjQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$sjQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$sjQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$sjQjhRE4M0QU0E4AE MU \$VWu,P}$E _PL$ Qjdj$+W}A9E4&PWu0 E49s%sjQjhRE4M01U0)E41E HM @Pt$ jdj$+WA9E4&PWu0y E49s)\$sjQjhRE4M01U0)E41E E ;D$%L$hT$T$ T$sL$%M01U0)E41E E ;D$@%\$Pt$ jdj$+W!@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-s\$jQjhR\$E4M0QU0E4Au wE P2PL$ Qjdj$+W*?9E4-$PWu0 E49s%sjQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0 E49s%sjQjhRE4M01U0)E41u RE E P=E E P(E PWVQjdj$ +P=}$u E E PE E PE T$XPWVQj2jR=9E4"PWu0 E49s%sjQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W9E4!PWu0j E49s)\$sjQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0  E49d\$sjQjhRE461D$E4D$W\$pL$D$L$L$sL$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$\$9E4Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0  E491\$jt$ jht$(D$(E4  pL$D$L$L$sL$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$N\$9E4mPt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0v  E49-\$jt$ jht$(D$(E4\$I/}4E0)E4u)\$sjQjhRE4M0QU0E4AC}$n }$b_PL$ Qjdj$+W 19E4PWu0 E49s%sjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s%sjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s)\$sjQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$sjQjhRE4M0QU0E4A 8g}4+E0-E4u)\$sjQjhRE4M0QU0E4A}3}4E0 E4u)\$sjQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7$+t$$ +f@======2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$pL$D$L$L$sD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$ \$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu01 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$\$jPjdj$+P(\$9E4 P$ +P|$ \$ D$pD$D$D$L$L$sD$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$*9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0V E495\$jt$ jht$(D$(E4|$ D$f E4w)\$sjQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u E M4 U0B  ru0M4B\$QVPb"  ƋM49s)\$sjQjhRE4M0L$M0)D$E4z|$)D$L$L$ s\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P袨PQjdj$+W6%9E49 PWu0 E49s)\$sjQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj}0WcƋE49s,\$sjQjhRE4}0}0)E4E \$u4u0Pj薇}0WƋE49s,\$sjQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$sjQjhRE4M0QU0E4AD$w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$pD$D$D$L$L$sD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0s E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$sjQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u uE M4MU0B  ru0M4B\$QVP (ƋM49s)\$sjQjhRE4M0L$M0)D$E4|$t)D$L$L$ s\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$sjQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u ȮE M4U0B  ru0M4B\$QVP  {ƋM49s)\$sjQjhRE4M0L$M0)D$E4|$)D$L$L$ s\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$sjQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u E M4U0B  ru0M4B\$QVP[ ƋE49s)\$sjQjhRE4M0M0)E4sf )E4w)\$sjQjhRE4M0QU0E4AE4D$E0D$|$)D$L$L$ s\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$sjQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$D$,;$p+u ȍe^_[]Ë\$USWV [È5t$,|$(D$ .ʋ7l$Ut$Vt$40RQ‹L$$7>tVt2$QW)$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sGD$D$s@(D$ 9s$sjQjhR)))y"֖ΖsPQhR ^_[]1))lj$USWV Չ $[3T$8D$4 D$L$D$"u$sjQjhR|$4QA$93<$779$xʖD$D$D$ sD$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$sjQjhRMQUA+<$-ynD$4L$D$ ^_[]ffffY1T$4D$#ѠѤÐUSWV[K1|$ l$t$~Jt$~2UVAx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[ú0|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }(^_[]E ffGftC,$RW'xǃ9w,$)xD$ hHGftf,$RWՠf 8 9Xσ95,$)5|$ oGwtc,$RWc 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [8.|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.a ^_[]Ð~34$U蟞x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0QuuÝ]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[è+|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$. ^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v k (+l$xD$$h,h,L$ H(ŋT$0PhRQuu۩U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0] (LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X)\$1ɐ\ \\ \\ \\ 9u΅t1Ґ9uT$r;t$@L$\$Љ\$0 $ L$L$L$|$ |$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄S|$ t;|$$sF* $D$  8t(y"rgPQhZR^_[]ÍgPQhR`|$ L0N xN|$|$4~D$ `D$lj<wsGuL1Fщ$T$T$$l$TUT$t& $LQщ$T$,$TjT$$D$1պ r $?TWT$T$Dz$ʍF$и rL$ʋD$T$ <$tpD$ЉT$ ;T$4OXǗPQj>R[ǗPQj?R7D$ ^_[]ÉUSWVP[ê t$ 6ǃ|$uǗPQjgRaD$u f0x=|V4$~b1 9tJ|$,00r7 $ r7zB؃u9}B.벉$^_[]fX,t ÐS[î,t ht$ P> [ffffÐ1ÐX_u ffffffUSWVX[8l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn=L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ =T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ =|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p` txҋ9|Wy>TWPڋD$+D$py8ffffUSWV[l$Uƃ;D$v(`|$UW[1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[u$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]ffSVP[L$t$D$T$ $xRQVPAx9rRQP艩 ^[USWV[Ë|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[ |$t$l$tt$$PW%t^_[]VW t W LJWVUF ͐SWV[Ìt$|$jW1Ƀ PVW ^_[ÐUSWV[K|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[t$t5|$r#u#jV#tjV$F1?^_[S[nD$tL$ ttu H1[[ÐSWV[t$t_|$G?wSD>1RjV"t3jVU# tۃtjV"t jV/#e^_[ÐSWV[Ìt$tAjVq"t2|$jV"wsf~ 1^_[ffS[L$T$ pP[ÐUSWVT$0L$@[uD$\VD$ P譲ǃ\$D$t6袖=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$L$D$@$<$D$D$D$\$$|$,Vt$8PQRWiǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\z$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$ƥt$,PVD D$,\$wPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$   >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[<D$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[Ít$ >t0Vs 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[D$ L$t9u[Í|>PQjpRS[~D$ #L$t9u[Í|>PQjpRtD$t&L$tu1u 1tÐS[L$ D$Qss)ǀ[Ãuu ǀ[Í|>PQjpRS[~D$tL$ t 1[[ffUSWV[;j 71tQ@@jjPf (8t(Wn(^_[]ÐSWVP[û|$uPQjZR|OGQ9u0$jQP)f 08t  G $GT$pw1^_[ÐSWV[t$tRtC|$t3~t-0~r4g;~rPTVK^_[ÐUSWVP[êt$u"PQhRhF$t(.1tt$Vt 9<$u1^_[]ÐUSWVP[*T$J $Ћ*1|t$Wt94$u|$ l$tWYE$F;$} $)Qtu<|uprP $كU|jVæjjV f jV跨^[ÐS[D$ t$QPt$3[fffUSWV[|$$Ƌ|$u"Nh/PQhRD$F t2t$$t$$t$$PV_ŋD$t V4t$$t$$t$$PV-V 1^_[]ÐUSWV,[$HD$$(u&N(Ս/PQhBR蹿$Pt t$;$Lvt$;$L$DT$ Ph j.W9l$u D$(hPW$LWtNj$L`0<$DFŨtV$tCu<.uA$t)DNu.t"/1x.u<:t*uj:t$y$Tu<:uV$tC$u.lNu:t.uuـx.$P$DD$D$D$T$ L$$<$W}l?t$ PWQRVUD$4P/z 1t$$P$D$P|$,$֋$DL$HA$Hу$P$DBT$B D$$HB)r[t$t$VUt$o# ~n$DA0A@$H$HU{T$)‹$Ps<1t$;$(uq,^_[]Ë$PՉT$PUVM $D7$H$@@ tt$$HV $P_nSWV[<|$$Xt/ƋT$L$Wt$$t$$t$$PV|1^_[ÐUSWV[l$8|$0u"ax/PQhR蒻L$4uRuM?u!Wր1?u5u/ -t/9uqD$DT$@t$vy uy P"<t&D$j.PWV$"tl$t $y D$PUuL$QRPD$PWU< $t!Q辶l$|$TG )|$TW4$芶l$tNjM;L$4/\$PQhR]$PT$$L$Du1M4/\$PQhRT$$Ttt1 B t$L։j( ‹$P\$,sfKfD$C l$9[fQ$|$\$$T$TPt$ t$<.BNj$Hfxx\$$PT$PD$,D$;D$|$$$DD$+D$$$Ptȋ$@$Du7\$QlT$=$L$P)D$$LQ$t$ l$D$9r\$VpDfD$BFP_DǍFPQD΃ 931fT$Bf"D$+<|$l$H\$h$+Pt$Wt$uYt$Dc=9ƋD$L$0)9%\$Qt$HPe D$$LΉD$ꋄ$H@ tՍT$\$t$0D$D$l$ )ՃL$0)9sыt$FF\$URP趃 V茤l$l$$T$<)ƒ\$0)19s>QZ聩1$X;$(uH,^_[]Ë$LiRPU/ 1ɋ$L뽉&F|$;\$_U蚥USWVT[5$h>L$u&ψՍ/PQh^RWt1T$ T$G j(ʒ¸RD$D$ D$$D$D$1ɉ|$ D$ L$Pt$ Vaǃt$Vt$  t5ꐐ< t쐐D$D$ t$h < t< t򍃑PW5at1ɀ8 L$ D$1ɉL$L$ t WPYtT$$9s9ȉ86(Pt$T$$k D$ + $$ȍQ8D$H|$|$ D$Ɛ wXL$ $l$9r4T$(PL$Qڛs l$T$+$‰$2t$ V`AƃL$sD$!D$$D$#D$ #$hL$$h|$ ?$nL$<)N)‹D$ L$HJL$)T$L$ωx|$t$tjD$B 19wz $PQW~ L$ A<0A )Ń9t$uыT$ B#P3bL$$h|$ :ȋL$D$Pn^ƃ)s4$h$PF 1T^_[]ËD$D$Vt$ W~ D$ 8|$tsD$D$wD$1ɐ$L$D$P]ƃ)ZVt$Wa~ D$ @L$<9L$ut$ FL$4$ 8$h$hL$USWV [Ht$(|$ u"/PQh R.vy uy Pn#y t$t$U\L$QRPUVW# $tQ-|$ G .T$|$ W74$uǸ ^_[]ÐUSWV[;t$|$l$4y y Ph@QRUWV#^_[]ÐSV[t$ 4y y Ph@QRV^[ÐUSWV[ë{4Ģt6ƋT$L$y y Wh@PUVLV1^_[]ÐSWV[< u P tXǃy ǃy ǃy ǃy ǃy y 3y Ph@QWV^_[31퐐USWV։[Ôtt<|$0t^^M/PQh`R<učiM/PQhaR|$0uM/PQhbR! GG ?.D$ uD$/$D$t$JD$FFD$F t$..L$0))9|h)ƃ1t u/t$ t$hMt$ D$ D$ gt$t$hNt$ ϙE^_[]fffUSWV4[øl$PD$0|$LuʜPQjIRjt$Ht*tIL$L;L$0ʜPQjJRut$Lu"PQhR|$u"PQhRD$,D$(D$$D$ 1ɄE<:u~:7t$LL$ $t$ ~D$ L$L$1D$jD$Pt$$V,x ujt$t$ Vx t*Yt$) Ɖt$u1ɀ|$:/tA?z$L$09ȹcT$f $f1$|$ D$1|$ |$$D$t$;/t$$p1ɍD$09L$f$f4$|$D$09tu+D$T$ҹt:lj1ҐD/DD.D9u߹)щtR)ȋt$NJT$ )ʈB>81X|$.uQ$rD$09wCL$ V1ɅL.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0u ȃ4^_[]QHUSWV։[4_~`LZu 1^_[]É4$t$0t$u'_ t E<)׋$$x`<$1L$D$ D$}T$uUm$T$E ulD$;tM 貑E=t܉t$L$0QP=tt$ T$ u#D$8=u$ELM D$|$uIt$MtȍL$0QPsL$t$6$D$$ʉD$|$ T$,t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$$D$ u?tUPuTE)΋M0E0D$D$ L$$tCE<)‰T$Ή4$MuT$$M8t$ ))ʉT$M< $+4$T$uED$ ))t$$M $D$ E L$,T$+T$T$($2T$9T$}oD$ L$(ȉE)΋L$$T$ y*PPQhR։D$uE@9tRTD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQD$e ߋD$)D$U讋u E;D$U4htjUpĬ^_[]Wt$t$$uT$ !ƒtˋE0tU@9t QcE0EEEe jU=p1뙋t$u)y'PPQhRlE)EfffffffUSWV [Xt$@|$4\$u->FD$FD$jt$8m1D$ D$t$<\$tj D$Pt$< ŅD$\$1Ʌtr|$~l\$ +tX9\$8utAp9r:1Ґ8uʃ9s뾐u.1%)D$ L$ÊD$t$t@uHFWVP="žQPQhRu뙸FWV1^_[ÐSWV[|$t$tCu"؞̞QPQhR袀t>t@uHFWVP="̞QPQhRcu뙸FWV1^_[ÐUSWVP[J|$l$tRu"QPQhREt`tBuU$EQUPA"QPQhRu늋EQUt$1^_[]ÐUSWVP[Ê|$l$tRu"QPQh&R@Et`tBuU$EQUPA"QPQh%R~u늋EQUt$1^_[]ÐUSWVP[ʡ|$l$tSu"+QPQhFR~EtctCuX$EQUPC"QPQhER1~u뉋EQUt $f1^_[]ÐUSWVP[ |$l$tSu"*QPQheR}EtctCuX$EQUPC"QPQhdRq}u뉋EQUt $f1^_[]ÐUSWVP[J|$l$tSu"T6QPQhR}EtctCuX$EQUPC"6QPQhR|u뉋EQUt $f1^_[]ÐUSWVP[Ê|$l$tSu"RCQPQhR@|EtctCuX$EQUPC"CQPQhR{u뉋EQUt $f1^_[]ÐUSWVP[ʞt$|$txu"-qdQPQhR{u&"͍QPQhRU{tJt]uaGQWtQ $C"dQPQhR {ua $G͉QWPt 1^_[]ÐUSWVP[ڝt$|$txu"-qnQPQhRzu&"͍QPQhReztJt]uaGQWtQ $C"nQPQhRzua $G͉QWPt 1^_[]ÐUSWVP[|$l$tXu"z^zQPQhRyEtltHua1?$EQUPG"zQPQhRLyu넋EQUt 1<$1^_[]ÐUSWVP[|$l$tRu"QPQh RxEt`tBuU$EQUPA"QPQhRxu늋EQUt$1^_[]ÐUSWV[[|$T$u&"֍QPQh*RxL$u*-qՍQPQh0RwL$(t )ŋt1tXuQBWQRP t?t=G UQWP%BWQRP ttG0UQWP 1^_[]ÐUSWV [Xt$$l$ u""QPQh^Rw|$(tTtv6EEEL$QU/D$QPQh_RvuQPQh`Rnvc"QPQhRGvKQPQhRv$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$Uj ǀ|$tB}um먐SWV[<|$t$tt4WV^_[Í"]QPQhRlu̍9]QPQhRl먐SWV[ü|$t$tt4WVJ^_[Í"mQPQhRdlu̍8mQPQhR>lffffSV[=t$t$Vt$t$t$~>.u^[ÐS[t$t$t$t$t$J[ÐSV[͎t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[ît$ t$ [ÐS[ÎD$t$ P[ÐS[^t$[ÐS[>t$Z[ffY ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXx$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$YPQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$4w;t$b\Gn߃^rxo;l$1\,, $* wkdT$Ɖ*t$i $* wi (Ћ4$ Wm;|$Yȃ|$ U(!Ћ$YPQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$i(^_[]Ë$iᐐS[jt$t$t$[ÐUSWV([؆|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ B_0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[NuL$T$ pPt$ [ÐUSWVT$[uɉ$u&T`$PQj?RQ\$t$4|$ |$0t;D$0|$ "v+vW1T$$VP^Fu+t-u#D$D$t$0tDD$t$0u20u- ǃ ǃ $0>$ t $@ D$ ) D$DD$D$\$t$D$q P$j V8[$9jS9uBD$\$,t$D$q P$j VZ$99u$@L$ \$ف@t$DPQ$j VjZ$99urD$\$,t$D$qP$j VY$91#9u$H*R )tȋL$ \$ف,t$DPQ$j VzY$99u$@L$ \$فt$DPQ$j V Y$9<#9u$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$t$.RPQjVW$99u$9 9$Htȋ\$zt$DPQ$j VWW$9s9ub\$>L$$$Wt$ $ƒ(\$zt$D$qP$j VV$99uD$DD$D$DL$\$$PWt$ $8‹L$Dtȋ$;d$V$$xQkd)Ѝ4 kd(d6$z D$D ljNj\$Pt$6!ƒ $\$މǍD$DP!ƒ)tL$D8$9O 39u"$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$PQ\$щkd)Ët$ Qkd)i{kd)Ɖfd\$L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$t$DRP$j VR$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $t$DRP$j VR $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $|$DRP$j WP $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$t$DRP$j V?P$9qc9uRHx1t$DQP$j VO$99u $L$ 1t$DQP$j VO$99u $\$1ƍ|$DVP$j W$O$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7f85\$]\$$,L$ $<$ \$t9u4$<$Ήƺųʉ kdk<)΍\$TVP$j t$TVM$$99u<$D$ ;D$pu t^_[]Ë\$IUSWV [(Ht$ X$Pb8*D$D$l$$pt$׋T$(PVUWt$<t9tk*L$)\*T O*"1$P> ^_[]ÐUSWV [hGt$ X$P 8)D$D$l$$D$T$(t$0PUVt$<t9t)L$))T )"1$P ^_[]fffUSWV[èFL$A~?\$T$ $uD11$\$t9hF9u9lFdVu )1^_[]ÉÃ|F11 9tu9u EdVu9u܋EdVUSWV[ED$H~>\$T$  $uFø1$t;hF9u;dF\$uO(^_[]ÃÍxF1 9tn9uF.9uFߐSV[-EV1 V^[USWV [Dt ɉ$tEW1=$L$x ~7$| $WPX$uD$x uhZƋ$t tDytxf|$~| hWP{N t thpǃ< %V҉t$>.hFs/.lFƁdV$t">-00t!t$t.J"1ɋD$+(dF$< >-00uʅV~{<1\FOs*7ƁdV$t&>-00t!t$t,J1+O< >-00uѻ@ D$x ^_[]ÐS[ÞBysP[|SV[mBVysPg=V^[ÐSWV[,BhZ%ƅt#T$#tV$81^_[ÐUSWVP[At@Հ:jt;ǀ}:ju1ɉjDžF $1퐐9}x.dVPNŃ=~߿TFFF fFdždFƆhFdžlFfdžpFdždVUTC><$~81퍻z 9,$t".dVjEPW uƄ.dV_1^_[]ÐS[Î@t$ [ÐS[n@t$jt$t$[ÐUSWV8^3@M y|$,\$(Utlzt$ \$tBD$J9ÉL$ȋL$|zBtvL9\ }jJBD$9ˉD$|$L$=)؋L$C1҉up S,1҃lp dVH(NtmL$;JJ|X1Ƀ|I9}%4}t$;tt}؉9|ۃU >׋2dFL$(\$ uW+7hFH 7lFdVP(}uMdF1+< [֋R+D Lt$ jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹\$΁€Y`;|$|$|ЉD$ L$$;D$|URut]9D U}\$ _ 1{pH(nD$ \$ uuPR3tPL$;NL$NH}+L$T$1ֺHtt$΋|$׉11pu‰Ѝe^_[]SWV[ =t$W豾ysPD PjVt Wx^_[ÐUSWV[Û<t$l$W<ysPcUjVt W ^_[]ÐUSWV[+<|$t$U̽| uLhZ p t*Ǎlj tjƃ| |$Un1Wp [(tp tdVpH(^_[]ÐSV[m;t$L$t$p (t)p t dVu pthH(^[ÐS[;D Pt$ [ÐUSWV[:l$|$V|| uLhZp t*ōlj tjbƃ| l$VD Pp 't)p t dVu pthH(^_[]USWV[ :l$|$V謻| uLhZp t*ōlj tjƃ| l$VNt$p 8&t)p t dVu pthH(^_[]ÐUSWV[;9t$D$t jPyU˺| uHhZp t*Ǎlj tjƃ| Uqjp ^_[]ÐUSWV[Ë8t$U0ysPWt t jPsU| uHhZ2p t*ǍljFtjƃ| U蠹jp 8ƉU{^_[]ÐS[Þ7L$ D$tA QP9[ÐS[n7D$t@ P[ÐUSWV[;7t$tF |$UѸ| uLhZ p t*Ǎljtjƃ| |$UsWp ^_[]ÐUSWV([Å6D$ $$AΉT$y |F D$ D$l$jP$HP$HW *|$t ֋|$ ωjD$P$HV)ʼnր|$t |$ |$O $<G~΍$$PjQ GL$>D$Hm~{ р$u7lF7dV-00tƄ$T$L$T$뮽8D$ ;$$R(^_[]Ã|$1L$D$;D$D$D$$<hFT$9ʉudFD$1t$9|$tT<$hF9tT$dFT$+1F T$jD$P$HPU(|$uqT$jD$P$H$H'|$uGD$$<dFL$ +t$1Ƀ~ N DTʼn֋|$ SWV,[É3|$<$GD$GD$G D$ GD$GD$G D$ G$D$$D$jP|$x ,^_[ÐSWVT$D$t$>O<4lX~;F~^|1ɉ)^_[ÐUSWVP[ú2$P`x uysP~l$|$t tABR lX~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lX鐐~;YQq|1L$4$lX됐~;Cs{|61\$()l$$9}aD$L$ 4$lX1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lXL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[;0Ux uysP,|$t$t tWVP ƉU蛱^_[]ÐUSWV`׉[ô/h/tfGt>:t!>/u(8y o>:u߃>/VTD$?=/9 Enfo/E oneiEre/zE/shaE/usrEh/VP\9 j.V j.Pt49tx/ux.uHt/uщjV:jVШhUPw +"yAL$VuhD$0VcHE,D$8E-D$XlFD$TdVD$@lXD$2T$t$ r$t$\Ƌt$,t$ D$ ‹T$ v A,9D$0D$( D$tIL$8 $t$$)ЋL$0h/L$4QRUl6|$' D$,t9D$4t9yD$ $Ppx \$1D$XT$1t$884$D$L\T$փL$9l$ D$4$u0v J ryrjɉv J r J r J y Ë4$F 4$D$Ƅ(>t5t T9Ή9ED$Ƅ(>1|$ \$l$~{9T$ |$$>̀<t $> $OL$ mw9}+L$ U91t$81|$ t$ l$$G|$ D$Tʃ~ ׉v zy  pM|$+@uO 9l$0D$ uO 1҅4$Qȃ1rUD$ ̓1D$4$>8dVT>8eVT>8fVT>8gV9u4$l$D$ t/|$@14$./9ul$|$ 1 |$4$1ƄfVfDŽdVD$D\$1ҋD$T> \> L>y ˁ ˋ$D$ L$|$(9l$ 999T$D\$l$|$4$GL$P t|$,t<$wX<$مt$jL$LU|$4t<$w<$D$UD$`^_[]Ë\$l$|$tL$0} |) D$x|D Mt$Z\$D$x D$ l$D$D$1D$0D$$;D$ l$$ (|L$|Łt+~#1D$@\$UPt9u\$U΃1wD$dVUP4!D$8D$D$D$ PD$l$D$ 9D$\$JD$x @$|9$D$>:>uPJ߃ $$l$!|$OD$1$$;T$$(Y Il$__aG|$\$#1|$t$L$T$„1v~\${z\$3pFz\$3lFzZl$5hF\$3dFt$v~\${z \$3pFz\$3lF:Zl$5hF\$3dFt$ 9[D$\$l$tKt$NQVpF|lFtxhFdFD$x1 USWV։X"D$tW<€Ѐ r<r Au)E=T$0\$V1Ʌ|$H$D$$D$(tcD$O~D TT$D$ IdXdX\$QWR D$T$(S]D$Nj\$_jtD$D$D$D$~@XXL$\XD$$E$fF t><J1АP>FF11+D$0dFƆhFdžlFfdžpFdžtFƆxFdž|FfdžF$D$(F dV\$Ut$LPf Ƅ.dVeV\$Wt$,V: >АʀЀ rՀr HuNjT$()ʉ|$DOt,t ;`L$0L$L|$H|$u L$j8tD$DD$@t$H<;t<,-T$($\$8,T$l\$8FdFD$XD$0D$`؉dFƆhFdžlFfdžpFtFD$TD$LD$\؉tFƆxF$|FfdžF11ɿQ<$t1:׉ډkd)в=uiǐ)$‹T$itp+9T$L$} $Yy։k1։|$ T$L$hF9L$$uD$L$D$ 9T$dύ$t$`MƉT$lt$\9|$t$Pt1+i)\P(\t$Pw  ףɋT$itQ9D$#|D$,‰t$,<$L$h|t$,)9(T$ T$8t$<|$ $T $t<$p;T$t$|;D$Pt$>>t$D$ L$,L$8D$$t$D$ L$D$ T$h‰T$8D$</T$,|$ uȋL$,;L$T$$CD$d:D$01+dFL$D$0|$$~zD$1 9T$$te>hF>qFu%D$+D$|$DߋD$tt$hF8t1+dFD$뒋D$؉dFƆhFdžlFfdžpF1+D$LtFƆxF$|FfdžFF|$DD$@FL$$Fu6L$TA T$XB ABIJFD$@!t$~L$+L$4D$@|fF|$DVUSWVՉ[ +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍØ1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށƌ1i4Q9uB ^_[]ÐUSWV0T$ $X1D$T$Dt14@lX~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ 麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$g)jhUt$ QT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9tl$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$L$D$|$s؉D$͉)пjjUt$fD$(|$\$jhUt$DL$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPy)jhUt$cU\$T1ڽT$\$jjdUR$)jhUt$t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$8X D$UyqY QT$QT$ Q T$0L$XI$L$}tMt$$xq*ƉѺʉkĉȋt$$D$|$(xѺωt$$ppD$$xqVй*щp;D$x кUUUƒD$ p Ɓlq!\$oTe^_[]RT$)1T$D$ kčIT$(T$@)D$$1L$+tFpnL$ 1ui)\P(\w ף1T$tr$T$ ui)\PT$(\wD$= ף먹QkdD$ +|$ |$ iʐ)ʉ\$(|$|$ ʼn ō@L$+~'G\$( |D$FQqPƔt$ OD$<|$sD$<D$,2|$ ED$D$,;D$<D$,D$D$ƋD$l$|$Ft jP~n~ e1^_[]fUSWV[[l$|$uaY!PQjFRt$u#tmY!PQjGR|$$uXVY!PQjHR1uN)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffUSWV[kl$t$|$u"ͣPQhR!U^_[]ÐUSWVP$[t$u"٣PQhR Ut,jtRx $Hp  19" xuxt)txu8u뮾U^_[]ÃUSWV[8 D$ P]   $ L$ܽ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ N~ u#t7Wyu^_[]ÐSWV[t$u"٣PQhR W}"  xuxt&t xu8ujTu $p@@  1WN}^_[ffUSWV[$$$t#uB5PQjPR$D$$DŽ$DŽ$$ jPp|$<jP}DŽ$TDŽ$XDŽ$\DŽ$ps1|$$d$t$l$x$d$$$P& $d7rx5PQjQR[T;$u ^_[]腊S[npt$t$Pt$t$G[ÐSWVP[;D$L$T$t$ 4$pVRWQP ^_[ÐSWVP[D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[ût$}XjWE`HM`~;Ep~ t EXHMX WRqjW^_[]ÐSWV[<L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[D$ L$ $XQPR[ÐSVP[ìD$L$T$$XRQPV0D^[fffffUSWV[h|$$t$ |$(u}XXPQj=R"t$t qTD$(H @1r<$tQt$uwUXXPQjQRj|$,W8G uy$‰Ņl1<$1qyQuE)ljuދl$$$)1t$ ōACAAAjQ˼Ջ)v1WPVӴ L$(9l$Q|uh}T$RPV蠴 L$(A)y-XXPQhRL$8A)AjQ6l$$jU%$+D$1t$ ʼn^_[]ffffSP[mD$ L$T$$RQPK[ÐSVP[<D$L$T$t$4$VRQPA^[fffffffUSWVP[t$|$uPQj>RPV|1踯ht$t$ p x=|Pxq0fF FfFfn vF$F,F( F $tjjjV^_[]fSWV[ |$u}+PQj;RjWRw jWN^_[ffSWV[ì|$W藑;D$w+t$9w 9w9w 9wPWV ^_[{fffffSV[MD$;D$wt$ Pt$Vi~ ^[<VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[|[USWV[t$u}f2PQj aV);F|V荮u?1FT$i.;Ft F t uVPu^_[]fffffUSWV[t$|$l$jU\pWVPUjUM^_[]ÐUSWV[àuMD$h$}$tkG0u ǀD$?u QD$xG t $W賯t} ;}n$PQh3RM}\$fxn$PQh4R}\$5G f ftE$u)rxn$PQhRG\$$X$DŽ$lDŽ$p$tjP-q$jPqDŽ$DŽ$DŽ$$`h jP MA f$Af$A$A,$AD$$X$$DŽ$DŽ$DŽ$$Vuu WƅxWk1Ƀ ΋D$h$@M9I @9D$,ED$|$T$D$D$ D$D$`D$dD$XD$(1ɋu~1_t%t됐L$4)L$P8ى2J֋T$ L$)L$T$ rcUҍ$\$tV$D$PR˥\$ D$D$ thp9L$PTC$}n$PQhR\$UL$wD$ L8D$'Ƅ$/D$4D$0D$T$ |$4ƉِAσ s&1L$0ȁ1ҍ$X1 D$xT$|$t$8$u $\QwPZƒ.D$ƒ;T$0v$D$8MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$0D$$xD$0|$\uƄ$/D$(t$P輾\$WrD$(L+D$L PD$L$W n|$ptD$'-D$D$\=\$4u#D$(8NT$ L$Lu]|$`o$mD$@T$ L$߃GD$DufЉڋL$dtL$0\$@|B9\$0|<)y1ɉL$0i|$`$$ɥ$D$8D$' L$0ӋT$L$Lt $0|$@Љڃ\$@م D$0tD$0ȉD$|$X|$@2|$XC9D$@9D$T1ҐT$H11ҀD$D$t\$@)D$‹D$HЉD$L$T\$@9$ťD$8D$%D$D$@D$HD$TD$D1)+$1 \$Ѻgfff)À0D$,L$ I<ϋD$, L$ IϋD$,L$ ID$,L$ IEHMPwEHMPEHMP1D$,L$ IEHMvEHM1D$ y1۸D$'-‰D$D$t$X1 D$t$u RjPjN1Ƀ,EHMT$|$PH8T$T$ ϋD$,L$ IϋD$,L$ I D$,L$ I8EHMEHMEHM8EHMT$L$PT$T$ JEHM1qEHM1wEHM1:EHMD$D$H$Q赧tO‹D$D$t1 $X׍D$tu $\Qt$ PRt W1ɉL$8L$(ɋU$|$0x<$|$0Wjt$@ |$\$4T$ tW+D$8L$0L$9GD$A$t$8uD$y"ͥnPQh&R賶\$4T$ D$D$'1D$@D$HD$T1EHM1D$EHM1D$ 1GEHM8EHM1D$EHM1D$ D$EHM1aEHMD$ ɉyD$'-11D$sEHM0EHM7EHM811ҋL$t! t L$t D$$/D$ȉD$'|$0x% D$tRD$@ uT|$0uM$|$$|$@|$D$@D$?% T$0t9\$UρD$? ٍ$$t$XPWt$ t$PQ$|$\$uM$t=\$|$T$?T$D$$t$Xt$HWt$ Pt$0(.Ǎ$|$8)D$e!D$1D$@D$HD$TD$D$D|$0\$4T$ |$ ;|$D$|$'$/L$Lt)L$\$PD$D%D$\$4|$L$ \$׋$GÉ\$L$ [Uu/$}n$PQhRU\$ۋ|$.$D$PR諌D$D$ $0|$'sG >$B\$L$ rʋUu/$}n$PQhR^U\$1ۅt<$D$PR1ۃD$D$ $Xg1ɍ$E|$|$'u5|$|$'u D$ $|$'txD$'BL$ D$D$L$ rHUi$D$PR'D$D$ $t $/Ƅ$.0$.BL$ D$D$L$ rLU6e$D$PR蛊D$D$ $t|$OGL$ \$׋$(GÉ\$L$ <Eu/$}n$PQhRBE\$ۋ|$$L$QPΉD$D$ $2G K$(B\$L$ rʋUu/$}n$PQhR莯U\$1ۅt<$D$PR1ۃD$D$ $X1ɍ$E|$$}n$PQhRUD$hD$ $$/$}n$PQhR覮UD$D$ $|$D$ $D$ +D$L$ |$|$ljЋ]D$G $(BD$D$L$ r‰څu/$}n$PQhRǭUD$D$t=$D$PRS]D$D$ $P1ɍ$;T$ $(\$ T$ B|$lj|$L$ E$L$QP跆D$D$ $L$4D$0|$D$DD$8D$BD$ÉD$D$ D$ EL$4D$0D$Dus뚐F$}n$PQhR&EL$D$ $L$4D$0|$D$D)|$L׃UD$DD$8GT$ D$ÉD$T$ Uu3$}n$PQhRkL$DU\$D$ۋ|$ $D$PRD$D$ $L$4D$`B|$\I׋D$(L$dȉD$L+D$8L$@9ɋ]D$8OD$ȉD$L$ L$ څu/$}n$PQhR{UD$$D$PR ]D$D$ $vD$8$XD$x$Y$XG\$ L$L$\$ +u/$}n$PQhR轩UL$1ۅ~$D$PRK1ۃD$D$ $P$}n$PQhRHL$DE\$IL$M $؃L$GÉsT$D$`|$[D$0$(D$BЋT$ L$L$L$T$ Eu3$}n$PQhRHEL$L$|$C$L$QPсD$D$ 1D$$L$ "'1ND$щЉډÐT$$ 0\$T$T$|$D1ҿ;|$|$DڋT$rÃ|$@B<0:|$D0.D$LD$҉|$8^ $ 1ۍ$D$`1ɍ$D$8T$dBGLL$CD$ Eu/$}n$PQhR˦EL$D$ɋ|$tT$L$QPSD$D$ D$ $L$4t/D$L$ L$4|$D$ $L$4D$0+D$dуNj]ʋL$ D$G $(BL$D$D$ r‰څu/$}n$PQhR跥UL$1ɅtB$D$PRG]D$D$ D$$1ɅOD$$4D$`\$ ]ʋL$ ϋ $( B|$L$GD$ څu/$}n$PQhRUL$D$ɋ|$tU$D$PRh~D$D$ $D$`L$4t-D$D$`ˋL$4|$1ۍ$D$`L$4É\$ \$\$CD$ $0D$`BEu7$}n$PQhRL$DET$T$ |$ U $L$QP}D$D$ $L$45 ( D$ $|$@)L$ D$D$׋$(G|$lj|$L$ REu/$}n$PQhREL$$L$QP|D$D$ $ D$G 9$(BD$D$L$ r‰څu/$}n$PQhRWUD$D$t=$D$PR{]D$D$ $PK1ɍ$;D$ 1D$$D$ D$D D$0u ыT$ D$x|$ GD$D$JL$ rEu/$}n$PQhRaEL$$L$QPzD$D$ 1D$$kKD$XD$ $D$@D$8|$XT$ t0D$Tƒ|$H|$8D$L9wD$8D$X]D$D D$0T$ u1D$x$X$XBL$ D$D$L$ Zڅu/$}n$PQhR&UD$7$D$PRy]D$D$ $|$0 L$ |$|$|$8|$8T$D$TuD$XUD$?|$ GD$D$L$ ruu/$}n$PQhR^UD$tG$D$PRxD$D$ D$$t'i D$D$ D$1ɍ$D$L+D$8T$X9ÅۉD$8ZD$\$ ؉D$D$AD$ UҋD$u/$}n$PQhRvUD$tM$D$PR xD$D$ D$$\$ t-} 1$D$ D$1ɍ$\$ D$X8)׋$(G|$lj|$L$ NEu/$}n$PQhR舝EL$$L$QPwD$D$ 1D$$r D$G 7$(BD$D$L$ r‹Uu/$}n$PQhRƜUD$D$t:$D$PRRvD$D$ $R1ɍ$?D$D$ 1D$$T$ T$҃\$H)ӃT$T)‹D$X|$8ljЅ‰\$H<47|$0ߋ$jj RWkA )ˀ0$D$$ËD$XD$H(|$@ ߉ىËT$DML$ߋ$jj T$HRW谑T$D )ـ0|$OL$Y|$|$8|$tL$H t9ϋ|$@uу rL$L\$KL$HytL$H\$D$AD$ $|$0D$ 1D$$D$\x Ћ]T$ ߃]T$ D$G D$BD$D$L$ rljڅu/$}n$PQhRUD$D$t=$D$PRs]D$D$ $U1ɍ$@]T$ |$:B|$lj|$|$AD$ ryڅۋ|$0D$u/$}n$PQhRXUD$$D$PRr]D$D$ $t Y|$0|$\D$(L$d+D$8|$09DžD$8zD$D$L$ L$ rqڅu/$}n$PQhR藘UD$t=$D$PR+r]D$D$ $t1D$ $D$0)L$ |$|$D$G $(BD$D$L$ r‰څu/$}n$PQhR觗UD$D$t=$D$PR3q]D$D$ $P1ɍ$;׋$(G|$lj|$L$ rwE|$u/$}n$PQhREL$tB$L$QP|pD$D$ $L$4t*L$4|$L$4D$ $D$DT$ L$ |$T$ \$C D$$B|$L$ rċUu/$}n$PQhRU|$1t:$D$PRxoD$D$ $T1ɍ$A|$UuS0T$ Ӌ$Clj|$L$ UrҋL$4L$4u:$}n$PQhRL$DU|$$D$PRnL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZXt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P wE|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $Pdž<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$"USWV [ƧD$ 069rljT$D$uj$jWPH >(79$T$JHJHJHJHJ H JH RPE$jWP ؉(щ8t!lj0t$荄贉0*)4$PjVՅ $L$D$ 81 ^_[]ffffUSWVP[ãEET$@t$DT$$dpU }LjjD$܋lT$\$8t$<EΉ7tƉP1t?D$|=WjP )mjRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]CUSWV׉[l$YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[Ӣm|$hE t$p |$<$ MM$U`jjl$l$܋l|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjP )mjQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]~ffffUSWV[0E\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$]uNjD$L$ttW% ?L$@\$D$4\$j؋E\$mju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋t܃|$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$dM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jadwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PeWD$P#dW`VD$P؋|$ |$(|$ |wD$0ufsD$\$t$WOe\$ Džjwc|$|$l\$WPe`؋L$1ҋD$DD$4D$RC_D$t/L$4t9t\$Q"_D$\$P_\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$+^T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$^eD$T$|$Z D$1e^_[]ÉL$D$4|$ \$D$0L$T$tWjt$`L$¸tQT$Rbu d$|$ \$T$~0vt@L$(t$$D$4|$0thjt$`¸ҋL$"QT$RaD$ |$9t$D$ 1|$ \$T$N|$9u@F9L$|$ \$T$@<9uF9uL$1nFd|$,D$|$ 0|$0t!|$9tD$ 1F|$ \$T$)|$ \$T$L$NfffffUSWV[8|$ t$nD$.t>L$$t6 ruLQUc$t?$L$Uai$1ynL$^_[]þT]n0ffffUSWV[Ët$|$l$t?xUGPQj5R;hu1 1 ^_[]fffVL$T$ tu1 ^Á1 ^fffffUSWV[ðM1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PKT\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$tW\$R&SD$PVD$ ,RL$ )M ~D$$Pt$ VL$ P_T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋t܃|$ۄ$܋҉t$$~@CM ~O$VSM$U mjQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋ك T$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtK+D$HD$T$,‹|$LD$~$RQOt,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$Q2QT$|$t$$$Y|$D~RD$T$ L$$jjt$H D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PRNDž~#T$?؋L$؃T$$jj QG |$@c΋$jj t$G ‹D$8 |$Dt$$$/L$|$D$D$t$QfFD$ t.L$t9t$QFFD$$P6FT$%T$$1|$D$Ȁy0ItL$RFL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wDO L$O ‰D$ t$QR 7 jt$MM|$D$ D$$t$|$ W_D$,t$WnNt$ t$Nt$t$,k$jj PE ljD$ D$L$L$D$D$QPƉ|$Wt$ Mt$ t$GNt$,N0L$ x $tPrDL$(T$D:Pt$ MVIDT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QD D$jj t$D NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VD D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$KL$ |$$F|$$t$t$ Z0D$ t$(Vt$bKt$t$z|$D$ jj QB D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPI\$ht$D$ PJugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ HD$I$t$t$ ID$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[sD$1r 1 9vW=t8Ɖ^_[ÐSWV[|sD$1r 1 9vWK=t:L$T$8ƃXt𐐐Xut^_[ÐSV[rD$ PHpR=^[USWV XrT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU5F|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[pSVH[pD$0hjPO D$(D$,DŽ$@DŽ$DD$ D$D$$jPjU L$(VPQjeD$$D$ D$D$D$D$D$jPjQ jQjYQS[oS[þofffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffUSWV[nt$|$uLݦPQj?RK1tt (h1^_[]ÐUSWV[k}uu[\$D$4PD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋƥt$(PV'T$4D$(wPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ D$p '3 |$4t$N  D$0P QVR| t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP/ 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}%"P"L$D$ffffUSWVt$F98[-: |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[C9u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[[8t$D$T$<n~,D$9r9s#L$9w)QjP ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX7ǀ, ǀ0 fǀ4 ǀ] fǀa ǀ= fǀA USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[L6D$H~( 1u 9r1$PƉ^[fUSWV[5L$H?t$P w t{ ?u1>PƅD$t/Fn?t$P裵FF ^_[]1?t$Px@ )ʉʁ oΉ@oUSWV[4t$tbF!r V[OH}t3$W}F  tW˴  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[3l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR] E!r&U-E!r\U1H}$$P蝲}T$,B ti4$u\H}th$$PS1}F  t14$-$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[.1j,tL$H@[ÐUSWV$[0D$9| 9}T$P7P|$, $r0wD$PjR  $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU 9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [Ã(E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[å%$t|1A1  ٧PQjERHP$1jjU͟ ʼn$tƒ9tt)D$P$Rts#D$ =uXtZfx $tu f~ $fFvF$F,F( F -OĀ^_[]fffffS[N$t$t$jt$[fffffSWV[$|$u}ZPQj=RjWbGHO~ H0 WjWC^_[ÐSV[Ý#t$ u}PQjIR^FHN~ H VL^[fffUSWV[;#t$uaX#PQj>Ratrt!w 11ҊNt\tGɍyw@ؐ+u˽뿁뷁 ՋL$) 1^_[]fSWV[L"|$f jWG0ǀǀ 1G t W ƋO twуy y w`G0tW@9t QGG00G0ǀǀjW G GG:}nPQj8R7f  ^_[f̀rS[!|[SV[ t$ u}ߨPQj;RF0u ǀVuFH^[SWV[Ì |$u}PQjJRM8uGG Ⱦ uuL O @G0taW@9t QG0GG81t&WG GGfG u WG t'HVEPV-GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐSV[ t$ u}'PQj;RF Ш u V1^[fSWV[üt$t`1mT$ |$L$D$t#t8uӉ6@VRQWP@26@VRQWP}6@VRQWPL^_[ÐXL$ AA A AAAÐfffffUSWV[$uthjh1$džt.%u%D$PQ1t+8$u!8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF40 DhjP$ t;$PQ|$=|F P/$FEt$P$FV EtF4Et UMtЅBt N&tEu0 hVn VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaF.j P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC(1Va(1^_[]14dž$j$tJpLHHH 0rPtot u8~)1 9}8tQ݋t PܐVdt81^_[]ÐSWV[ì|$tOW^_[ÐSV[mD$ p|$s t.jt$ 1dž,dž,^[S[L$tAt[[ÐSV[ýD$ p|$t_dž,1t$t$ ^[ÐSV[mD$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[L$(D$x)$xuLJ$LJ(LJ 11t f} t2nD$(tE9(G($19wJjjWQ}Ɖ鉅 hf}u A(9vA($9(LJ(u$kp:PQhR1(f|Eu;DEjVPWQ ƋhLJ(f}tf}LJ $z^p:PQhR1jAf|E@u(9LJ $LJ([LJ,^_[]Ë(L}w*jt$(t$(VRu‰w$ trT}t$t$ r|})ǁ$w<$_ t)׋t$ ~t$΋|$$7)ʉW $(15SWV[ì|$tU^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[8|$(o(o(OG0!D$;G9} $wD$D$ P$L$L$D$QPt$ $L$QjP t$$D$ Gjw: $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wi ^_[]ÐSV[t$ t$t$ #F,;F(~#F0^[ÐSWV[ö4aA.j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrUSWV[èD$ t$$|$ B~rکPQjbRBF 7f.ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]fffffffUSWV[û|$oEtjPu' EjWuEtPE EtPDžDžtPDžDžUyWpVt^_[]ÐUSWV[ø|$0D$,pFtjP6! Ft>^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6q 6Y 1KfffffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fSV[MD$;D$wt$ Pt$V) ^[YͪPQj5R=jjjPV1Ƀ $ȃ^[fffUSWV[$$$$u&>Y ֪PQj?R趴$ t$tm$xb$%GuR1<7vuN| '?0)щL$ $9rj/Pt-1ɋD$;$ȁĜ^_[]Él$ ,$}Xuj> tE9sލU,$D$)$hPT$ RQ$ $t#9<$v,$}/(9w$) $L$L$  D$tD$$t%ht$WXP $t* $hW8踸1Ƀ89t$1퐋D$(j?Pt$輒 tWH0tȋL$):,T$D$19u^D$PW8uk9t$u?)/ED$PW7E/1Ʌ#D$$=@1ɷ1Ƀ8dfffSV[D$;D$w.L$t$ 9w9w9w9wPQVb ^[dffUSWVT[ØED$PD$LD$HD$DD$@T$@P D$FD$FD$FD$FD$ F D$F$L$N|$ j@jD$P7 9tE;D$PuT^_[]ÍPTbUSWVx[øED$tĬtG\Vƅ@~ / 9E;D$tx^_[]ÍVSĬD$pD$lD$hD$dD$`D$\D$XD$TD$PD$LD$HD$DD$DL$T$dPb 1ɍT 08u y?u8 877PQRQ ,8PQOTƃĬVRjHJǃ#j9J11$j"J<$jjjhjWjD5tjWP4 u WV41VaT?PQ%1j"`ϰUSWV[e$E$ uD$|D$xD$tD$pL$0T$pP D$LFD$HFD$DFD$@FD$tD$ 9tU D$L$$D$(0jVD$0j Uܔ1^_[]ÐUSWV [&t$ T$r&YPPQhRӓT$fzfz~F l$$uBrکPQjbR艓ftB׍Bs811brکPQjbRG[1W)11lN.lN.lN.lN.9uمt# N1Ґ,Q.9uL$$DAfAfAl$$}E 4$uErکPQjbR舒ftH׍BsA11rکPQjbRC1)11l$$lMt$$.t$$lNt$$.t$$lNt$$.t$$lNt$$.l$$9ut' M1Ґ,Qt$$.l$$9uL$$EDfAA A jQD$0h^_[]ÐUSWVP׉ $[ul$D$fJfJ D D B uD5OP )fOfOɉEDDD5 L t5PQ#= D5tcju t$6ge twH jP6Bg 7E (D W)fWfW7PQR< ED7fGG G jWD$0f 1^_[]ø荒USWV4T$X$D$ D$PL$(f\$r+\$ FPQh|R\$D$xr(\$ کPQjbR膏\$D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$D$f;D$f9u(D$t$Tf9L$I T$ tT$LB4 t$4 L )\$LC T$ t փ L \$L$f9v>NL$TAʉT$T$LB4 t$4 D$f9w;L$,9D$$f9t7ŋT$HJ)fJfLBЃD$\$ Vt$P8:\$ r+\$ FPQhR貍\$9D$0g|$t(D$ tD$ Kf1D$A4-=r+\$ FPQhR2\$D$HfpT$(B(t>BL$;u3Bf9rfBt$f9s D$HBL$L J)fBff9|$vD$Pf)8D$LD$ދD$f91i\$\$L{ \$ Ńt$LF)fFfD^\$ QRP8 f9|$t$19t΋L$I T$ щt$\$\$L{ 4 L \$ VL$Tyʹ9\$\$L{ \$ 1/fy&\$ FPQhRdD$L$Lfif9uD$LfhD$4^_[]Ë\$ 莍fffffffUSWV[(|$8D$,hEtjPua E l$wJrr GE(uI1GT$0:zD$PVtHUD$PV|$a$ML$fMjPu` juu^ t1BQ A8E,jjuc^ ?fpjWu#` jt$u"^ DžwrکPQjbR:G or&کPQjbRwD/DD$ l$کPQjbR衈E,jju.] ǍD$ l$wrکt$ PjbQ8G GtfAjWu^ jVu\ Džxl$:蕍E(Err/D$T$ کPQjbRYD$$T$f9B$fD$},|$ f9{l$9aFjRu] jvu[ E‹npr׍کPQjbR襆|$qbjWjWl$u] <$wrکPQjbR3ft$><$fD$l$.E(uEft,$fD$$E($EfD$1OH$fD$u,9 GjRu=\ jwu=Z ftB :$f|$wrjRu[ jVuY 1rjRu[ tYjVuY `@=r'Ǎ֍کPQjbRjR*|$B uSfiDBtjR7 [ jV7 Y 1ul$$fl$1l$D$D$ B fyDBtjRu}Z jVuX t3xrکt$t$jbP蟃{$8t$EtPE EE($}fu E(jQt$  OfL$$Ɖl$;tjVuX 7GfD$Gft$fD$t $A4 ;tjt$unX $@jPujV :ʼnprکPQjbR老fw,$l$fwWt$U) t$l$whrکPQjbRf9u>pjPl$uW tljVuU fGOT$,‹OJ3t$ $;tjQu:W D$,0L$fHL$fH1^_[]Ë$;ujVD$0V ҸffffUSWV0[Cu~,jj6T &|$ NL$eL$A }HʋfqDBtjR7PV jV7ST L$D$xrکPQjbRc1fu(77)(QjP(v F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPu <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVt^_[]ÐYϕD$XPTPPPLPHP DP@P<@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[ޔt$t$t$ [ÐS[ît$ t$ F[ÐS[ÎL$T$ j[ÐSV[]t$ tA\j@PVP FPhjP(s F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPAi FP3nPtPWjPi UVj~jUi FPNHVLN@VDPV^_[]ÐSV[ýt$ tAj@PVKF FPhjPh F@FDFHFL^[ÐS[^t$t$t$ [ÐS[.t$ t$ [ÐSWV[ t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVkg ^_[fffffffT$D$fSVP[<D$L$t$$hjjjRQP  $^[ffffffUSWV[MD$$&yd\Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ < 1D$D$ D$D$L$8T$jjPQjRatD$8 D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$pL$L$FL$L$ǬL$߬L$&hjjjPQRD$L$8T$jjPQt$RL$81 ujP) _UiK1D:0D$D$D$ D$L$8T$jjPQjR`t$8|$<QPWVID$D$D$ D$L$8T$jjPQjRD$XL$ L$hjjjPQRM uMD$D$ D$L$8T$jjPQt$RtD$8ce^_[]fffffS[ހ [ÐUSWV$[øl$8D$D$D$D$ L$D$QPj ̬$P1t3 t!jVMDžu t$<$* ol$jVjA $^_[]Ë<$ېUSWV[~̬WtV6u\MaPƅt3\tUmuW0\tUmujW.^_[]ffS [ ~ t [D$D$$ T$jjPQjR0t1 uyl3PQjARZ 둸S\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[|l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQP>TOV QRPg ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPSt,NQW QRP FEE1^_[]ÐSWV[Y{D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [zT$0|$,D$(L$$)q092sVPQ$D$00$D$ jU0J+ Ÿtr|$9rL$EQPt$V jUD$(0,D$ )t+Ɖ4$juD$(0* ŅD$u1 ^_[]ÐUSWV[yL$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0, L$,+|$ $t*D$D$Pt$(L$njUD$,0+ 1ɉȃ^_[]ÐUSWV[x|$D$ hj07) tk@ uVxPQ4$9vDt$jW6F) t9<$)HL$PV9|$w jP7+ 1ɉȃ^_[]ùfffffff̀rS[Dw|[ḿ̀rS[$w|[̀rS[w|[S[v|[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[8v$D$D$huET1}8XM4tI$PBE8*$$E4E0|$ 1D$L$j`QPu8VR ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$PLT|$ WM$Ƅ$D$TPW t.$Ƅ$8u$L$ThPQ0 $ 1 $Y?l$$PW}$D$t2) $j UW$WaƄ,j W$U !RjD$$PU: ʼnQD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFCt_`u|$ <5$h$PW h$PWr U|$|$Tt$h$PW? |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$P4 E$$t8OltC$($,2D$XP$0V $0$$toOt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TP)$,$ $$t%(tPD$(PQ( $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tP$$t M"$($,uWP  t$l$$t$|$t$P^E$$8$j`C7t@8@P$i$t$|$t$PE$$t8L&t$l$tW$,$$t(SL?$($,t t$7$QP t$$t$$tP9$$tL$$sSWV[htM΋uA~8t:~4~"`N4F8 I9rP;FF8^_[ffffffUSWV[Åh$$$$$9$u t!6t$!P$VURQD$bI$>I+`|$ $L$1t2`r/j`PWD$ .$D$ `1t`rŃ`j`PWL$ #L$ `댃$t!$9b`Y|$ D$荫($ $` $hjD$ PE tF;EuED$E$D$ETt+hPt$$V Vbƃ t$ $tVD$PQ"L$ t$$uO$;$uSuO-wBI$uxT|$|$ $u5$t&aH0;$^_[]Ë$lD$|$ $$Pt uTd틴$L$t$T$9rD$Pt$U! 1gL$Y;L$OG :ffS[dD$L$ AQ jQ0" [ÐSWV[|d|$t$t+jP6 tH  W6^_[ff̀rS[d|[D$t8t9@€tuuuuH+D$ffUSWV^ƥc$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXbD$L$ht$dl$`u/t+t'\$γȳPQjkRa?L$x|$lu'\$؟ȳPQjlR3?L$x1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$Z D$$PT$)rh,D$GD$ \$UW|$t׉t$ l$Uуx6l$V\$t$ |$WT$tx:|$ 4l$l$x \$|$ Wt$T$tx|$|$D$؉D$ )\$VD$@P|$t׉UVуx4\$Ut$@VT$tyx\$Ut$@VT$tx|$+D$l$ \$UD$ PT$tD$ WUT$t|$ x!A\$|$Wl$ UT$tx($x \$t$|$ WT$tx|$l$|$\$V|$W|$t׉ljl$UVуx1T$|$\$ T\$t$Vl$UT$tx+T$|$\$ x#\$t$Vl$UT$txT$\$ |$,tPD$tY\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$VWT$tL$uӃ|$,\$h|$tOD$tY\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq21pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[ÌOt$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q-.SWV[ND$L$Pt prxxp| pPxtz xyV,1^_[ÐUSWV[XN|$ l$9v`wDt9xtNȅuT$81$Xq30<01*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y/ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p+ D$ L$Q$ЈA1ÐSV[MLt$ V P)tHP tQ P V)1^[ÐSWV[Kt$>gthGt tww$Ѓ gpNjPQwu;u<tww$Ѓ .^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[ÜJD$t$tA|$1ɐt 9u)tPjQG) ^_[fffffffUSWV[(Jt$0|$,ttq,TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P, Pt$8=t +l$1jt$81^_[]fffffffUSWV[XI|$(T$$tMtpGJB t zRty+ }JPQjGR%T$4uUJPQjHR%T$4h`+F \$/}u-D$ $$L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$a D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPOT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$L$T$( 9J9s\$VWPK t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[D|$tpjW0G 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;HW P7W& jW^_[]ÀO @1USWV[Ct$u}aPQjVR N 1tQ~tJ.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[lBt$u}ִPQj$$u"}"PQhR|$F=tYQPxI#L$1 ED$ht1FLu*N(1; E|^_[]Í-"PQhRX="PQhR1fS[Þ=jt$ [ÐUSWVP[z=H8|$t$F0P芽F0P9tnPj;F0Pt8PQ_jt$N0PǁTt!ǁXN0TtXXu\QjN0Qɼ^_[]ÐSWV[l<H8tR|$G0P脼G0PӿO09t,Pu'蹿O0PǁT 1T1Q+^_[ÐSV[;H8tJt$ F0PF0TuǀP8PF0P^[ÐSWV[l;H8tn|$t$F0P耻tF0Xuj\0F0TuǀP8P\F0P+^_[ffSV0[:D$<L$,QPF1;T$,uȃ0^[ff̀rS[Ä:|[SWV[l:|$t$uk`PQj9R)Wht,@V* ^_[fS[:L$T$ pPt$(t$(t$(t$(t$(t$([ÐUSWVՉ[9D$1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[{%l$$t$|$tu"bG PQhR-D$,tL$ z91Ʌ1^_[]ÐT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[í$t$u"~ PQhRkD$ t|$tT$t121Ҁ9 11^[ËD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[õ#$xЉׅtϋ$tRWPQ$$$4UhVH$yPVj S[.#t$jt$t$PUSWV[#$$$$xЉՅt$ t$RUPW$,$<QhVt$t;l$VPQhUJPUj tWD$ hjP' D$D$DŽ$DŽ$ L$VPQj$;$^_[]ǃP҃¿+w狔у̃ǃƒCS[.!t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[ê D$ D$D$$jVjt uƃ tjljj0jVj3 jIjfffffffSV0[ t$̀rS[T|[S[>jPt$t$t$[ffSVP[ D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[Ä|[PS[m[fffffffS[>H8t3[Ë[ffff̀rS[|[S[j1[ffSV[ u# V>u耑1 ^[Ðfffffff1ÐÐ1Ð1ÐX/ Ð1ÐÐUSWV,[l$D|$@ 0u"6 PQhRƃK$ f Fw =uЋ Ɛ=r4$UhW두 덋 |$@l$Dt= t2 9s8u+p ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]ÐfffffffUSWV[$$$D$@$t-u)jPQhR$  $$D$ D$8|$$l$ BE <%t9sߐD$D$D$,D$ l$\$4D$ L$ zt*[D$ H1 w71A*MЃ rl$ D$l$xD$떐l$D$느1퐐,AȉӍQЃ r܉l$,l$\$48 L$ tȉD$ L$$$L$,ɋ\$4\$,L$+D$ L$L$@L$1:lu D$ʋl$L$ L$L$r$D$yD$$TD$x!u4u uCu@ug $O $)ED$El$; $l$( $l$D$ $)l$ l$ ED$ l$( $f $l$f(L$L$ɋ<$D$ x7uu u"u /@t/<$l$D$oЍW$‹D$ L$-L$xL$ L$l$1͉l$1Ϲ,$D$D$ O?D$D$ Uf3 $ $D$DD$ cbD$,$D$u'u um@tl$ED$D$11$(uT$D$l$(PjUD$$- )L$9ȋ\$ȋT$D$,$D$u'u um@tl$ED$D$17fD$8D$ $u~ Ϩu @tɉgL$DD$D$DD$(\$,$ED$D$L$fD$8x1) $1BED$}D$1iED$}ЃD$K)A $T$l$ uL$ L$ʃ,$uʹD$T$T$D$ |$T$,$D$ xd$D$ T$8u$D$|$_te$\$|$ ؃E1ҿ9T$ T$8Ér$|$ À0ʼnD$1;|$l$ r͍iD$00 $rgD$D$\$4jj WP轔T$ tb )hPW Ƅ$'D$?D$D$ D$D$D$D$D$D$#$@-PD$PWt$ QR0E;$(u ,^_[]~ffffff̀rS[|[D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[ôuD$ Pjt*jP9x/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[uD$ Pj:t*jP艌x/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [E$0D$$$ $fEt$$,$,$,PhD$ Pjjj$@$@$@jU(ƅu]E $@tR$4hD$PVU ƅE t'4jjjPhD$PVUy ƅ~s$4WVD$PU<ƅyvE @t73$t'ZP'mEP'xEtLGP,G$OfWfw f VRQt$ Prr߾WU._D$;$u# ^_[]ÉGffuXyUSWV(]D$$$$@$<rjV^1t81ۀ.Qu닼$@9vy.Åt1eD$ 1ۅu\$D$#hPWVJt/$P$P$P$PPV1\$d9ٸu^T$L$\$$P$P$P$PjWVN\$ ƅF$<L$T$t$D$~D$D$ *D$sF D$D$ i^DFT$L$D$~HD$\$D$D$ ɋ$<t .u xuD$$P$P$P$PP$TRFT8=z$<1t<tu-D$ +$L!5u D$$<X1‹t у9#|$L$  \$$@D$u]D$D$D$ uA|$u:$P$P$P$PjW$T.Ɖ1t P$@|$ $<t.jPZ[D$;$$uL(^_[]þ|$t؉j$@[É뿉j됋$@D$L$/uUSWV [$ M$1@ u  tE;$4 ^_[]ÍaP詌tЍ.QPutƄ$T$` $D$1PhhRL$$t$ T$DH@u u{F$$RiT$D$u$DH@utD$(tDP@u Vu$,FPQW D7t$&ysUSWV[U$$$ $$@t-t[6$,$,PUQtRL$WUPhQ=s>$4$4$4$4U$0R&U=r,j$ X;$u;^_[]Åt|.u|$FUPQhWf;t$ s E$EtJyPEDt%uHPW u퍃PPxtkV[ML$0 ;$u ^_[]`USWV[kt$xPFLdžft91 9s)tQLDŽͅtMtt|b9utKxt PKW:džtPdžf^_[]ÐUSV[dEu jPo$D$F$FBbfF e^[]ÐUSWVx[EL$ L$pu D$jPyoD$3D$fGt$VjWV4 VWGL$ ;L$pue^_[]^USWV[kt$xPLJdž|$ft;19s)tQJDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[DD$Att$0UP8 EO $L$(T$ L$L$L$ F< t< tjt$V^ jPV] j PV] jPV] &:j PV] Yj PV] jPVz]  GjPV`] NjPVF] Qj PV,] GjPV] jPV\ ]jPV\ ejPV\ nj PV\  jPV\ jPVs\ $`FP!5d$/FP!|Gt^GddGtAPt$'F P{!|GGt PQ7< < {$H׋$ut$0UP> $P뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]DPVf?r?D$PVt$ D$L$Ƅ|$DPVf?r?D$PVt$ D$L$Ƅ($H^_[]ÐUSWVx[$$l3 h3 p; t|[9h@t[|x$D$D$%D$ D$D$D$ PjjjQtctt. T$tvƊt_`L$9 $|Gy $ DAD.D$8VlH9s .1%40PjO^_[]E]-%SV[ݫ4 tzX N98  QP蟃4 t{NDDDDD DDX .jUx4 tǃX ǃ8 ^[ÍUSWV[ j0xƋD$F PwFF耍(Ff~FF,4 t 8 1ҋL$9u<8 (FFF@FFFF,4 t8 9uD19u<8 zT |$R< L  @ 1>F(4 th8 9tF F$Fw(4 8 rT R< L  @ ^_[]19u뫐S[^6QPRʰ jSWV[,t$84 t38 9t^t,@ < zT 4 t78 9u 8 ~t v蹄V谄^[19uΐS[t$苄[ÐWVXL$ tsAQQBQQAA,4 tD8 49u48 4~T v< L @ ^_19uSWV[Lt$trT4 8 t/<t)@ < zT TQ9t$|$|WƋHL$T$TQ9vPt$ |$|WU&ƋHL$(T$P2Q D$ff|$(f}r#L$0IT$4RуDE9T$0vZVWƋHfyrD$0@T$4RЃTQ9v*t$4t$4VWk uR"t$4GT$0t$431ɀNG8G8tO(1;G4~ Wwp^_[]ÐUSWV]Řt$4\$0V{4ufr\$0K4T$Ns DDxKS !T$S$1҉|$9,$~t$ 4L$͋|$!E;l$\$08un19؋$p LL$08rT$0jjjjQPRT\$08mD$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$ j1Pj> V`1JуT$  1fljڋ$jt$8VPR$1ɃFttHT$*]tjLjfLjfw8\$$YJPQhRY\$T$ D$4@ftjf|jfDjfȃ^_[]Ë$VI1Ʌt‰ D$0L$ЃVhPt[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08sY1USWV[{T$B =t $|$ t<|$,t5|$$|$(j<WZT$ D@fw'uj֍PQh#RXF P=tfOtfO1 ŋJD~t-9$w$D$ u( D$ uD$D֋$;PD$ u fjT$Ty)‰T$ L$ʉL$‹D$Rt$VPT$ D$ Ɖt$)$ƋD$L$f xD$ L$fDy9f)tyfyuM|FaT$oPQhRNT$2|Fr"oPQhRN1<$V $D$D$ $09wЉl$$uL$D;QuLN)L$.Wt$P |$$)Hf,Nf?Ń$r)oPQhRMT$flFL$fLFt%f~t$t$<2tWŋpf~l$M|FoPQhRlM1$^_[]ÐUSWV[Xpt$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UxƋD$cPUT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σr+oPQhRK$E ʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]ÐUSWV[Èn|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ,u uhDnjt$Pt$0VvtRV tm9u.NWRVt t ^_[]ÐSWV[Lmt$|$LQjPQWvt2HfyuftfDHjWPVFu`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVt+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TNGDHjWPVt t&dž(@f8u$dž  ^_[]ÐUSWV[jzA =tl$$G)B fT$L$D$ uf͋t PH,$UjAA|$(todž(dž $FDGjRPVrtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$tL^_[]DGjt$ PVmr t׋@f8u$dž wSWV[\i|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[iT$$wA =tF)G D$ *$Ffu^L$t P?F4$jl?L$t$,t$,jWQPt$DFjWPQ,qtjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ. $JЃ^_[]ÐUSWV[øgt$0l$$D$jPj :|$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/202412140340Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20241213223245Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%untpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.0.8--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.0.8 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.8 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclasswaitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timeread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %sinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 router solicitation for %0.1f secondsipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: soliciting an IPv6 routeripv6nd_startrs1%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: DHCPv6 Vendor Class too big%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s%s: ADV %s from %s%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %sSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addressesdhcp6_startrequest%s: failed to request DHCPv6 address%s: no advertising IPv6 router wants DHCP%s: extending DHCPv6 lease%s: %s received from %sTIMEOUT6BOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 address%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebindSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist